[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ55328.1

[Show Plain Result]


## Summary of Sequence Search
    1::392
   24::388     2e-21  26%  399 aa  LIVB7_BRUAB RecName: Full=Leu/Ile/Val-binding protein homolog
   24::388     2e-21  26%  399 aa  LIVB7_BRUA2 RecName: Full=Leu/Ile/Val-binding protein homolog
   24::388     6e-21  25%  399 aa  LIVB7_BRUME RecName: Full=Leu/Ile/Val-binding protein homolog
   24::388     8e-21  25%  399 aa  LIVB7_BRUSU RecName: Full=Leu/Ile/Val-binding protein homolog
   31::364     2e-19  26%  406 aa  LIVB5_BRUSU RecName: Full=Leu/Ile/Val-binding protein homolog
   31::364     3e-19  26%  406 aa  LIVB5_BRUME RecName: Full=Leu/Ile/Val-binding protein homolog
   31::364     3e-19  26%  406 aa  LIVB5_BRUAB RecName: Full=Leu/Ile/Val-binding protein homolog
   31::364     3e-19  26%  406 aa  LIVB5_BRUA2 RecName: Full=Leu/Ile/Val-binding protein homolog
   28::348     6e-18  26%  373 aa  BRAC_PSEAE RecName: Full=Leucine-, isoleucine-, valine-,
   25::343     4e-15  27%  368 aa  LIVB3_BRUME RecName: Full=Leu/Ile/Val-binding protein homolog
   25::343     7e-14  25%  368 aa  LIVB3_BRUSU RecName: Full=Leu/Ile/Val-binding protein homolog
   28::315     3e-13  27%  403 aa  LIVB8_BRUSU RecName: Full=Leu/Ile/Val-binding protein homolog
   28::315     3e-13  27%  403 aa  LIVB8_BRUME RecName: Full=Leu/Ile/Val-binding protein homolog
   28::315     3e-13  27%  403 aa  LIVB8_BRUAB RecName: Full=Leu/Ile/Val-binding protein homolog
   28::315     3e-13  27%  403 aa  LIVB8_BRUA2 RecName: Full=Leu/Ile/Val-binding protein homolog
   22::340     2e-12  24%  365 aa  LIVJ_SALTY RecName: Full=Leu/Ile/Val/Thr-binding protein;       
   52::333     3e-12  27%  967 aa  GLR26_ARATH RecName: Full=Glutamate receptor 2.6;AltName:
   22::344     4e-12  23%  369 aa  LIVK_ECOLI RecName: Full=Leucine-specific-binding protein;       
   22::342     4e-12  24%  367 aa  LIVJ_ECOLI RecName: Full=Leu/Ile/Val-binding protein;       
   22::342     4e-12  24%  367 aa  LIVJ_ECOL6 RecName: Full=Leu/Ile/Val-binding protein;       
   22::342     4e-12  24%  367 aa  LIVJ_ECO57 RecName: Full=Leu/Ile/Val-binding protein;       
   22::344     1e-11  25%  369 aa  LIVK_SALTY RecName: Full=Leucine-specific-binding protein;       
   22::344     1e-11  25%  369 aa  LIVK_SALTI RecName: Full=Leucine-specific-binding protein;       
   25::294     5e-11  22%  390 aa  LIVB6_BRUSU RecName: Full=Leu/Ile/Val-binding protein homolog
   25::294     7e-11  22%  390 aa  LIVB6_BRUME RecName: Full=Leu/Ile/Val-binding protein homolog
   26::342     9e-11  23%  367 aa  LIVJ_CITFR RecName: Full=Leu/Ile/Val-binding protein;       
   25::294     1e-10  22%  390 aa  LIVB6_BRUAB RecName: Full=Leu/Ile/Val-binding protein homolog
   25::294     1e-10  22%  390 aa  LIVB6_BRUA2 RecName: Full=Leu/Ile/Val-binding protein homolog
   53::331     4e-10  26%  918 aa  GLR25_ARATH RecName: Full=Glutamate receptor 2.5;AltName:
   22::331     1e-09  25%  896 aa  GLR24_ARATH RecName: Full=Glutamate receptor 2.4;AltName:
   33::343     2e-09  23%  371 aa  LIVB2_BRUME RecName: Full=Leu/Ile/Val-binding protein homolog
   33::343     3e-09  23%  371 aa  LIVB2_BRUSU RecName: Full=Leu/Ile/Val-binding protein homolog
   17::343     5e-09  25%  385 aa  AMIC_PSEAE RecName: Full=Aliphatic amidase expression-regulating
   68::327     9e-09  26%  920 aa  GLR22_ARATH RecName: Full=Glutamate receptor 2.2;AltName:
   75::340     1e-07  24%  952 aa  GLR27_ARATH RecName: Full=Glutamate receptor 2.7;AltName:
   66::331     2e-07  25%  940 aa  GLR29_ARATH RecName: Full=Glutamate receptor 2.9;AltName:
   41::323     5e-07  23%  921 aa  GLR37_ARATH RecName: Full=Glutamate receptor 3.7;AltName:
   71::356     6e-07  23%  959 aa  GLR34_ARATH RecName: Full=Glutamate receptor 3.4;       
   33::290     1e-06  24%  371 aa  LIVB1_BRUAB RecName: Full=Leu/Ile/Val-binding protein homolog
   33::290     1e-06  24%  371 aa  LIVB1_BRUA2 RecName: Full=Leu/Ile/Val-binding protein homolog
   68::229     1e-06  26%  901 aa  GLR21_ARATH RecName: Full=Glutamate receptor 2.1;AltName:
   69::207     4e-06  28%  947 aa  GLR28_ARATH RecName: Full=Glutamate receptor 2.8;AltName:
   66::129     4e-06  33%  895 aa  GLR23_ARATH RecName: Full=Glutamate receptor 2.3;AltName:
   33::343     1e-05  23%  371 aa  LIVB2_BRUAB RecName: Full=Leu/Ile/Val-binding protein homolog
