[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ55333.1

[Show Plain Result]


## Summary of Sequence Search
    1::500
   14::408     4e-13  26%  512 aa  BMR3_BACSU RecName: Full=Multidrug resistance protein 3;AltName:
   11::338     2e-10  24%  532 aa  YHCA_BACSU RecName: Full=Uncharacterized MFS-type transporter yhcA;
    9::330     1e-07  27%  444 aa  YVKA_BACSU RecName: Full=Uncharacterized MFS-type transporter yvkA;
   46::107     3e-06  36%  578 aa  ACT22_STRCO RecName: Full=Probable actinorhodin transporter;
  272::361     3e-05  33%  457 aa  YEBQ_ECOLI RecName: Full=Uncharacterized transporter yebQ;
   75::194     3e-05  24%  488 aa  EDL13_ARATH RecName: Full=Putative sugar transporter ERD6-like 13;
   17::413     6e-05  34%  452 aa  YWOD_BACSU RecName: Full=Uncharacterized MFS-type transporter
  247::354     6e-05  29%  475 aa  HSRA_ECOLI RecName: Full=Probable transport protein hsrA;AltName:
  251::355     1e-04  32%  463 aa  NORB_STAAR RecName: Full=Quinolone resistance protein norB;
   90::125     2e-04  47%  522 aa  YLX3_CAEEL RecName: Full=Uncharacterized protein F23F12.3;
   70::136     4e-04  27%  540 aa  YM8M_YEAST RecName: Full=Uncharacterized transporter YMR279C;
  251::355     6e-04  30%  463 aa  NORB_STAAB RecName: Full=Quinolone resistance protein norB;
    6::142     6e-04  35%  512 aa  EMRY_ECOLI RecName: Full=Multidrug resistance protein Y;
   10::67      8e-04  31%  124 aa  YMFD_BACSU RecName: Full=Uncharacterized MFS-type transporter
  221::355     8e-04  27%  463 aa  NORB_STAAW RecName: Full=Quinolone resistance protein norB;
  221::355     8e-04  27%  463 aa  NORB_STAAS RecName: Full=Quinolone resistance protein norB;
   33::97      8e-04  29%  531 aa  FNX1_SCHPO RecName: Full=Multidrug resistance protein fnx1;
    1::500

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxATPAAVPHISPLRVIVPLVLGGLTYAMSQNAIVPVLAEIQRATGSTASEAAWVVTGFFISSAVLTVIA
BMR3_BACSU      ---------------VVLGLLLGILMSAMDNTIVATAMGNIVADLGSF-DKFAWVTASYMVAVMAGMPIY
YHCA_BACSU      -----------NPMSLLIVLMAGLFLAILNQTLLNVAMPHLMTEFGVSATTIQWLTTGYMLVNGVLIPLS
YVKA_BACSU      ---------------LIVSLLLGAILVPINSTMIAVALSSISHTYNESIASITWVVTVYLIVMAVTQPIA
ACT22_STRCO     -------------------VILGAEIMDLLDGTVMNVAAPAVRADGGSLSVIQWITVGYTLAFAVLLVVG
YEBQ_ECOLI      ----------------------------------------------------------------------
EDL13_ARATH     ----------------------------------------------------------------------
YWOD_BACSU      ----------------------GTMLNPLNSSMISLALHSIQHEFHLSFTTVSWLISSFYLASAVAQPVT
HSRA_ECOLI      ----------------------------------------------------------------------
NORB_STAAR      ----------------------------------------------------------------------
YLX3_CAEEL      ---------------------------------------------GTKAYDSAWIATIQFIGALVGALVY
YM8M_YEAST      -------------LMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILIS
NORB_STAAB      ----------------------------------------------------------------------
EMRY_ECOLI      --STPAPLTGGTLWCVTIALSLATFMQMLDSTISNVAIPTISGFLGASTDEGTWVITSFGVANAIAIPVT
YMFD_BACSU      -----------------VPLVM-----TLGNSMLIPVLPMMEKKLSVTSFQVSLIITVYSVVAIICIPIA
NORB_STAAW      ----------------------------------------------------------------------
NORB_STAAS      ----------------------------------------------------------------------
