[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ55520.1

[Show Plain Result]


## Summary of Sequence Search
    1::389
  142::342     7e-33  36%  383 aa  Y793_METTH RecName: Full=Uncharacterized protein MTH_793;
   97::364     4e-25  32%  547 aa  NLTP_RAT RecName: Full=Non-specific lipid-transfer protein;        
   97::364     3e-24  33%  547 aa  NLTP_RABIT RecName: Full=Non-specific lipid-transfer protein;      
  142::316     3e-23  33%  392 aa  Y1549_METJA RecName: Full=Uncharacterized protein MJ1549;
   97::364     4e-23  31%  547 aa  NLTP_MOUSE RecName: Full=Non-specific lipid-transfer protein;      
  158::365     1e-22  32%  543 aa  NLTP_BOVIN RecName: Full=Non-specific lipid-transfer protein;      
   97::364     1e-21  31%  547 aa  NLTP_HUMAN RecName: Full=Non-specific lipid-transfer protein;      
  100::368     1e-21  28%  547 aa  NLTP_CHICK RecName: Full=Non-specific lipid-transfer protein;      
  135::354     5e-07  30%  387 aa  FADA_AERS4 RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     8e-07  32%  387 aa  FADA_IDILO RecName: Full=3-ketoacyl-CoA thiolase;       
  210::354     4e-06  30%  387 aa  FADA_AERHH RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     5e-06  32%  387 aa  FADA_ENT38 RecName: Full=3-ketoacyl-CoA thiolase;       
  245::358     1e-05  33%  391 aa  FADA_MARAV RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     1e-05  31%  387 aa  FADA_ENTCL RecName: Full=3-ketoacyl-CoA thiolase;       
  214::357     1e-05  32%  391 aa  FADA_ALCBS RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     2e-05  31%  387 aa  FADA_ENTS8 RecName: Full=3-ketoacyl-CoA thiolase;       
  278::383     2e-05  36%  424 aa  THIKB_RAT RecName: Full=3-ketoacyl-CoA thiolase B, peroxisomal;    
  278::383     2e-05  36%  424 aa  THIKA_RAT RecName: Full=3-ketoacyl-CoA thiolase A, peroxisomal;    
  241::354     2e-05  28%  389 aa  FADA_PSEHT RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     3e-05  31%  387 aa  FADA_SALTY RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     3e-05  31%  387 aa  FADA_SALTI RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     3e-05  31%  387 aa  FADA_SALPA RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     3e-05  31%  387 aa  FADA_SALCH RecName: Full=3-ketoacyl-CoA thiolase;       
  278::383     4e-05  35%  424 aa  THIKB_MOUSE RecName: Full=3-ketoacyl-CoA thiolase B, peroxisomal;  
  278::383     4e-05  35%  424 aa  THIKA_MOUSE RecName: Full=3-ketoacyl-CoA thiolase A, peroxisomal;  
  241::354     4e-05  31%  387 aa  FADA_ECO24 RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     6e-05  31%  387 aa  FADA_SHESA RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     6e-05  31%  387 aa  FADA_SHELP RecName: Full=3-ketoacyl-CoA thiolase;       
  245::357     6e-05  28%  391 aa  FADA_SACD2 RecName: Full=3-ketoacyl-CoA thiolase;       
  252::360     8e-05  32%  397 aa  THIL_YARLI RecName: Full=Acetyl-CoA acetyltransferase;       
  246::355     8e-05  33%  389 aa  THIL_MYCTU RecName: Full=Probable acetyl-CoA acetyltransferase;    
  246::355     8e-05  33%  389 aa  THIL_MYCBO RecName: Full=Probable acetyl-CoA acetyltransferase;    
  254::362     8e-05  30%  403 aa  THIA_CANTR RecName: Full=Acetyl-CoA acetyltransferase IA;       
  241::354     8e-05  30%  387 aa  FADA_KLEP7 RecName: Full=3-ketoacyl-CoA thiolase;       
  245::358     8e-05  29%  391 aa  FADA_HAHCH RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     8e-05  31%  387 aa  FADA_ECOL6 RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     8e-05  31%  387 aa  FADA_ECOL5 RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     1e-04  31%  387 aa  FADA_SHIDS RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     1e-04  31%  387 aa  FADA_ECO57 RecName: Full=3-ketoacyl-CoA thiolase;       
  253::357     1e-04  34%  392 aa  THLA_CLOAB RecName: Full=Acetyl-CoA acetyltransferase;       
  254::333     1e-04  30%  403 aa  THIB_CANTR RecName: Full=Acetyl-CoA acetyltransferase IB;       
  165::358     1e-04  28%  436 aa  FADI_ENT38 RecName: Full=3-ketoacyl-CoA thiolase;       
  275::358     2e-04  30%  436 aa  FADI_SHIF8 RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     2e-04  29%  387 aa  FADA_SHIBS RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     2e-04  31%  387 aa  FADA_SHESR RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     2e-04  31%  387 aa  FADA_SHESM RecName: Full=3-ketoacyl-CoA thiolase;       
  245::357     2e-04  31%  391 aa  FADA_PSEU5 RecName: Full=3-ketoacyl-CoA thiolase;       
  252::360     2e-04  27%  395 aa  THIL_SCHPO RecName: Full=Acetyl-CoA acetyltransferase;       
  176::355     2e-04  27%  436 aa  FADI_KLEP7 RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     2e-04  30%  387 aa  FADA_SHISS RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     2e-04  30%  387 aa  FADA_SHESW RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     2e-04  30%  387 aa  FADA_SHEON RecName: Full=3-ketoacyl-CoA thiolase;       
  245::357     2e-04  30%  391 aa  FADA_PSEAE RecName: Full=3-ketoacyl-CoA thiolase;       
  245::357     2e-04  30%  391 aa  FADA_PSEAB RecName: Full=3-ketoacyl-CoA thiolase;       
  245::357     2e-04  30%  391 aa  FADA_PSEA7 RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     2e-04  30%  387 aa  FADA_ECOUT RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     2e-04  30%  387 aa  FADA_ECOK1 RecName: Full=3-ketoacyl-CoA thiolase;       
  237::355     3e-04  29%  436 aa  FADI_KLEP3 RecName: Full=3-ketoacyl-CoA thiolase;       
  275::355     3e-04  28%  437 aa  FADI_ERWT9 RecName: Full=3-ketoacyl-CoA thiolase;       