   33::343     1e-05  23%  371 aa  LIVB2_BRUA2 RecName: Full=Leu/Ile/Val-binding protein homolog
   33::289     3e-05  24%  371 aa  LIVB1_BRUME RecName: Full=Leu/Ile/Val-binding protein homolog
   33::289     3e-05  23%  371 aa  LIVB1_BRUSU RecName: Full=Leu/Ile/Val-binding protein homolog
   58::349     8e-05  24%  953 aa  GLR35_ARATH RecName: Full=Glutamate receptor 3.5;AltName:
   84::155     1e-04  34%  312 aa  MDH_BACSU RecName: Full=Malate dehydrogenase;       
   84::155     2e-04  34%  312 aa  MDH_BACCN RecName: Full=Malate dehydrogenase;         EC=1.1.1.37;
   84::155     2e-04  34%  312 aa  MDH_BACA2 RecName: Full=Malate dehydrogenase;         EC=1.1.1.37;
   59::185     2e-04  25%  938 aa  GLR31_ORYSJ RecName: Full=Glutamate receptor 3.1;AltName:
   84::155     3e-04  31%  312 aa  MDH_BACLD RecName: Full=Malate dehydrogenase;         EC=1.1.1.37;
   84::155     5e-04  32%  312 aa  MDH_BACWK RecName: Full=Malate dehydrogenase;         EC=1.1.1.37;
   84::155     5e-04  34%  312 aa  MDH_BACP2 RecName: Full=Malate dehydrogenase;         EC=1.1.1.37;
   84::176     5e-04  31%  314 aa  MDH_BACHD RecName: Full=Malate dehydrogenase;         EC=1.1.1.37;
   27::126     5e-04  31%  921 aa  GLR31_ARATH RecName: Full=Glutamate receptor 3.1;       
    1::392

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGEGLPDTIKIMSIKEMTGPVSFAGENSTKGIDL
LIVB7_BRUAB     --------------------------------------------IKMGSLYPFSGPLALLGDESARGLEI
LIVB7_BRUA2     --------------------------------------------IKMGSLYPFSGPLALLGDESARGLEI
LIVB7_BRUME     --------------------------------------------IKMGSLYPFSGPLALLGDESARGLEI
LIVB7_BRUSU     --------------------------------------------IKMGSLYPFSGPLALLGDESARGLEI
LIVB5_BRUSU     ------------------------------------------DVITLGASVQLSGPVANTGRYYQDAYNI
LIVB5_BRUME     ------------------------------------------DVITLGASVQLSGPVANTGRYYQDAYNI
LIVB5_BRUAB     ------------------------------------------DVITLGASVQLSGPVANTGRYYQDAYNI
LIVB5_BRUA2     ------------------------------------------DVITLGASVQLSGPVANTGRYYQDAYNI
BRAC_PSEAE      ------------------------------------------DTIKIALAGPVTGPVAQYGDMQRAGALM
LIVB3_BRUME     --------------------------------------------ITIGVIAPLTGPVAAFGDQVKKGAET
LIVB3_BRUSU     --------------------------------------------ITIGVIAPLTGPVAAFGDQVKKGAET
LIVB8_BRUSU     --------------------------------------------VKFGSLYPISGSLALLGEESARGLEL
LIVB8_BRUME     --------------------------------------------VKFGSLYPISGSLALLGEESARGLEL
LIVB8_BRUAB     --------------------------------------------VKFGSLYPISGSLALLGEESARGLEL
LIVB8_BRUA2     --------------------------------------------VKFGSLYPISGSLALLGEESARGLEL
LIVJ_SALTY      ------------------------------------------DDIKVAVVGAMSGPVAQYGDQEFTGAEQ
GLR26_ARATH     ---------------------------------------------------------------SLRAINM
LIVK_ECOLI      ----------------------------------------MADDIKVAVVGAMSGPIAQWGDMEFNGARQ
LIVJ_ECOLI      ----------------------------------------LAEDIKVAVVGAMSGPVAQYGDQEFTGAEQ
LIVJ_ECOL6      ----------------------------------------LAEDIKVAVVGAMSGPVAQYGDQEFTGAEQ
LIVJ_ECO57      ----------------------------------------LAEDIKVAVVGAMSGPVAQYGDQEFTGAEQ
LIVK_SALTY      ----------------------------------------MADDIKVAIVGAMSGPVAQWGDMEFNGARQ
LIVK_SALTI      ----------------------------------------MADDIKVAIVGAMSGPVAQWGDMEFNGARQ
LIVB6_BRUSU     ---------------------------------------------KVGVIGPFSGPFALQGKNFKAGIDA
LIVB6_BRUME     ---------------------------------------------KVGVIGPFSGPFALQGKNFKAGIDA
LIVJ_CITFR      --------------------------------------------IKVAVVGAMSGPVAQYGDQEFTGAEQ
LIVB6_BRUAB     ---------------------------------------------KVGVIGPFSGPFALQGKNFKAGIDA
LIVB6_BRUA2     ---------------------------------------------KVGVIGPFSGPFALQGKNFKAGIDA
GLR25_ARATH     ---------------------------------------------------------------SLRAINM
GLR24_ARATH     -------------------------------------GKGQNTTIQVINVGVVTDVGTTASNLSLLAINM
LIVB2_BRUME     ----------------------------------------------------LTGSQAAFGEQIKRGVEA
LIVB2_BRUSU     ----------------------------------------------------LTGSQAAFGEQIKRGVEA
AMIC_PSEAE      -----------------------------------------------------TGVTADIERSQRYGALL