FNX1_SCHPO      ---------------ILPALWVGGFLSALDMT-IVASLYPVIGSEFKLMNNASYIVTAYLITNTAFQPLY


                         .         .         *         .         .         .         .:140
query           GRLGDLFGRKPXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVIMGVAGGVFPLAFALLGQLLPRDRAAFXX
BMR3_BACSU      GKLSDMYGRKRXXXXXXXXXXXXSALCGIAQTMNQLIIFRAIQGIGGGLLPIAFTIIFDLFPPEKRGKMS
YHCA_BACSU      AFLITRFGQRSLFLVAMFCFTLGTLVCGIAPNFSTMLIGRLIQAVGGGILPLVMTTILLIFPPESRGKGM
YVKA_BACSU      GKLGDMYGNKTMYLWGVGLFLIAXXXXXXXXXXXXXIVFRALQAVGGALLPNSIAIIRHVVSEKRLPKVX
ACT22_STRCO     GRLGDIYGRK------------------------------------------------------------
YEBQ_ECOLI      ----------------------------------------------------------------------
EDL13_ARATH     ----------------------------------------------------------------------
YWOD_BACSU      GKLGDLIGRK------------------------------------------------------------
HSRA_ECOLI      ----------------------------------------------------------------------
NORB_STAAR      ----------------------------------------------------------------------
YLX3_CAEEL      GHLGDHFGRKP-----------------------------------------------------------
YM8M_YEAST      GRLGDIYGLK------------------------------------------------------------
NORB_STAAB      ----------------------------------------------------------------------
EMRY_ECOLI      GRLAQRIGEXXXXXXXXXXXXXXXXXXXXXTNLDVLIFFRVVQGMAGPLIPLSQSLLLRNYPPEKRTF--
YMFD_BACSU      GYLSDRFGRK------------------------------------------------------------
NORB_STAAW      ----------------------------------------------------------------------
NORB_STAAS      ----------------------------------------------------------------------
FNX1_SCHPO      GRLSDIFGRRP-----------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXXXXXXXXXXXEYFGYQGLFWXXXXXXXXXXXXXXLLVPEPXXXXXXXVDWIGAXXXXX
BMR3_BACSU      GMFGAVFGLSSVLGPLLGAIITDSISWHWVFYINVPIGALSLFFIIRYYKESLEHRKQKIDWGGAITLVV
YHCA_BACSU      GIFGLAMMFAPAVGPTLSGWIIEHYTWRIMFYGLVPIGXXXXXXXXXXXKNMVEPQKIKLDTLGAILSIV
YVKA_BACSU      XXXXXXXXXXXXXXPFIGSILIDSFSWHSIFWVNIPFLAIALFTALTMFPQKENKSDAPLDIIGSLLLAG
ACT22_STRCO     ----------------------------------------------------------------------
YEBQ_ECOLI      ----------------------------------------------------------------------
EDL13_ARATH     ----------------------------------------------------------------------
YWOD_BACSU      ----------------------------------------------------------------------
HSRA_ECOLI      ----------------------------------------------------------------------
NORB_STAAR      ----------------------------------------------------------------------
YLX3_CAEEL      ----------------------------------------------------------------------
YM8M_YEAST      ----------------------------------------------------------------------
NORB_STAAB      ----------------------------------------------------------------------
EMRY_ECOLI      ----------------------------------------------------------------------
YMFD_BACSU      ----------------------------------------------------------------------
NORB_STAAW      ----------------------------------------------------------------------
NORB_STAAS      ----------------------------------------------------------------------