  245::358     3e-04  29%  391 aa  FADA_VIBPA RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     3e-04  30%  387 aa  FADA_SHIFL RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     3e-04  30%  387 aa  FADA_SHIF8 RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     3e-04  30%  387 aa  FADA_SHEPC RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     3e-04  30%  387 aa  FADA_SHEB8 RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     3e-04  30%  387 aa  FADA_SHEB5 RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     3e-04  30%  387 aa  FADA_ECOLI RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     3e-04  30%  387 aa  FADA_ECOHS RecName: Full=3-ketoacyl-CoA thiolase;       
  275::358     4e-04  30%  436 aa  FADI_SHISS RecName: Full=3-ketoacyl-CoA thiolase;       
  275::358     4e-04  30%  436 aa  FADI_SHIFL RecName: Full=3-ketoacyl-CoA thiolase;       
  275::358     4e-04  29%  436 aa  FADI_SHEFN RecName: Full=3-ketoacyl-CoA thiolase;       
  275::358     4e-04  29%  436 aa  FADI_SHEDO RecName: Full=3-ketoacyl-CoA thiolase;       
  176::358     4e-04  26%  436 aa  FADI_SALTI RecName: Full=3-ketoacyl-CoA thiolase;       
  176::358     4e-04  26%  436 aa  FADI_SALSV RecName: Full=3-ketoacyl-CoA thiolase;       
  176::358     4e-04  26%  436 aa  FADI_SALPK RecName: Full=3-ketoacyl-CoA thiolase;       
  176::358     4e-04  26%  436 aa  FADI_SALPC RecName: Full=3-ketoacyl-CoA thiolase;       
  176::358     4e-04  26%  436 aa  FADI_SALPB RecName: Full=3-ketoacyl-CoA thiolase;       
  176::358     4e-04  26%  436 aa  FADI_SALPA RecName: Full=3-ketoacyl-CoA thiolase;       
  176::358     4e-04  26%  436 aa  FADI_SALNS RecName: Full=3-ketoacyl-CoA thiolase;       
  176::358     4e-04  26%  436 aa  FADI_SALHS RecName: Full=3-ketoacyl-CoA thiolase;       
  176::358     4e-04  26%  436 aa  FADI_SALEP RecName: Full=3-ketoacyl-CoA thiolase;       
  176::358     4e-04  26%  436 aa  FADI_SALDC RecName: Full=3-ketoacyl-CoA thiolase;       
  176::358     4e-04  26%  436 aa  FADI_SALA4 RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     4e-04  29%  387 aa  FADA_VIBVY RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     4e-04  29%  387 aa  FADA_VIBVU RecName: Full=3-ketoacyl-CoA thiolase;       
  176::358     5e-04  26%  436 aa  FADI_SALTY RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     5e-04  31%  387 aa  FADA_SHEDO RecName: Full=3-ketoacyl-CoA thiolase;       
  283::354     6e-04  29%  387 aa  FADA_SERP5 RecName: Full=3-ketoacyl-CoA thiolase;       
  283::354     6e-04  29%  387 aa  FADA_ERWT9 RecName: Full=3-ketoacyl-CoA thiolase;       
  283::354     6e-04  29%  387 aa  FADA_ALISL RecName: Full=3-ketoacyl-CoA thiolase;       
  275::358     8e-04  29%  436 aa  FADI_SHIBS RecName: Full=3-ketoacyl-CoA thiolase;       
  275::358     8e-04  29%  436 aa  FADI_SHIB3 RecName: Full=3-ketoacyl-CoA thiolase;       
  275::358     8e-04  30%  436 aa  FADI_SALCH RecName: Full=3-ketoacyl-CoA thiolase;       
  275::358     8e-04  30%  436 aa  FADI_SALAR RecName: Full=3-ketoacyl-CoA thiolase;       
  275::358     8e-04  29%  436 aa  FADI_ECOSM RecName: Full=3-ketoacyl-CoA thiolase;       
  275::358     8e-04  29%  436 aa  FADI_ECOSE RecName: Full=3-ketoacyl-CoA thiolase;       
  275::358     8e-04  29%  436 aa  FADI_ECOLU RecName: Full=3-ketoacyl-CoA thiolase;       
  275::358     8e-04  29%  436 aa  FADI_ECOLI RecName: Full=3-ketoacyl-CoA thiolase;       
  275::358     8e-04  29%  436 aa  FADI_ECOLC RecName: Full=3-ketoacyl-CoA thiolase;       
  275::358     8e-04  29%  436 aa  FADI_ECOL6 RecName: Full=3-ketoacyl-CoA thiolase;       
  275::358     8e-04  29%  436 aa  FADI_ECOHS RecName: Full=3-ketoacyl-CoA thiolase;       
  275::358     8e-04  29%  436 aa  FADI_ECODH RecName: Full=3-ketoacyl-CoA thiolase;       
  275::358     8e-04  29%  436 aa  FADI_ECOBW RecName: Full=3-ketoacyl-CoA thiolase;       
  275::358     8e-04  29%  436 aa  FADI_ECO8A RecName: Full=3-ketoacyl-CoA thiolase;       
  275::358     8e-04  29%  436 aa  FADI_ECO7I RecName: Full=3-ketoacyl-CoA thiolase;       
  275::358     8e-04  29%  436 aa  FADI_ECO55 RecName: Full=3-ketoacyl-CoA thiolase;       
  275::358     8e-04  29%  436 aa  FADI_ECO27 RecName: Full=3-ketoacyl-CoA thiolase;       
  275::358     8e-04  29%  436 aa  FADI_ECO24 RecName: Full=3-ketoacyl-CoA thiolase;       
  275::358     8e-04  29%  436 aa  FADI_CITK8 RecName: Full=3-ketoacyl-CoA thiolase;       
  241::354     8e-04  30%  387 aa  FADA_SHEAM RecName: Full=3-ketoacyl-CoA thiolase;       
  245::357     8e-04  29%  391 aa  FADA_PSEPU RecName: Full=3-ketoacyl-CoA thiolase;       
  245::357     8e-04  29%  391 aa  FADA_PSEPK RecName: Full=3-ketoacyl-CoA thiolase;       
  245::357     8e-04  29%  391 aa  FADA_PSEP1 RecName: Full=3-ketoacyl-CoA thiolase;       
  245::357     8e-04  29%  391 aa  FADA_PSEE4 RecName: Full=3-ketoacyl-CoA thiolase;       
    1::389

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Y793_METTH      ----------------------------------------------------------------------
NLTP_RAT        ----------------------------------------------------------------------
NLTP_RABIT      ----------------------------------------------------------------------
Y1549_METJA     ----------------------------------------------------------------------
NLTP_MOUSE      ----------------------------------------------------------------------
NLTP_BOVIN      ----------------------------------------------------------------------
NLTP_HUMAN      ----------------------------------------------------------------------
NLTP_CHICK      ----------------------------------------------------------------------
FADA_AERS4      ----------------------------------------------------------------------
FADA_IDILO      ----------------------------------------------------------------------