GLR22_ARATH     ----------------------------------------------------------------------
GLR27_ARATH     ----------------------------------------------------------------------
GLR29_ARATH     ----------------------------------------------------------------------
GLR37_ARATH     ---------------------------------------------------------SVIGRAAKVALEA
GLR34_ARATH     ---------------------------------------------------------SFIGRAAKPAVKA
LIVB1_BRUAB     ----------------------------------------------------VTGPNAVYGAQIQKGAEA
LIVB1_BRUA2     ----------------------------------------------------VTGPNAVYGAQIQKGAEA
GLR21_ARATH     ----------------------------------------------------------------------
GLR28_ARATH     ----------------------------------------------------------------------
GLR23_ARATH     ----------------------------------------------------------------------
LIVB2_BRUAB     ----------------------------------------------------LTGSQAAFGEQIKRGVEA
LIVB2_BRUA2     ----------------------------------------------------LTGSQAAFGEQIKRGVEA
LIVB1_BRUME     ----------------------------------------------------VTGPNAVYGAQIQKGAEA
LIVB1_BRUSU     ----------------------------------------------------VTGPNAVYGAQIQKGAEA
GLR35_ARATH     ---------------------------------------------------------SFIGRAAKLAFVA
MDH_BACSU       ----------------------------------------------------------------------
MDH_BACCN       ----------------------------------------------------------------------
MDH_BACA2       ----------------------------------------------------------------------
GLR31_ORYSJ     ----------------------------------------------------------------------
MDH_BACLD       ----------------------------------------------------------------------
MDH_BACWK       ----------------------------------------------------------------------
MDH_BACP2       ----------------------------------------------------------------------
MDH_BACHD       ----------------------------------------------------------------------
GLR31_ARATH     -----------------------------------------PPVIKVGAI---FGLNTMYGETANIAFKA


                         .         .         *         .         .         .         .:140
query           AVEQINEQGFLGDTKLEIDLKDASDSTQEAASLATQAVSDKSYSAILGPGLSSQASAISPIAEKGEIPVI
LIVB7_BRUAB     AVEEINAKGGVQGEKIVLVRGDAVDNNQ-AIGEARRLISVENVAGIFGSFSSGRAVAASQVSELAGVP--
LIVB7_BRUA2     AVEEINAKGGVQGEKIVLVRGDAVDNNQ-AIGEARRLISVENVAGIFGSFSSGRAVAASQVSELAGVP--
LIVB7_BRUME     AVEEINAKGGVQGEKIVLVRGDAVDNNQ-AIGEARRLISVENVAGIFGSFSSGRAVAASQVSELAGLP--
LIVB7_BRUSU     AVEEINAKGGVQGEKIVLVRGDAVDNNQ-AIGEARRLISVENVAGIFGTFSSGRAVAASQVSELAGVP--
LIVB5_BRUSU     TIDKINAAGGVKPYKLALKIYDNQSNVNLSVRQYTQLVTTDKVNFLLGPFASNFALADSVISEKYRIPMV
LIVB5_BRUME     TIDKINAAGGVKPYKLALKIYDNQSNVNLSVRQYTQLVTTDKVNFLLGPFASNFALADSVISEKYRIPMV
LIVB5_BRUAB     TIDKINAAGGVKPYKLALKIYDNQSNVNLSVRQYTQLVTTDKVNFLLGPFASNFALADSVISEKYRIPMV
LIVB5_BRUA2     TIDKINAAGGVKPYKLALKIYDNQSNVNLSVRQYTQLVTTDKVNFLLGPFASNFALADSVISEKYRIPMV
BRAC_PSEAE      AIEQINKAGGVNGAQLEVIYDDACDPXXXXXXXXXXXXXXXXF--VVGHVCSSSTQPATDIYEDEGVLMI
LIVB3_BRUME     AVEVINKAGGIKGEKVVLKFADDAGEPKQGVSAANQIVGDKFVVGLVTTGVAVPVSDV--LSENGVLMVT
LIVB3_BRUSU     AVEVINKAGGIKGEKVVLKFADDAGEPKQGVSAANQIVGDGIKFXXXXXXXXXXXXXSDVLSENGVLMVT
LIVB8_BRUSU     AVDEVNAAGGIKGEKVVLERGDAVDNNQ-ATGEARRLISLVGVKAIFGTYSSARVIAASQVSELAGIPYF
LIVB8_BRUME     AVDEVNAAGGIKGEKVVLERGDAVDNNQ-ATGEARRLISLVGVKAIFGTYSSARVIAASQVSELAGIPYF
LIVB8_BRUAB     AVDEVNAAGGIKGEKVVLERGDAVDNNQ-ATGEARRLISLVGVKAIFGTYSSARVIAASQVSELAGIPYF
LIVB8_BRUA2     AVDEVNAAGGIKGEKVVLERGDAVDNNQ-ATGEARRLISLVGVKAIFGTYSSARVIAASQVSELAGIPYF
LIVJ_SALTY      AIADINAKGGIGDKLVAVKYDDACDPKQXXXXXXXXXXDGIKY--VIGHLCSSSTQPASDIYEDEGILMI
GLR26_ARATH     SLSEFTHNGF--KTRIVLNIRDSKRTVVGAAASALYLIKKREVVAIIGPGNSMQAPFLINLGNQSQVPII
LIVK_ECOLI      AIKDINAKGGIGDKLVGVEYDDACDPKQ-AVAVANKIVND-GIKYVIGHLCSSSTQPASDIYEDEGILMI
LIVJ_ECOLI      AVADINAKGGIKGNKLQIKYDDACDPKQXXXXXXXXXXDGIKY--VIGHLCSSSTQPASDIYEDEGILMI
LIVJ_ECOL6      AVADINAKGGIKGNKLQIKYDDACDPKQXXXXXXXXXXDGIKY--VIGHLCSSSTQPASDIYEDEGILMI
LIVJ_ECO57      AVADINAKGGIKGNKLQIKYDDACDPKQXXXXXXXXXXDGIKY--VIGHLCSSSTQPASDIYEDEGILMI
LIVK_SALTY      AIKDINAKGGIGDKLVGVEYDDACDPKQ-AVAVANKIVND-GIQYVIGHLCSSSTQPASDIYEDEGILMI
LIVK_SALTI      AIKDINAKGGIGDKLVGVEYDDACDPKQ-AVAVANKIVND-GIQYVIGHLCSSSTQPASDIYEDEGILMI
LIVB6_BRUSU     YMAEHGNK--VGDDTVEVVYRDVPQADPQSKALAQELVVKEGVQYLAGFYFTPDAMAVTPILKQGNVPMV