FNX1_SCHPO      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXXXAVSRGAEWGWSSTPXXXXXXXXXXXXXXXXXXERRIPDPLIDLRLMRQRNVWLAHVIGFLTTC
BMR3_BACSU      SIVCLMFALELGGKYDWNSIQIIGLXXXXXXXXXXXXXXERKAEEPIISFWMFKNRLFATAQILAFLYGG
YHCA_BACSU      GFASLLYGVSEAGSDGWTDPIVLSTXXXXXXXXXXXXXQQLRHDDPMLDFRVFKYDIFSLSSVINIIITV
YVKA_BACSU      SIVSIILLTKNEAPWGYT-----VYSVLILLFVPLFFRREKRTQHPIIDFALFKSSTFTNANLSVLLSNL
ACT22_STRCO     ----------------------------------------------------------------------
YEBQ_ECOLI      ------------------------------------------------------------------LSIC
EDL13_ARATH     ----------------------------------------------------------------------
YWOD_BACSU      ---------------------------------------ELKTDKPFIDVRLFKQRNLSAVYVQFILLNV
HSRA_ECOLI      ----------------------------------------RRTPNPLISLDLFKTRTFSIGIVGNIATRL
NORB_STAAR      ---------------------------------------EKRATNPLIDFKLFKNKAYTGATASNFLLN-
YLX3_CAEEL      ----------------------------------------------------------------------
YM8M_YEAST      ----------------------------------------------------------------------
NORB_STAAB      ---------------------------------------EKRATNPLIDFKLFKNKAYTGATASNFLLN-
EMRY_ECOLI      ----------------------------------------------------------------------
YMFD_BACSU      ----------------------------------------------------------------------
NORB_STAAW      ---------TKGSELGVSSLLFITLLAIAIGSFSLFIVLEKRATNPLIDFKLFKNKAYTGATASNFLLN-
NORB_STAAS      ---------TKGSELGVSSLLFITLLAITIGSFSLFIVLEKRATNPLIDFKLFKNKAYTGATASNFLLN-
FNX1_SCHPO      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GQITTFLLVPQMVQAPAEGGTGLGVGVTQAGLYLLPFSMTTLVGGALTGKAVARFGIRPLMALGAASAVT
BMR3_BACSU      TFIILAVFIPIFVQAV------YGSSATSAGFILTPXXXXXXXXXXXXXXFQTKASFRNLMLISVIAFFI
YHCA_BACSU      ALYTGMFLLPIYLQ------NLVGFTALQSGLLLLPGAIVMLIMSPISGILFDKFGPRPLAIIG------
YVKA_BACSU      MMYAVLLIMPLFMT------NQFGLNTSNSGMALSVFSIFMSASNWVGAQLHHKWGAKKIIFLSFA----
ACT22_STRCO     ----------------------------------------------------------------------
YEBQ_ECOLI      TSVCSFCAMLAMVSLPFYLQTVLGRSEVETGLLLTPWPLATMVMAPLAGYLIERVHAGLLGALGLFIMAA
EDL13_ARATH     --------------SPAQTGAGLNLSLAEFSFFGAVLTIGGLVGAAMSGKLADVFGRRGALGVSNSFCMA
YWOD_BACSU      FFYCLFFGLPSYFQDE------MHLSVQTSGLFMLFMSGMSIVVSPLTGKWIDRSGVVKPIFAGALLMTA
HSRA_ECOLI      GTGCVPFLMPLMLQ------VGFGYQAFIAGCMMAPTALGSIIAKSMVTQVLRRLGYR--HTLVGITVII
NORB_STAAR      GVAGTLIVANTFVQR------GLGYSSLQAGSLSITYLVMVLIMIRVGEKLLQTFGCKKPMLIGTAVLIV
YLX3_CAEEL      ----------------------------------------------------------------------
YM8M_YEAST      ----------------------------------------------------------------------
NORB_STAAB      GVAGTLIVANTFVQR------GLGYSLLQAGSLSITYLVMVLIMIRVGEKLLQTLGCKKPMLIGTGVLIV
EMRY_ECOLI      ----------------------------------------------------------------------
YMFD_BACSU      ----------------------------------------------------------------------
NORB_STAAW      GVAGTLIVANTFVQR------GLGYSSLQAGSLSITYLVMVLIMIRVGEKLLQTLGCKKPMLIGTGVLIV
NORB_STAAS      GVAGTLIVANTFVQR------GLGYSSLQAGSLSITYLVMVLIMIRVGEKLLQTLGCKKPMLIGTGVLIV
FNX1_SCHPO      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GLSILAFLPVQPATVLLXXXXXXXXXXXXYSALPVLIAEAVPERETGTVNGINTIIRTIAMAILxxxxxx
BMR3_BACSU      GMLLLSNMTPDTARVWLFMMISGFGVGFNFSLLPAASMNDLEPRFRGTANSTNSFLRSFGMTL-------