FADA_AERHH      ----------------------------------------------------------------------
FADA_ENT38      ----------------------------------------------------------------------
FADA_MARAV      ----------------------------------------------------------------------
FADA_ENTCL      ----------------------------------------------------------------------
FADA_ALCBS      ----------------------------------------------------------------------
FADA_ENTS8      ----------------------------------------------------------------------
THIKB_RAT       ----------------------------------------------------------------------
THIKA_RAT       ----------------------------------------------------------------------
FADA_PSEHT      ----------------------------------------------------------------------
FADA_SALTY      ----------------------------------------------------------------------
FADA_SALTI      ----------------------------------------------------------------------
FADA_SALPA      ----------------------------------------------------------------------
FADA_SALCH      ----------------------------------------------------------------------
THIKB_MOUSE     ----------------------------------------------------------------------
THIKA_MOUSE     ----------------------------------------------------------------------
FADA_ECO24      ----------------------------------------------------------------------
FADA_SHESA      ----------------------------------------------------------------------
FADA_SHELP      ----------------------------------------------------------------------
FADA_SACD2      ----------------------------------------------------------------------
THIL_YARLI      ----------------------------------------------------------------------
THIL_MYCTU      ----------------------------------------------------------------------
THIL_MYCBO      ----------------------------------------------------------------------
THIA_CANTR      ----------------------------------------------------------------------
FADA_KLEP7      ----------------------------------------------------------------------
FADA_HAHCH      ----------------------------------------------------------------------
FADA_ECOL6      ----------------------------------------------------------------------
FADA_ECOL5      ----------------------------------------------------------------------
FADA_SHIDS      ----------------------------------------------------------------------
FADA_ECO57      ----------------------------------------------------------------------
THLA_CLOAB      ----------------------------------------------------------------------
THIB_CANTR      ----------------------------------------------------------------------
FADI_ENT38      ----------------------------------------------------------------------
FADI_SHIF8      ----------------------------------------------------------------------
FADA_SHIBS      ----------------------------------------------------------------------
FADA_SHESR      ----------------------------------------------------------------------
FADA_SHESM      ----------------------------------------------------------------------
FADA_PSEU5      ----------------------------------------------------------------------
THIL_SCHPO      ----------------------------------------------------------------------
FADI_KLEP7      ----------------------------------------------------------------------
FADA_SHISS      ----------------------------------------------------------------------
FADA_SHESW      ----------------------------------------------------------------------
FADA_SHEON      ----------------------------------------------------------------------
FADA_PSEAE      ----------------------------------------------------------------------
FADA_PSEAB      ----------------------------------------------------------------------
FADA_PSEA7      ----------------------------------------------------------------------
FADA_ECOUT      ----------------------------------------------------------------------
FADA_ECOK1      ----------------------------------------------------------------------
FADI_KLEP3      ----------------------------------------------------------------------
FADI_ERWT9      ----------------------------------------------------------------------
FADA_VIBPA      ----------------------------------------------------------------------
FADA_SHIFL      ----------------------------------------------------------------------
FADA_SHIF8      ----------------------------------------------------------------------
FADA_SHEPC      ----------------------------------------------------------------------
FADA_SHEB8      ----------------------------------------------------------------------
FADA_SHEB5      ----------------------------------------------------------------------
FADA_ECOLI      ----------------------------------------------------------------------
FADA_ECOHS      ----------------------------------------------------------------------
FADI_SHISS      ----------------------------------------------------------------------
FADI_SHIFL      ----------------------------------------------------------------------
FADI_SHEFN      ----------------------------------------------------------------------
FADI_SHEDO      ----------------------------------------------------------------------
FADI_SALTI      ----------------------------------------------------------------------
FADI_SALSV      ----------------------------------------------------------------------
FADI_SALPK      ----------------------------------------------------------------------
FADI_SALPC      ----------------------------------------------------------------------
FADI_SALPB      ----------------------------------------------------------------------