LIVB6_BRUME     YMAEHGNK--VGDDTVEVVYRDVPQADPQSKALAQELVVKEGVQYLAGFYFTPDAMAVTPILKQGNVPMV
LIVJ_CITFR      AIADINAKGGVGDKLVMVKYDDACDPKQXXXXXXXXXXDGIKY--VIGHLCSSSTQPASDIYEDEGILMI
LIVB6_BRUAB     YMAEHGNK--VGDDTVEVVYRDVPQADPQSKALAQELVVKEGVQYLAGFYFTPDAMAVTPILKQGNVPMV
LIVB6_BRUA2     YMAEHGNK--VGDDTVEVVYRDVPQADPQSKALAQELVVKEGVQYLAGFYFTPDAMAVTPILKQGNVPMV
GLR25_ARATH     SLSEFTHNGF--KTRIVLNVRDSKQTVVGAAASALYLIKKREVVAIIGPGTSMQAPFLINLGNQSKVPII
GLR24_ARATH     SLSDFYSSRPESRTRLLLNFADSRDDVVGXXXXXLDLIKNKEVKAILGPRTTMQASFVIEVGQKSQVPII
LIVB2_BRUME     AVAEANAKGGMNGEQITLVYGDDAADSKQGISVANKFVGDKFVIGHFNSGVSIPTSDI--YAENG---VL
LIVB2_BRUSU     AVAEANAKGGMNGEQITLVYGDDAADPKQGISVANKFVGDKFVIGHFNSGVSIPTSDI--YAENG---VL
AMIC_PSEAE      AVEQLNREGGVGGRPIETLSQDPGGDPDRYRLCAEDFIRNRGVRFLVGCYMSHTRKAVMPVVERADALLC
GLR22_ARATH     -------------TRLVVNVGDSKNDVVGAATAAIDLIKNKQVKAILGPWTSMQAHFLIEIGQKSRVPVV
GLR27_ARATH     -------------TRLAIHIRDSMEDVVQASSAALDLIKNEQVSAIIGPRTSMQAEFMIRLADKSQVPTI
GLR29_ARATH     -------------TRLTLHVRDSMEDTVQASAAALDLIKTEQVSAIIGPINSMQADFMIKLANKTQVPTI
GLR37_ARATH     AVSDVNDKSFLKETELRLLMEDSACNVFRGSFGAFELL-EKEVVAMIGPISSSVAHTISDIAKGLHFPLV
GLR34_ARATH     AMDDVNDQSVLKGIKLNIIFQDSNCSGFIGTMGALQLMENKVVAAI-GPQSSGIAHMISYVANELHVPLL
LIVB1_BRUAB     AIKEVNDAGGINGEKIAITIGDDVSDPKQGISVANKFAADKFVIGHFNSGVTIPASQV--YAENGILEI-
LIVB1_BRUA2     AIKEVNDAGGINGEKIAITIGDDVSDPKQGISVANKFAADKFVIGHFNSGVTIPASQV--YAENGILEI-
GLR21_ARATH     -------------TRLVTTVVDSKNDVVTXXXXXLDLITNKEVKAILGPWTSMQAQFMIEMGQKSQVPIV
GLR28_ARATH     -------------TRLALHVRDSMKDTVQASAAALDLIQNEQVSAIIGPIDSMQAKFMIKLANKTQVPTI
GLR23_ARATH     ------------ETRLVVNVGDSKSDVVGAAIAALDLIKNKQVKAILGPWTSMQAHFLIEIGQKSRVPIV
LIVB2_BRUAB     AVAEANAKGGMNGEQITLVYGDDAADPKQGISVANKFVGDKFVIGHFNSGVSIPTSDI--YAENG---VL
LIVB2_BRUA2     AVAEANAKGGMNGEQITLVYGDDAADPKQGISVANKFVGDKFVIGHFNSGVSIPTSDI--YAENG---VL
LIVB1_BRUME     AIKEVNDAGGINGEKIAITIGDDVSDPKQGISVANKFAADKFVIGHFNSGVTIPASQV--YAENGILEI-
LIVB1_BRUSU     AIKEVNDAGGINGEKIAITIGDDVSDPKQGISVANKFAADKFVIGHFNSGVTIPASQV--YAENGILEI-
GLR35_ARATH     AIEDINDQSILRGTKLNIVFQDTNCSGFVGTMGALQLMENKVVAAI-GPQSSGIGHIISHVANELHVPFL
MDH_BACSU       ----------------------------------------------------------------------
MDH_BACCN       ----------------------------------------------------------------------
MDH_BACA2       ----------------------------------------------------------------------
GLR31_ORYSJ     -----NDSNILPGTKLDLHMHDSSCNRFLGIVQALQFM-EKDTVAIIGPLSSTTAHVLSHLANELHVPLM
MDH_BACLD       ----------------------------------------------------------------------
MDH_BACWK       ----------------------------------------------------------------------
MDH_BACP2       ----------------------------------------------------------------------
MDH_BACHD       ----------------------------------------------------------------------
GLR31_ARATH     AEEDVNDPSFLGGSKLRILMNDAKRSGFLSIMGALQFM-ETDVVAIIGPQTSIMAHVLSHLANELTVPML


                         +         .         .         .         .         *         .:210
query           YYQAGSDGVLVGDYTYRVTAPAASYYHIIGDYLAEKKVKTAAVLYTSGNPTLTELGEKAVPGVIEENGVT
LIVB7_BRUAB     YFELGAVADEITDNVYRANPYARDFAQMIVEMLQKKDLKIAVIYEDSSYGTSVAKHEET---FLKEAGLN
LIVB7_BRUA2     YFELGAVADEITDNVYRANPYARDFAQMIVEMLQKKDLKIAVIYEDSSYGTSVAKHEET---FLKEAGLN
LIVB7_BRUME     YFELGAVADEITDNVYRANPYARDFAQMIVEMLQKKDLKIAVIYEDSSYGTSVAKHEET---FLKEAGLN
LIVB7_BRUSU     YFELGAVADEITDNVYRANPYARDFAQMIVEMLQKKDLKIAVIYEDSSYGTSVAKHEET---FLKEAGLN
LIVB5_BRUSU     QGGGASDEIYSRNYIFGTLAPASNYFGSTVEMLLDPKVTNVALVYADDSFDISV--ADGTRKLLKDAGFT
LIVB5_BRUME     QGGGASDEIYSRNYIFGTLAPASNYFGSTVEMLLDPKVTNVALVYADDSFDVSV--ADGTRKLLKDAGFT
LIVB5_BRUAB     QGGGASDEIYSRNYIFGTLAPASNYFGSTVEMLLDPKVTNVALVYADDSFDVSV--ADGTRKLLKDAGFT
LIVB5_BRUA2     QGGGASDEIYSRNYIFGTLAPASNYFGSTVEMLLDPKVTNVALVYADDSFDVSV--ADGTRKLLKDAGFT
BRAC_PSEAE      TPSATAPEITSRGYKFRTIGLDNMQGPVAGKFIAERKDKTIAVLHDKGEGIATE-----VKKTVEDAGIK
LIVB3_BRUME     PTATGPDLTARGENVFRTCGRDGQQAEVMADYLKNMKDKKVAVIHDKG--AYGKGLADAFKAAINKGGIT
LIVB3_BRUSU     PTATGPDLTARGENVFRTCGRDDQQAEVMADYLKNMKDKKVAVIHDKG--AYGKGLADAFKAAINKGGIT
LIVB8_BRUSU     EMGAVADEVTGRQYLFRTNPTAENMAKDSVDMLIKKDMKIGIIYEDSSYGT-------SVAGHQEDNGLT
LIVB8_BRUME     EMGAVADEVTGRQYLFRTNPTAENMAKDSVDMLIKKDMKIGIIYEDSSYGT-------SVAGHQEDNGLT
LIVB8_BRUAB     EMGAVADEVTGRQYLFRTNPTAENMAKDSVDMLIKKDMKIGIIYEDSSYGT-------SVAGHQEDNGLT