YHCA_BACSU      ----------------------------------------------------------------------
YVKA_BACSU      ----------------------------------------------------------------------
ACT22_STRCO     ----------------------------------------------------------------------
YEBQ_ECOLI      GLFSLVLLPASPADI-------------------------------------------------------
EDL13_ARATH     GWLMIAFSQATWSLDIGRLFLGVAAGVASY-VVPVYIVEIAPKKVRGTFSAINSLVMCASVAV-------
YWOD_BACSU      GAVLLTFINVQTXXXXXXXXXXXXXXXXXNVALQAAMLETSPSNMVGTTSGLGSILSSVILGIL------
HSRA_ECOLI      GLMIAQFSLQSPAMAI------------------------------------------------------
NORB_STAAR      GLISLTFLP-------------------------------------------------------------
YLX3_CAEEL      ----------------------------------------------------------------------
YM8M_YEAST      ----------------------------------------------------------------------
NORB_STAAB      GLISLTFLP-------------------------------------------------------------
EMRY_ECOLI      ----------------------------------------------------------------------
YMFD_BACSU      ----------------------------------------------------------------------
NORB_STAAW      GLISLTFLP-------------------------------------------------------------
NORB_STAAS      GLISLTFLP-------------------------------------------------------------
FNX1_SCHPO      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
BMR3_BACSU      ----------------------------------------------------------------------
YHCA_BACSU      ----------------------------------------------------------------------
YVKA_BACSU      ----------------------------------------------------------------------
ACT22_STRCO     ----------------------------------------------------------------------
YEBQ_ECOLI      ----------------------------------------------------------------------
EDL13_ARATH     ----------------------------------------------------------------------
YWOD_BACSU      ----------------------------------------------------------------------
HSRA_ECOLI      ----------------------------------------------------------------------
NORB_STAAR      ----------------------------------------------------------------------
YLX3_CAEEL      ----------------------------------------------------------------------
YM8M_YEAST      ----------------------------------------------------------------------
NORB_STAAB      ----------------------------------------------------------------------
EMRY_ECOLI      ----------------------------------------------------------------------
YMFD_BACSU      ----------------------------------------------------------------------
NORB_STAAW      ----------------------------------------------------------------------
NORB_STAAS      ----------------------------------------------------------------------
FNX1_SCHPO      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxx
BMR3_BACSU      ----------
YHCA_BACSU      ----------
YVKA_BACSU      ----------
ACT22_STRCO     ----------
YEBQ_ECOLI      ----------
EDL13_ARATH     ----------
YWOD_BACSU      ----------
HSRA_ECOLI      ----------
NORB_STAAR      ----------
YLX3_CAEEL      ----------
YM8M_YEAST      ----------
NORB_STAAB      ----------
EMRY_ECOLI      ----------
YMFD_BACSU      ----------
NORB_STAAW      ----------
NORB_STAAS      ----------
FNX1_SCHPO      ----------