FADI_SALPA      ----------------------------------------------------------------------
FADI_SALNS      ----------------------------------------------------------------------
FADI_SALHS      ----------------------------------------------------------------------
FADI_SALEP      ----------------------------------------------------------------------
FADI_SALDC      ----------------------------------------------------------------------
FADI_SALA4      ----------------------------------------------------------------------
FADA_VIBVY      ----------------------------------------------------------------------
FADA_VIBVU      ----------------------------------------------------------------------
FADI_SALTY      ----------------------------------------------------------------------
FADA_SHEDO      ----------------------------------------------------------------------
FADA_SERP5      ----------------------------------------------------------------------
FADA_ERWT9      ----------------------------------------------------------------------
FADA_ALISL      ----------------------------------------------------------------------
FADI_SHIBS      ----------------------------------------------------------------------
FADI_SHIB3      ----------------------------------------------------------------------
FADI_SALCH      ----------------------------------------------------------------------
FADI_SALAR      ----------------------------------------------------------------------
FADI_ECOSM      ----------------------------------------------------------------------
FADI_ECOSE      ----------------------------------------------------------------------
FADI_ECOLU      ----------------------------------------------------------------------
FADI_ECOLI      ----------------------------------------------------------------------
FADI_ECOLC      ----------------------------------------------------------------------
FADI_ECOL6      ----------------------------------------------------------------------
FADI_ECOHS      ----------------------------------------------------------------------
FADI_ECODH      ----------------------------------------------------------------------
FADI_ECOBW      ----------------------------------------------------------------------
FADI_ECO8A      ----------------------------------------------------------------------
FADI_ECO7I      ----------------------------------------------------------------------
FADI_ECO55      ----------------------------------------------------------------------
FADI_ECO27      ----------------------------------------------------------------------
FADI_ECO24      ----------------------------------------------------------------------
FADI_CITK8      ----------------------------------------------------------------------
FADA_SHEAM      ----------------------------------------------------------------------
FADA_PSEPU      ----------------------------------------------------------------------
FADA_PSEPK      ----------------------------------------------------------------------
FADA_PSEP1      ----------------------------------------------------------------------
FADA_PSEE4      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxGSSAIQMVQYASMAISAGMANVVACVYADAPLKEGRGSGAAYAGGNRPLTGVEALPAAA
Y793_METTH      ----------------------------------------------------------------------
NLTP_RAT        -----------GSTALFMAQ---QLVQGGLAN---CVLALGFEKMEKGSGTKYSDRSNPLEKIDVLINKY
NLTP_RABIT      -----------GSTALFM---GRQLIQGGMAE---CVLALGFEKMERGSGAKFPDRTNPMDKLDVLINKY
Y1549_METJA     ----------------------------------------------------------------------
NLTP_MOUSE      -----------GSTALFM---AHQLIQGGLAN---CVLALGFEKMERGSGTKFSDRTTPTDKIEVLIDKY
NLTP_BOVIN      ----------------------------------------------------------------------
NLTP_HUMAN      -----------GSTALFM---ARQLIQGGVAE---CVLALGFEKMSKGSGIKFSDRTIPTDKVDLLINKY
NLTP_CHICK      -----------GSTALFM---SRQLVEGGLADCVLALGFERMAKGSLASG--FSDRTNPMDKLEIMINKY
FADA_AERS4      ---------------------------------------------GMAKSVAKASGMMGLTA-EMLGKLH
FADA_IDILO      ----------------------------------------------------------------------
FADA_AERHH      ----------------------------------------------------------------------
FADA_ENT38      ----------------------------------------------------------------------
FADA_MARAV      ----------------------------------------------------------------------
FADA_ENTCL      ----------------------------------------------------------------------
FADA_ALCBS      ----------------------------------------------------------------------
FADA_ENTS8      ----------------------------------------------------------------------
THIKB_RAT       ----------------------------------------------------------------------
THIKA_RAT       ----------------------------------------------------------------------
FADA_PSEHT      ----------------------------------------------------------------------
FADA_SALTY      ----------------------------------------------------------------------
FADA_SALTI      ----------------------------------------------------------------------
FADA_SALPA      ----------------------------------------------------------------------
FADA_SALCH      ----------------------------------------------------------------------
THIKB_MOUSE     ----------------------------------------------------------------------
THIKA_MOUSE     ----------------------------------------------------------------------
FADA_ECO24      ----------------------------------------------------------------------
FADA_SHESA      ----------------------------------------------------------------------
FADA_SHELP      ----------------------------------------------------------------------
FADA_SACD2      ----------------------------------------------------------------------