LIVB8_BRUA2     EMGAVADEVTGRQYLFRTNPTAENMAKDSVDMLIKKDMKIGIIYEDSSYGT-------SVAGHQEDNGLT
LIVJ_SALTY      TPAATAPELTARGYVLRTTGLDSDQGPTAAKYILE-KVKPQRIAIIHDKQQYGEGLARAVQDGLKKGGVN
GLR26_ARATH     SFSASSPVLLRSPYFIRATHDDSSQVHAISAIIESFRWREVVPIYAD-----NEFGEGILPYLVQEINVR
LIVK_ECOLI      SPGATNPELTQRGYQHRTAGLDSSQGPTAAKYILE-TVKPQRIAIIHDKQQYGEGLARSVQDGLKAANAN
LIVJ_ECOLI      TPAATAPELTARGYILRTTGLDSDQGPTAAKYILE-KVKPQRIAIVHDKQQYGEGLARAVQDGLKKGNAN
LIVJ_ECOL6      TPAATAPELTARGYILRTTGLDSDQGPTAAKYILE-KVKPQRIAIVHDKQQYGEGLARAVQDGLKKGNAN
LIVJ_ECO57      TPAATAPELTARGYILRTTGLDSDQGPTAAKYILE-KVKPQRIAIVHDKQQYGEGLARAVQDGLKKGNAN
LIVK_SALTY      SPGATNPELTQRGYQYRTAGLDSSQGPTAAKYILE-TVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNAN
LIVK_SALTI      SPGATNPELTQRGYQYRTAGLDSSQGPTAAKYILE-TVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNAN
LIVB6_BRUSU     VMNAATSSIVTSPYVVRTSFTTWQTSTPIARVALDKGVKKVISVVSDYGPGVD--AENAFKAAFTDAGGE
LIVB6_BRUME     VMNAATSSIVTSPYVVRTSFTTWQTSTPIARVALDKGVKKVISVVSDYGPGVD--AENAFKAAFTDAGGE
LIVJ_CITFR      TPAATAPELTARGYVLRTTGLDSDQGPTAAKYIVE-KVKPKRIAIVHDKQQYGEGLARSVQDNLKKANAD
LIVB6_BRUAB     VMNAATSSIVTSPYVVRTSFTTWQTSTPIARVALDKGVKKVISVVSDYGPGVD--AENAFKAAFTDAGGE
LIVB6_BRUA2     VMNAATSSIVTSPYVVRTSFTTWQTSTPIARVALDKGVKKVISVVSDYGPGVD--AENAFKAAFTDAGGE
GLR25_ARATH     SFSATSPDSLRSPYFIRATHDDSSQVQAISAIIESFRWREVVPIYVD-----NEFGEGILPNLVQEINVR
GLR24_ARATH     SFSATSPFLDSGPYFFRSTYDDSSQVQAISEIIKVFGWREVVPVYEN-----NAFGEGIMPGLTDAQAIN
LIVB2_BRUME     MIAPGTTNPTFTENTFRTCRRDDKQGIVAGKYMADNYKDGKVAILHDKTPYGQGLADETKKS-LNENGMK
LIVB2_BRUSU     MIAPGTTNPTFTENTFRTCRRDDKQGIVAGKYMADNYKDGKVAILHDKTPYGQGLADETKKS-LNENGMK
AMIC_PSEAE      YFEYSPNIVYGGPAPNQNSAPLAAY--LIRHY-GERVVFIGSIYPRESNHVMRHLYRQHGGTVLEEIYIP
GLR22_ARATH     SYSATSPSLLRSPYFFRATYEDSSQVHAIKAIIKLFGWREVVPVYIDNT-----FGEGIMPRLLQDINVR
GLR27_ARATH     TFSATCPLLINSPYFVRATLDDSSQVKAIAAIVKSFGWRNVVAIYVD-----NEFGEGILPDALQDVQAF
GLR29_ARATH     TFSATSPLLIKSPYFVRATIDDSSQVRAIASIFKFFRWRRVVAIYVD-----NEFGEGFMPFLFDAQDVE
GLR37_ARATH     SFAATDPSALQFPFFLRTTPNDAHQMSALVDLINFYGWKEVISVYSD-----DELGRNGVSALDDESRIS
GLR34_ARATH     SFGATDPTLSSLQFPYFLRTTQNDYFHAIADFLSYSGWRQVIAIFVDGRNGISVLGDVLAK---KRSRIS
LIVB1_BRUAB     -----SPGATNPQYTFRTCGRDDQQGTVAGQYIFDHKDAKIAVIHDKGQGLADETKKK-----LNELGTK
LIVB1_BRUA2     -----SPGATNPQYTFRTCGRDDQQGTVAGQYIFDHKDAKIAVIHDKGQGLADETKKK-----LNELGTK
GLR21_ARATH     TYSATSPSLIRSQYFFRATYDDSSQVHAIKEIIKLFGWREVAPVYVDDT-----FGEGIMPDVLQEINVR
GLR28_ARATH     SFSATSPLLIKSDYFVRGTIDDSYQVKAIAAIFESFGWRSVVAIYVD-----NELGEGIMPYLFDAQDVQ
GLR23_ARATH     SYSATS----------------------------------------------------------------
LIVB2_BRUAB     MIAPGTTNPTFTENTFRTCRRDDKQGIVPGKYMADNKDGKVAILHDKGQGLADETKKK-----LNELGTK
LIVB2_BRUA2     MIAPGTTNPTFTENTFRTCRRDDKQGIVPGKYMADNKDGKVAILHDKGQGLADETKKK-----LNELGTK
LIVB1_BRUME     -----SPGATNPQYTFRTCGRDDQQGTVAGQYIFDKDAKIAVVHDKTGQGLADETKKK-----LNELGTK
LIVB1_BRUSU     -----SPGATNPQYTFRTCGRDDQQGTVAGQYIFDHKDAKIAVIHDKGQGLADETKKK-----LNELGTK
GLR35_ARATH     SFAATDPTLSSLQYPYFLRTTQNDYFQMITDFVSYFRWREVVAIFVDGRNGISVLGDALAK---KRAKIS
MDH_BACSU       -------------------------------------------------------------GIARKPGMS
MDH_BACCN       -------------------------------------------------------------GIARKPGMS
MDH_BACA2       -------------------------------------------------------------GIARKPGMS
GLR31_ORYSJ     SFSATDPTLSSLEYPFFVRTTVSDQFQMLVEYYGWKQVTTIFVDNDYGRNAISSLGDE------------
MDH_BACLD       -------------------------------------------------------------GIARKPGMS
MDH_BACWK       -------------------------------------------------------------GIARKPGMS
MDH_BACP2       -------------------------------------------------------------GIARKPGMS
MDH_BACHD       -------------------------------------------------------------GIARKPGMS
GLR31_ARATH     SFTA------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IKRSDTVSNDTQDFTAVTSEIIKADPDAVFLLLLGPQNPRAVSQLKQKGYDGEIIGMTTMGAGNLETAGE
LIVB7_BRUAB     MVLSQSYPGNTVDMSSLVLDLKSAGADVVLQTSYQSDSVLFLQQANEGGYKPSAI----VGAGTADAVGH
LIVB7_BRUA2     MVLSQSYPGNTVDMSSLVLDLKSAGADVVLQTSYQSDSVLFLQQANEGGYKPSAI----VGAGTADAVGH
LIVB7_BRUME     MVLSQSYPGNTVDMSSLVLDLKSAGADVVLQTSYQSDSVLFLQQANEGGYKPSAI----VGAGTADAVGH
LIVB7_BRUSU     MVLSQSYPGNTVDMSSLVLDLKSAGADVVLQTSYQSDSVLFLQQANEGGYKPSAI----VGAGTADAVGH
LIVB5_BRUSU     IAADEKFATNSTDFTSLISQIKSKNVDAVLVAGHETEVLNFVRQSKSLAFDPKLYSF-TVGVPTRKALGK
LIVB5_BRUME     IAADEKFATNSTDFTSLISQIKSKNVDAVLVAGHETEVLNFVRQSKSLAFDPKLYSF-TVGVPTRKALGK
LIVB5_BRUAB     IAADEKFATNSTDFTSLISQIKSKNVDAVLVAGHETEVLNFVRQSKSLAFDPKLYSF-TVGVPTRKALGK
LIVB5_BRUA2     IAADEKFATNSTDFTSLISQIKSKNVDAVLVAGHETEVLNFVRQSKSLAFDPKLYSF-TVGVPTRKALGK
BRAC_PSEAE      VAVFEGLNAGDKDFNALISKLKKAGVQFVYFGGYHPEMGLLLRQAKQAGLDARFMGPEGVGNSEITAIAG
LIVB3_BRUME     EVHYDSVTPGDKDFSALVTKLKSAGAEVVYFGGYHAEGGLLSRQLHDAGMQALVLG--GEGLSNTEIGGT
LIVB3_BRUSU     EVHYDSVTPGDKDFSALVTKLKSAGAEVVYFGGYHAEGGLLSRQLHDAGMQALVLG--GEGLSNTEIGGT
LIVB8_BRUSU     VVLKSGYPSNTVDMSSLVLELREKGADVVMQTSYQNDSVLFLQQANEAGYK----PLAIIGGGTADAVGH
LIVB8_BRUME     VVLKSGYPSNTVDMSSLVLELREKGADVVMQTSYQNDSVLFLQQANEAGYK----PLAIIGGGTADAVGH
LIVB8_BRUAB     VVLKSGYPSNTVDMSSLVLELREKGADVVMQTSYQNDSVLFLQQANEAGYK----PLAIIGGGTADAVGH
LIVB8_BRUA2     VVLKSGYPSNTVDMSSLVLELREKGADVVMQTSYQNDSVLFLQQANEAGYK----PLAIIGGGTADAVGH
LIVJ_SALTY      VVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQSRAAGLKTQFMGPEGVANVSLSNAGE
GLR26_ARATH     IRYRSAISHSTDDLVKKELYKLMTMPTRVFIVHMLPDGSRLFSIAKEKGYNGIADQMSVMGESSL----E
LIVK_ECOLI      VVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAG
LIVJ_ECOLI      VVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNAGE
LIVJ_ECOL6      VVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNAGE
LIVJ_ECO57      VVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNAGE
LIVK_SALTY      IVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQMLRQARANGLKTQFMGPEGVGNASLSNAGG
LIVK_SALTI      IVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQMLRQARANGLKTQFMGPEGVGNASLSNAGG
LIVB6_BRUSU     VVEAIRMPLATNDFSPIMQRIKDSGAQGVFAFL--PSDPTTLGFMKDNGLKSSGIQLFAPGESDLPALGE
LIVB6_BRUME     VVEAIRMPLATNDFSPIMQRIKDSGAQGVFAFL--PSGPTTLGFMKDNGLKSSGIQLFAPGESDLPALGE
LIVJ_CITFR      VVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNAGE
LIVB6_BRUAB     VVEAIRMPLATNDFSPIMQRIKDSGAQGVFAFL--PSGPTTFGFMKDNGLKSSGIQLFAPGESDLPALGE
LIVB6_BRUA2     VVEAIRMPLATNDFSPIMQRIKDSGAQGVFAFL--PSGPTTFGFMKDNGLKSSGIQLFAPGESDLPALGE
GLR25_ARATH     IRYRSAISLHYSD-DQIKKELYKTMPTRVFIVHMLPDGSRLFSIAKEKGY----VWIVTNGIADLESSLV
GLR24_ARATH     IRRTVISPNATDDEISVDLLKLMTKPTRVFVVHMNRSKARETGLMKQ-GYNGVIDHLVLMNGTDIEA---
LIVB2_BRUME     ETLYEGVNQGDKDFSALISKMKAAGITAVYWGGMHPEAGLLIRQMADQGLKAQFISGDGIVSNELASAGD
LIVB2_BRUSU     ETLYEGVNQGDKDFSALISKMKAAGITAVYWGGMHPEAGLLIRQMADQGLKAQFISGDGIVSNELASAGD
AMIC_PSEAE      LYPSD------DDVQRAVERIYQARADVVFSTVVGTGTARAIARRYGDGRRPPIASLTTSEAEVAKMESD
GLR22_ARATH     IPYRSVIPLNATD-QDISVELLKMMPTRVFIVHMSSSLASTVLGLMKPGYNGVMDGLRSIN----ETGIE
GLR27_ARATH     VVNRCLIPQEAND-DQILKELYKTMQTRVFVVHMPPQKAREIGMM-EEGY----VWLLTDGVMNLLKSNE
GLR29_ARATH     VKRSVIPPEAIDDEIQKELRKLMERQARVFVVHMESSLALRVFQMMEEGYNGMTHMMRHINNGRSLNTIE
GLR37_ARATH     YKVPLSVHSDEKFLTNALNKSKSIGP-RVYILHFGPDPLLRIFDIAQKMMTHEYVWLATDWLSTLDSLSD
GLR34_ARATH     YKAAITPGADSSSIRDLLVSVNLME-SRVFVVHVNPDSGLNVFSVAKSGYVWIATDWLPTAMDSMEHVDS
LIVB1_BRUAB     ETLYEGVNVGEKDFSALIAKLKQAGVNVVYWGGMHPEAGLLIRQMADQGLKAQFISGDGIVSNELASAGD
LIVB1_BRUA2     ETLYEGVNVGEKDFSALIAKLKQAGVNVVYWGGMHPEAGLLIRQMADQGLKAQFISGDGIVSNELASAGD
GLR21_ARATH     IPYRTVISNATDDEISVELLRMMTLPTRVFVVHL------------------------------------
GLR28_ARATH     VDRSPSEANDDQ----------------------------------------------------------
GLR23_ARATH     ----------------------------------------------------------------------
LIVB2_BRUAB     ETLYEGVNVGEKDFSALIAKLKQAGVNVVYWGGLHPEAGLIIRQMADQGLKAQFISGDGIVSNELASAGP
LIVB2_BRUA2     ETLYEGVNVGEKDFSALIAKLKQAGVNVVYWGGLHPEAGLIIRQMADQGLKAQFISGDGIVSNELASAGP
LIVB1_BRUME     ETLYEGVNVGEKDFSALIAKLKQAGVNVVYWGGLHPEAGLIIRQMADQGLKAQFISGDGIVSNELASAGP
LIVB1_BRUSU     ETLYEGVNVGEKDFSALIAKLKQAGVNVVYWGGLHPEAGLIIRQMADQGLKAQFISGDGIVSNELASAGP
GLR35_ARATH     YKAAFPPGADNSSISDLLASVNLME-SRIFVVHVNPDSGLNISVAKSLGMMGSYVWITTTALDSMEPLDP
MDH_BACSU       --RDDLVSTNEKIMRSVTQEIVKYSPDSIIVVLTNPVDAMTYAVYKESGFPKEVIGQ----SGVLDTA--
MDH_BACCN       --RDDLVATNSKIMKSVTKEIAKHSPDTIIIVLTNPVDAMTYSVFKEAGFPKEVIGQ----SGVLDTA--
MDH_BACA2       --RDDLVSTNEKIMRSVTREIVKYSPDCIIVVLTNPVDAMTYAVYKESGFPKEVIGQ----SGVLDTA--
GLR31_ORYSJ     ----------------------------------------------------------------------
MDH_BACLD       --RDDLVATNEKIMRSVTKEVVKYSPDCIIIVLTNPVDAMTYAVYKESGFPKEVIGQ----SGILDTA--
MDH_BACWK       --RDDLVATNSKIMKSITRDIAKHSPNAIILVLTNPVDAMTYSVFKEAGFPKEVIGQ----SGVLDTA--
MDH_BACP2       --RDDLVSTNEKIMRSVTREIVKYSPEAIIVVLTNPVDAMTYAVYKESGLPKEVIGQ----SGILDTA--