THIL_YARLI      ----------------------------------------------------------------------
THIL_MYCTU      ----------------------------------------------------------------------
THIL_MYCBO      ----------------------------------------------------------------------
THIA_CANTR      ----------------------------------------------------------------------
FADA_KLEP7      ----------------------------------------------------------------------
FADA_HAHCH      ----------------------------------------------------------------------
FADA_ECOL6      ----------------------------------------------------------------------
FADA_ECOL5      ----------------------------------------------------------------------
FADA_SHIDS      ----------------------------------------------------------------------
FADA_ECO57      ----------------------------------------------------------------------
THLA_CLOAB      ----------------------------------------------------------------------
THIB_CANTR      ----------------------------------------------------------------------
FADI_ENT38      -----------------------------------------------------------LRDLAPVPPAV
FADI_SHIF8      ----------------------------------------------------------------------
FADA_SHIBS      ----------------------------------------------------------------------
FADA_SHESR      ----------------------------------------------------------------------
FADA_SHESM      ----------------------------------------------------------------------
FADA_PSEU5      ----------------------------------------------------------------------
THIL_SCHPO      ----------------------------------------------------------------------
FADI_KLEP7      --------------------------------------------------AEYSTGLRMGDTAEQMAKSW
FADA_SHISS      ----------------------------------------------------------------------
FADA_SHESW      ----------------------------------------------------------------------
FADA_SHEON      ----------------------------------------------------------------------
FADA_PSEAE      ----------------------------------------------------------------------
FADA_PSEAB      ----------------------------------------------------------------------
FADA_PSEA7      ----------------------------------------------------------------------
FADA_ECOUT      ----------------------------------------------------------------------
FADA_ECOK1      ----------------------------------------------------------------------
FADI_KLEP3      ----------------------------------------------------------------------
FADI_ERWT9      ----------------------------------------------------------------------
FADA_VIBPA      ----------------------------------------------------------------------
FADA_SHIFL      ----------------------------------------------------------------------
FADA_SHIF8      ----------------------------------------------------------------------
FADA_SHEPC      ----------------------------------------------------------------------
FADA_SHEB8      ----------------------------------------------------------------------
FADA_SHEB5      ----------------------------------------------------------------------
FADA_ECOLI      ----------------------------------------------------------------------
FADA_ECOHS      ----------------------------------------------------------------------
FADI_SHISS      ----------------------------------------------------------------------
FADI_SHIFL      ----------------------------------------------------------------------
FADI_SHEFN      ----------------------------------------------------------------------
FADI_SHEDO      ----------------------------------------------------------------------
FADI_SALTI      --------------------------------------------------AEYSTGLRMGDTAEQMAKTY
FADI_SALSV      --------------------------------------------------AEYSTGLRMGDTAEQMAKTY
FADI_SALPK      --------------------------------------------------AEYSTGLRMGDTAEQMAKTY
FADI_SALPC      --------------------------------------------------AEYSTGLRMGDTAEQMAKTY
FADI_SALPB      --------------------------------------------------AEYSTGLRMGDTAEQMAKTY
FADI_SALPA      --------------------------------------------------AEYSTGLRMGDTAEQMAKTY
FADI_SALNS      --------------------------------------------------AEYSTGLRMGDTAEQMAKTY
FADI_SALHS      --------------------------------------------------AEYSTGLRMGDTAEQMAKTY
FADI_SALEP      --------------------------------------------------AEYSTGLRMGDTAEQMAKTY
FADI_SALDC      --------------------------------------------------AEYSTGLRMGDTAEQMAKTY
FADI_SALA4      --------------------------------------------------AEYSTGLRMGDTAEQMAKTY
FADA_VIBVY      ----------------------------------------------------------------------
FADA_VIBVU      ----------------------------------------------------------------------
FADI_SALTY      --------------------------------------------------AEYSTGLRMGDTAEQMAKTY
FADA_SHEDO      ----------------------------------------------------------------------
FADA_SERP5      ----------------------------------------------------------------------
FADA_ERWT9      ----------------------------------------------------------------------
FADA_ALISL      ----------------------------------------------------------------------
FADI_SHIBS      ----------------------------------------------------------------------
FADI_SHIB3      ----------------------------------------------------------------------
FADI_SALCH      ----------------------------------------------------------------------
FADI_SALAR      ----------------------------------------------------------------------
FADI_ECOSM      ----------------------------------------------------------------------
FADI_ECOSE      ----------------------------------------------------------------------