MDH_BACHD       --RDDLVSTNAGIMKAVTKEVVKHSPNAYIIVLTNPADAMTYTVYKESGFKNRVIGQSTFVAQELNLSVE
GLR31_ARATH     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DAAGVVWPSNFSARSEVPSTQEFVKAYEEKYGELPNNYAAEGYDAVWLLARGIKEANSADRVAIREGIAK
LIVB7_BRUAB     DVIEAAYDVDFTQTSFTPGLEEFVEAYKKKYGETPSGYSLTNYVGAKVILEALNKVKGFDAAAVKQALSA
LIVB7_BRUA2     DVIEAAYDVDFTQTSFTPGLEEFVEAYKKKYGETPSGYSLTNYVGAKVILEALNKVKGFDAAAVKQALSA
LIVB7_BRUME     DVIEAAYDVDFTQTSFTPGLEEFVEAYKKKYGETPSGHSLTNYVGAKVILEALNKVKGFDAAAVKQALSA
LIVB7_BRUSU     DVIEAAYDVDFTQTSFTPGLEEFVEAYKKKYGETPSGHSLTNYVGAKVILEALNKVKGFDAAAVKQALSA
LIVB5_BRUSU     DAGMTAWPSADLKDRWFGDAAKFETEYKARFNYEPDYHAASGASDVEAFAEAIEKANSLDPQKVRDALAS
LIVB5_BRUME     DAGMTAWPSADLKDRWFGDAAKFETEYKARFNYEPDYHAASGASDVEAFAEAIEKANSLDPQKVRDALAS
LIVB5_BRUAB     DAGMTAWPSADLKDRWFGDAAKFETEYKARFNYEPDYHAASGASDVEAFAEAIEKANSLDPQKVRDALAS
LIVB5_BRUA2     DAGMTAWPSADLKDRWFGDAAKFETEYKARFNYEPDYHAASGASDVEAFAEAIEKANSLDPQKVRDALAS
BRAC_PSEAE      DASEGMLATLPRAFEQDPKNKALIDAFKAKNQDPSGIFVLPAYSAVTVIAKGIEKAGEADPEKVAEAL--
LIVB3_BRUME     NAQGTLF-TNAKDATKNPAAKDAIQALKAK--NIPEAFTMNAYAAVEVIKAGIERAGSTDDSA---AVAK
LIVB3_BRUSU     NAQGTLF-TNAKDATKNPAAKDAIQALKAK--NIPEAFTMNAYAAVEVIKAGIERAGSTDDSA---AVAK
LIVB8_BRUSU     DLIDGVFDADYTQTSATPGLTEFVEAYKAKYGSQPRS---------------------------------
LIVB8_BRUME     DLIDGVFDADYTQTSATPGLTEFVEAYKAKYGSQPRS---------------------------------
LIVB8_BRUAB     DLIDGVFDADYTQTSATPGLTEFVEAYKAKYGSQPRS---------------------------------
LIVB8_BRUA2     DLIDGVFDADYTQTSATPGLTEFVEAYKAKYGSQPRS---------------------------------
LIVJ_SALTY      SAEGVTKPKNY---DQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNHSDDPAEIA-----KY
GLR26_ARATH     NMHGVLGVKTYFSRSK--ELMYLETRWRKRFGEELNNFECWGYDTATALAMSIEEISS------------
LIVK_ECOLI      DAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLAL---VKD
LIVJ_ECOLI      SAEGVTKPKNY---DQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDDPAEIA-----KY
LIVJ_ECOL6      SAEGVTKPKNY---DQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDDPAEIA-----KY
LIVJ_ECO57      SAEGVTKPKNY---DQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDDPAEIA-----KY
LIVK_SALTY      AAEGVTMPKRY---DQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASH---APLDLVKD
LIVK_SALTI      AAEGVTMPKRY---DQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASH---APLDLVKD
LIVB6_BRUSU     NALGVLTTFHYAVSHDSPENRKFVEEARKAIG--------------------------------------
LIVB6_BRUME     NALGVLTTFHYAVSHDSPENRKFVEEARKAIG--------------------------------------
LIVJ_CITFR      SAEGVTKPKNY---DQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDDPAEIA-----KY
LIVB6_BRUAB     NALGVLTTFHYAVSHDSPENRKFVEEARKAIG--------------------------------------
LIVB6_BRUA2     NALGVLTTFHYAVSHDSPENRKFVEEARKAIG--------------------------------------
GLR25_ARATH     NMHGVLGVKTYFAKSK--ELLHLEARWQKRFGEELNNFACWAYDAATALAMSVEE---------------
GLR24_ARATH     -MQGVIGIRTHFPISEELQTFRSRLAKAFPVSEL-NIYGLRAYDATTALAMAVEEAGTTN----------
LIVB2_BRUME     AVAGVMNTFGPDPRDD-KANAELIKAFRDK-GFEPEAYTFYAYAGVQSLVNAANAAGSNDPMEVATAMKE
LIVB2_BRUSU     AVAGVMNTFGPDPRDD-KANAELIKAFRDK-GFEPEAYTFYAYAGVQSLVNAANAAGSNDPMEVATAMKE
AMIC_PSEAE      VAEGQVVVAPYFSSIDTAASRAFVQAC---HGFFPENWAEAAYWQTLLLGRAAQAAGSWRVEDVQRHLYD
GLR22_ARATH     AMEGVLGIKTYIPKSK--DLETFRSRWKRRFPQMENVYGLWAYDATTALAMAIEDA--------------
GLR27_ARATH     RGSSLEMQGVLGVRSHIPKSKKFRLRWEKMFDEEMNIFALRAYDSITALAMAVEKTN-------------
GLR29_ARATH     GVLGV--------RSHVPKSKEWKRTFEKENPSMRNVFALWAYDSITALAKAVEKANT------------
GLR37_ARATH     KGTLKRLEGVVGLRQHIPESVKMEHTHKLQSNRSMNAYALHAYDTVWMIAHGIEE---------------
GLR34_ARATH     DTQGVVAFRHYTIESSV--KRQFMARWKNRPNDGFNSYAMYAYDSVWLVARAL-----------------
LIVB1_BRUAB     AVAGVMNTFGPDPRDD-KANAELIKAFRDK----------------------------------------
LIVB1_BRUA2     AVAGVMNTFGPDPRDD-KANAELIKAFRDK----------------------------------------
GLR21_ARATH     ----------------------------------------------------------------------
GLR28_ARATH     ----------------------------------------------------------------------
GLR23_ARATH     ----------------------------------------------------------------------
LIVB2_BRUAB     AVEGTLNTFGPDPRNN-PDNAELVKKFRDA-GFEPEAYTFYAYAGVQSLVNAANAAGSNDPMEVATAMKE
LIVB2_BRUA2     AVEGTLNTFGPDPRNN-PDNAELVKKFRDA-GFEPEAYTFYAYAGVQSLVNAANAAGSNDPMEVATAMKE
LIVB1_BRUME     AVEGTLNTFGPDPRNN-PDNAELVKKFRD-----------------------------------------
LIVB1_BRUSU     AVEGTLNTFGPDPRNN-PDNAELVKKFRD-----------------------------------------
GLR35_ARATH     RAQGVVAFRHYTPESD--NKRQFKGRWKNKSDDGFNSYALYAYDSVWLVARAL-----------------
MDH_BACSU       ----------------------------------------------------------------------
MDH_BACCN       ----------------------------------------------------------------------
MDH_BACA2       ----------------------------------------------------------------------
GLR31_ORYSJ     ----------------------------------------------------------------------
MDH_BACLD       ----------------------------------------------------------------------
MDH_BACWK       ----------------------------------------------------------------------
MDH_BACP2       ----------------------------------------------------------------------
MDH_BACHD       DITGFV----------------------------------------------------------------
GLR31_ARATH     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VAAEGFDGAQGPLSFENNDVRVEGVIASWNGSEEVVVTLGDD
LIVB7_BRUAB     VDIEAGKTAMGGFKFDQNNQNERASMMGMQWQDGKLVTVYPD
LIVB7_BRUA2     VDIEAGKTAMGGFKFDQNNQNERASMMGMQWQDGKLVTVYPD
LIVB7_BRUME     VDIEAGKNAMGGFKFDQNNQNERASMMGMQWQDGKLVTVYPD
LIVB7_BRUSU     VDIEAGKTAMGGFKFDQNNQNERASMMGMQWQDGKLVTVYPD
LIVB5_BRUSU     IK---FDSLYGPIAFD--------------------------
LIVB5_BRUME     IK---FDSLYGPIAFD--------------------------
LIVB5_BRUAB     IK---FDSLYGPIAFD--------------------------
LIVB5_BRUA2     IK---FDSLYGPIAFD--------------------------
BRAC_PSEAE      -RANTFETPTGNLGFD--------------------------
LIVB3_BRUME     ALHDGIETAIGTLTY---------------------------
LIVB3_BRUSU     ALHDGIETAIGTLTY---------------------------
LIVB8_BRUSU     ------------------------------------------
LIVB8_BRUME     ------------------------------------------
LIVB8_BRUAB     ------------------------------------------
LIVB8_BRUA2     ------------------------------------------
LIVJ_SALTY      LKGATVDTVMGPLSWD--------------------------
GLR26_ARATH     ------------------------------------------
LIVK_ECOLI      LKANGANTVIGPLNWD--------------------------
LIVJ_ECOLI      LKANSVDTVMGPLTWD--------------------------
LIVJ_ECOL6      LKANSVDTVMGPLTWD--------------------------
LIVJ_ECO57      LKANSVDTVMGPLTWD--------------------------
LIVK_SALTY      LKANGADTVIGPLKWD--------------------------
LIVK_SALTI      LKANGADTVIGPLKWD--------------------------
LIVB6_BRUSU     ------------------------------------------
LIVB6_BRUME     ------------------------------------------
LIVJ_CITFR      LKANSVETVMGPLSWD--------------------------
LIVB6_BRUAB     ------------------------------------------
LIVB6_BRUA2     ------------------------------------------
GLR25_ARATH     ------------------------------------------
GLR24_ARATH     ------------------------------------------
LIVB2_BRUME     KGP--FKTVLGDISFD--------------------------
LIVB2_BRUSU     KGP--FKTVLGDISFD--------------------------
AMIC_PSEAE      IC---IDAPQGPVRVENNHSRLSSRIA---------------
GLR22_ARATH     ------------------------------------------
GLR27_ARATH     ------------------------------------------
GLR29_ARATH     ------------------------------------------
GLR37_ARATH     ------------------------------------------
GLR34_ARATH     ------------------------------------------
LIVB1_BRUAB     ------------------------------------------
LIVB1_BRUA2     ------------------------------------------
GLR21_ARATH     ------------------------------------------
GLR28_ARATH     ------------------------------------------
GLR23_ARATH     ------------------------------------------
LIVB2_BRUAB     KGP--FKTVLGDISFD--------------------------
LIVB2_BRUA2     KGP--FKTVLGDISFD--------------------------
LIVB1_BRUME     ------------------------------------------
LIVB1_BRUSU     ------------------------------------------
GLR35_ARATH     ------------------------------------------
MDH_BACSU       ------------------------------------------
MDH_BACCN       ------------------------------------------
MDH_BACA2       ------------------------------------------
GLR31_ORYSJ     ------------------------------------------
MDH_BACLD       ------------------------------------------
MDH_BACWK       ------------------------------------------
MDH_BACP2       ------------------------------------------
MDH_BACHD       ------------------------------------------
GLR31_ARATH     ------------------------------------------