FADI_ECOLU      ----------------------------------------------------------------------
FADI_ECOLI      ----------------------------------------------------------------------
FADI_ECOLC      ----------------------------------------------------------------------
FADI_ECOL6      ----------------------------------------------------------------------
FADI_ECOHS      ----------------------------------------------------------------------
FADI_ECODH      ----------------------------------------------------------------------
FADI_ECOBW      ----------------------------------------------------------------------
FADI_ECO8A      ----------------------------------------------------------------------
FADI_ECO7I      ----------------------------------------------------------------------
FADI_ECO55      ----------------------------------------------------------------------
FADI_ECO27      ----------------------------------------------------------------------
FADI_ECO24      ----------------------------------------------------------------------
FADI_CITK8      ----------------------------------------------------------------------
FADA_SHEAM      ----------------------------------------------------------------------
FADA_PSEPU      ----------------------------------------------------------------------
FADA_PSEPK      ----------------------------------------------------------------------
FADA_PSEP1      ----------------------------------------------------------------------
FADA_PSEE4      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GLKSAPARYAIAARRHMETYGTTSEQLGXXXXXXXXXXXMNPLAQMREPITIDDHQNSRMIADPLRLLDC
Y793_METTH      -----PSLYAMMARRHMYEYGTTREQLAMVSVINHENASNNPRAQFPMKVTVEQVMNSTMVADPLRLLDC
NLTP_RAT        GMSAAPQLFGSAGKEHMETYGTKVEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEIMKSRPVFDFLTVLQC
NLTP_RABIT      GLSAAPQMFGSAGKEHMEKYGTKIEHFAKIGWKNHKHSVNNPYSQFQKEYSLDEVMSSRPIFDFLTVLQC
Y1549_METJA     -----PSLYAMMAQRYMYEYGLTLEELSMWSVIMHENASKNRYAQFPFKVTLEQVLNSSPVAEPLRLLHC
NLTP_MOUSE      GLSATPQMFGYAGKEHMEKYGTKVEHFAKIGWKNHKHSVNNTYSQFQDEYSLEEVMKSKPVFDFLTILQC
NLTP_BOVIN      ----APQMFGNAGKEHMEKYGTTLEHFAKIGWKNHKHSVNNPYSQFQKEYSLDEVMTSRKIFDFLTVLQC
NLTP_HUMAN      GLSAAPQMFGYAGKEHMEKYGTKIEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQC
NLTP_CHICK      GLASAPITFANAGKEHMEKYGTNPEYFAKIAWKNHSHSTNNPYSQFQKKYTLDEVLQSRKVFDFLTVLQC
FADA_AERS4      GI-SRQQQDEFAARSHRRAYAATVEGVGLEGHDASGARFFYDYDEVIRPTTVETLSQLRPVFDPVNGTTS
FADA_IDILO      ----------------------------------------------------------------------
FADA_AERHH      ---------------------------------------------IRPETTVETLSQLRPVFDPVNGTTS
FADA_ENT38      ----------------------------------------------------------------------
FADA_MARAV      ----------------------------------------------------------------------
FADA_ENTCL      ----------------------------------------------------------------------
FADA_ALCBS      ---------------------------------------------IRPGASIEDMQKLRPVFDPVTAGTS
FADA_ENTS8      ----------------------------------------------------------------------
THIKB_RAT       ----------------------------------------------------------------------
THIKA_RAT       ----------------------------------------------------------------------
FADA_PSEHT      ----------------------------------------------------------------------
FADA_SALTY      ----------------------------------------------------------------------
FADA_SALTI      ----------------------------------------------------------------------
FADA_SALPA      ----------------------------------------------------------------------
FADA_SALCH      ----------------------------------------------------------------------
THIKB_MOUSE     ----------------------------------------------------------------------
THIKA_MOUSE     ----------------------------------------------------------------------
FADA_ECO24      ----------------------------------------------------------------------
FADA_SHESA      ----------------------------------------------------------------------
FADA_SHELP      ----------------------------------------------------------------------
FADA_SACD2      ----------------------------------------------------------------------
THIL_YARLI      ----------------------------------------------------------------------
THIL_MYCTU      ----------------------------------------------------------------------
THIL_MYCBO      ----------------------------------------------------------------------
THIA_CANTR      ----------------------------------------------------------------------
FADA_KLEP7      ----------------------------------------------------------------------
FADA_HAHCH      ----------------------------------------------------------------------
FADA_ECOL6      ----------------------------------------------------------------------
FADA_ECOL5      ----------------------------------------------------------------------
FADA_SHIDS      ----------------------------------------------------------------------
FADA_ECO57      ----------------------------------------------------------------------
THLA_CLOAB      ----------------------------------------------------------------------
THIB_CANTR      ----------------------------------------------------------------------
FADI_ENT38      AEYSTGLRMGDTAEQMAKTYGITREQLGDEVMTVYIPPFREPLSEIRGTSTLADYAKLRPAFDTVTAANS
FADI_SHIF8      ----------------------------------------------------------------------
FADA_SHIBS      ----------------------------------------------------------------------
FADA_SHESR      ----------------------------------------------------------------------
FADA_SHESM      ----------------------------------------------------------------------
FADA_PSEU5      ----------------------------------------------------------------------
THIL_SCHPO      ----------------------------------------------------------------------
FADI_KLEP7      GI-SREQQDALAHRSHQLAAKAWEEKLSAEVMTAYAPPFREPLEQIRKNSTLADYQKLRPAFDTVTAANS
FADA_SHISS      ----------------------------------------------------------------------
FADA_SHESW      ----------------------------------------------------------------------
FADA_SHEON      ----------------------------------------------------------------------
FADA_PSEAE      ----------------------------------------------------------------------
FADA_PSEAB      ----------------------------------------------------------------------
FADA_PSEA7      ----------------------------------------------------------------------
FADA_ECOUT      ----------------------------------------------------------------------
FADA_ECOK1      ----------------------------------------------------------------------
FADI_KLEP3      -----------------------------------------PLEQIRKNSTLADYQKLRPAFDTVTAANS
FADI_ERWT9      ----------------------------------------------------------------------
FADA_VIBPA      ----------------------------------------------------------------------
FADA_SHIFL      ----------------------------------------------------------------------
FADA_SHIF8      ----------------------------------------------------------------------
FADA_SHEPC      ----------------------------------------------------------------------
FADA_SHEB8      ----------------------------------------------------------------------
FADA_SHEB5      ----------------------------------------------------------------------
FADA_ECOLI      ----------------------------------------------------------------------
FADA_ECOHS      ----------------------------------------------------------------------
FADI_SHISS      ----------------------------------------------------------------------
FADI_SHIFL      ----------------------------------------------------------------------
FADI_SHEFN      ----------------------------------------------------------------------
FADI_SHEDO      ----------------------------------------------------------------------
FADI_SALTI      GI-TREQQDALAHRSHQRAAQAWAEKLAEEVMTTYVPPYKNPFAEIRGASTLADYAKLRPAFDSVTAANS
FADI_SALSV      GI-TREQQDALAHRSHQRAAQAWAEKLAEEVMTTYVPPYKNPFAEIRGTSTLADYAKLRPAFDSVTAANS
FADI_SALPK      GI-TREQQDALAHRSHQRAAQAWAEKLAEEVMTTYVPPYKNPFAEIRGASTLADYAKLRPAFDSVTAANS
FADI_SALPC      GI-TREQQDALAHRSHQRAAQAWAEKLAEEVMTTYVPPYKNPFAEIRGTSTLADYAKLRPAFDSVTAANS
FADI_SALPB      GI-TREQQDALAHRSHQRAAQAWAEKLAEEVMTTYVPPYKNPFAEIRGASTLADYAKLRPAFDSVTAANS
FADI_SALPA      GI-TREQQDALAHRSHQRAAQAWAEKLAEEVMTTYVPPYKNPFAEIRGASTLADYAKLRPAFDSVTAANS
FADI_SALNS      GI-TREQQDALAHRSHQRAAQAWAEKLAEEVMTTYVPPYKNPFAEIRGTSTLADYAKLRPAFDSVTAANS
FADI_SALHS      GI-TREQQDALAHRSHQRAAQAWAEKLAEEVMTTYVPPYKNPFAEIRGASTLADYAKLRPAFDSVTAANS
FADI_SALEP      GI-TREQQDALAHRSHQRAAQAWAEKLAEEVMTTYVPPYKNPFAEIRGASTLADYAKLRPAFDSVTAANS
FADI_SALDC      GI-TREQQDALAHRSHQRAAQAWAEKLAEEVMTTYVPPYKNPFAEIRGASTLADYAKLRPAFDSVTAANS
FADI_SALA4      GI-TREQQDALAHRSHQRAAQAWAEKLAEEVMTTYVPPYKNPFAEIRGASTLADYAKLRPAFDSVTAANS
FADA_VIBVY      ----------------------------------------------------------------------
FADA_VIBVU      ----------------------------------------------------------------------
FADI_SALTY      GI-TREQQDALAHRSHQRAAQAWAEKLAEEVMTTYVPPYKNPFAEIRGASTLADYAKLRPAFDSVTAANS
FADA_SHEDO      ----------------------------------------------------------------------
FADA_SERP5      ----------------------------------------------------------------------
FADA_ERWT9      ----------------------------------------------------------------------
FADA_ALISL      ----------------------------------------------------------------------
FADI_SHIBS      ----------------------------------------------------------------------
FADI_SHIB3      ----------------------------------------------------------------------
FADI_SALCH      ----------------------------------------------------------------------
FADI_SALAR      ----------------------------------------------------------------------
FADI_ECOSM      ----------------------------------------------------------------------
FADI_ECOSE      ----------------------------------------------------------------------
FADI_ECOLU      ----------------------------------------------------------------------
FADI_ECOLI      ----------------------------------------------------------------------
FADI_ECOLC      ----------------------------------------------------------------------
FADI_ECOL6      ----------------------------------------------------------------------
FADI_ECOHS      ----------------------------------------------------------------------
FADI_ECODH      ----------------------------------------------------------------------
FADI_ECOBW      ----------------------------------------------------------------------
FADI_ECO8A      ----------------------------------------------------------------------
FADI_ECO7I      ----------------------------------------------------------------------
FADI_ECO55      ----------------------------------------------------------------------
FADI_ECO27      ----------------------------------------------------------------------
FADI_ECO24      ----------------------------------------------------------------------
FADI_CITK8      ----------------------------------------------------------------------
FADA_SHEAM      ----------------------------------------------------------------------
FADA_PSEPU      ----------------------------------------------------------------------
FADA_PSEPK      ----------------------------------------------------------------------
FADA_PSEP1      ----------------------------------------------------------------------
FADA_PSEE4      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           CLVSNGAIAIIVTSAERAADLAQPPVHIWGWGQAHPGYTSYRDSNFGLVSGAAQSGPAALRMAGVTVDEI
Y793_METTH      SPISDGAAAVILCPADMAREYTDTPVYVKASAQASGTIALHDRRDITRIDATVNAARNAFKMAKLTPGDI
NLTP_RAT        CPTSDGAAAAIVSSEEQKHGLQSKAVEIVAQEMVTDMPSTFEEKSVIKMVGYDMSKEAARKKSGLGPSDV
NLTP_RABIT      CPTSDGAAAAILASEEKKYGLQSKAVEILAQEMVTDFPSSFEEKSIIKMVGFDMSKEAARRKSGLRPSDI
Y1549_METJA     SPVSDGAAALIVCEAEKAKEFVNKDIYIKASVQASDTIALHSRESITSLKAAKVASEKAYKMANIEPKDV
NLTP_MOUSE      CPTSDGAAAAILSSEEQQYGLQSKAVEIVAQEMMTDLPSTFEEKSIIKVVGYDMSKEAARRCSGLTPNDV
NLTP_BOVIN      CPTSDGAAAAILASEAQKHNLKPKAVEILAQEMVTDMPSSFEGKSIIKMVGFDMSKEAARRCSGLRPSDI
NLTP_HUMAN      CPTSDGAAAAILASEAQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCSGLTPNDI
NLTP_CHICK      CPTSNGAAAAILASEDKRHKLQPQAVEILAQVMATDYPSTFEENSCMKMVGYDMTKKAAFKKAGLKPTDV
FADA_AERS4      SALSDGASAMLVMSADRAKALGLTPMAVAGCDAAIMGY------------GPVPATQKALKRAGLTIGDI
FADA_IDILO      --LSDGAAAMLVMSADKAKELGLTPIRSMAVAGCDPSIMGY---------GPVPATEKALKRAGVSIDDI
FADA_AERHH      SALSDGAAAMLVMSADRAKALGLTPMAVAGCDAAIMGY------------GPVPATQKALKRAGLTIGDI
FADA_ENT38      --LSDGAAAMLVMSESRARELGLTPMAVVGCDPSIMGY------------GPVPASKLALKKAGLTASEI
FADA_MARAV      --LTDGASAMVLMSAERAEALGLTPIAVAGCDPAIMGY------------GPVPATKKALKRAGLKVEDI
FADA_ENTCL      --LSDGAAAMLVMSESRARELGLTPMAVVGCDPSIMGY------------GPVPASKLALKKAGLTASDI
FADA_ALCBS      SALSDGASAMLVMSAERAQALGLKPMAVAGCDAAIMGY------------GPVPATQKALARAGLTIDDI
FADA_ENTS8      --LSDGAAAMLVMSESRARELGLTPMAVVGCDPSIMGY------------GPVPASKLALKKAGLTASDI
THIKB_RAT       --VSDGAAAVLLARRSKAEELGLP---ILGVLRSY-AVVGVPPDIMGI--GPAYAIPAALQKAGLTVNDI
THIKA_RAT       --VSDGAAAVLLARRSKAEELGLP---ILGVLRSY-AVVGVPPDIMGI--GPAYAIPAALQKAGLTVNDI
FADA_PSEHT      --LSDGASAMLVMSEAKAKELGLPRIKAMAVAGCDPSIMGY---------GPVPASKKALAQAGITIDDL
FADA_SALTY      --LSDGAAAMLVMSESRARELGLKPMAVVGCDPSIMGY------------GPVPASKLALKKAGLSASDI
FADA_SALTI      --LSDGAAAMLVMSESRARELGLKPMAVVGCDPSIMGY------------GPVPASKLALKKAGLSASDI
FADA_SALPA      --LSDGAAAMLVMSESRARELGLKPMAVVGCDPSIMGY------------GPVPASKLALKKAGLSASDI
FADA_SALCH      --LSDGAAAMLVMSESRARELGLKPMAVVGCDPSIMGY------------GPVPASKLALKKAGLSASDI
THIKB_MOUSE     --VSDGAAAVLLARRSKAEELGLP---ILGVLRSY-AVVGVPPDVMGI--GPAYAIPAALQKAGLTVNDI
THIKA_MOUSE     --VSDGAAAVLLARRSKAEELGLP---ILGVLRSY-AVVGVPPDVMGI--GPAYAIPAALQKAGLTVNDI
FADA_ECO24      --LSDGAAAMLVMSESRAHELGLKPMAVVGCDPAIMGY------------GPVPASKLALKKAGLSVSDI
FADA_SHESA      --LSDGASAMLVMEESKARALGLPSMAVAGCDAAIMGY------------GPVPATQKALARAGITVNDL
FADA_SHELP      --LSDGASAMLVMEEEKAKALGLPSMAVAGCDAAIMGY------------GPVPATQKALQRAGLTMNDI
FADA_SACD2      --ITDGASSMLVMSAAKAAELGLTPIRSMALAGVDPSIMGY---------GPVPATQKALANAGLSIEDI
THIL_YARLI      --INDGASAVVVASGTKAKELGTPVL---------AKIVSYADAATAPIDAPSLAIPAALKKAGLTKDDI
THIL_MYCTU      --ISDGAAAVVVMNQEKAQELGLTWLAEIG---AH-GVVAGPDST--LQSQPANAINKALDREGISVDQL
THIL_MYCBO      --ISDGAAAVVVMNQEKAQELGLTWLAEIG---AH-GVVAGPDST--LQSQPANAINKALDREGISVDQL
THIA_CANTR      --LNDGGAALVLVSEAKLKQLGLKPLKISGWGEA-------ARTPFDFTIAPALAVPKAVKHAGLTVDRV
FADA_KLEP7      --LSDGAAAMLLMSESRARELGLKPMAVVGCDPSIMGY------------GPVPASKLALKKAGLSTSDI
FADA_HAHCH      --LTDGASAMLLMSAERAQALGLTPIRSMATAGCDPAIMGY---------GPVPATKKALKRAGLKVEDI
FADA_ECOL6      --LSDGAAAMLVMSESRARDLGLKPMAVVGCDPSIMGY------------GPVPASKLALKKAGLSASDI
FADA_ECOL5      --LSDGAAAMLVMSESRARDLGLKPMAVVGCDPSIMGY------------GPVPASKLALKKAGLSASDI
FADA_SHIDS      --LSDGAAAMLVMSESRAHELGLKPMAVVGCDPSIMGY------------GPVPASKLALKKAGLSVSDI
FADA_ECO57      --LSDGAAAMLVMSESRAHELGLKPMAVVGCDPSIMGY------------GPVPASKLALKKAGLSVSDI
THLA_CLOAB      ------AAVLVIMSAEKAKELGVKPLKIVSYGSADPAIMGY---------GPFYATKAAIEKAGWTVDEL
THIB_CANTR      --LNDGGAALVLVSEAKLKQLGLKPLKISGWGEA-------ARTPFDFTIAPALAVPKAVKHAGLTVDRV
FADI_ENT38      TPLTDGAAAVILMTESRAKELGLVPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTLSDL
FADI_SHIF8      --LTDGAAAVILMTESRAKELGLVPL---GYLRSY-AFTAI-DVWQDMLLGPARSTPLALERAGLTMSEL
FADA_SHIBS      --LSDGAAAMLVMSESRAHELGLKPVRSMAVVGCNPSIMGY---------GPVPASKLALKKAGLSASDI
FADA_SHESR      --LSDGASAMLVMEESKARALGLPSMAVAGCDAAIMGY------------GPVPATQKALARAGITVNDL
FADA_SHESM      --LSDGASAMLVMEESKARALGLPSMAVAGCDAAIMGY------------GPVPATQKALARAGITVNDL
FADA_PSEU5      --ITDGASCMIVMSAQRAKDLGLQPVRAMALAGVDPAIMGY---------GPVPSTQKALKRAGLTMDDI
THIL_SCHPO      --LNDGASALVLMSAAKVKELGLKPLKIIGWGEAAQDPERFTTS-------PSLAIPKALKHAGIEASQV
FADI_KLEP7      TPLTDGAAAVILMTESRAKELGLRPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTLADL
FADA_SHISS      --LSDGAAAMLVMSESRARELGLKPMAVVGCDPSIMGY------------GPVPASKLALKKAGLSASDI
FADA_SHESW      --LSDGASAMLIMEESKARALSLPSMAVAGCDAAIMGY------------GPVPATQKALARAGITVADL
FADA_SHEON      --LSDGASAMLIMEESKARALGLPSMAVAGCDAAIMGY------------GPVPATQKALARAGITVNDL
FADA_PSEAE      --ITDGASCMIVMSAQRAQDLGIQPMAVMAVAGVDPAIMGY---------GPVPSTNKALKRAGLTIADI
FADA_PSEAB      --ITDGASCMIVMSAQRAQDLGIQPMAVMAVAGVDPAIMGY---------GPVPSTNKALKRAGLTIADI
FADA_PSEA7      --ITDGASCMIVMSAQRAQDLGIQPMAVMAVAGVDPAIMGY---------GPVPSTNKALKRAGLTIADI
FADA_ECOUT      --LSDGAAAMLVMSESRARELGLKPMAVVGCDPSIMGY------------GPVPASKLALKKAGLSASDI
FADA_ECOK1      --LSDGAAAMLVMSESRARELGLKPMAVVGCDPSIMGY------------GPVPASKLALKKAGLSASDI
FADI_KLEP3      TPLTDGAAAVILMTESRAKELGLTPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTLADL
FADI_ERWT9      --LTDGAAAVILMTASRARELGIAPL-----GFLRSYAFSAIDVRQDMLLGPSYASPLALDRAGITLADL
FADA_VIBPA      --LSDGASAMLIMSEEKANELGKIRARIKGMAIADPSIMGY---------GPVPATQKALKRAGLAIEDM
FADA_SHIFL      --LSDGAAAMLVMSESRAHELGLKPMAVVGCDPSIMGY------------GPVPASKLALKKAGLSASDI
FADA_SHIF8      --LSDGAAAMLVMSESRAHELGLKPMAVVGCDPSIMGY------------GPVPASKLALKKAGLSASDI
FADA_SHEPC      --LSDGASAMLIMEESKARALGLPSMAVAGCDAAIMGY------------GPVPATQKALARAGITVADL
FADA_SHEB8      --LSDGASAMLIMEESKARALGLPSMAVAGCDAAIMGY------------GPVPATQKALARAGITVADL
FADA_SHEB5      --LSDGASAMLIMEESKARALGLPSMAVAGCDAAIMGY------------GPVPATQKALARAGITVADL
FADA_ECOLI      --LSDGAAAMLVMSESRAHELGLKPMAVVGCDPSIMGY------------GPVPASKLALKKAGLSASDI
FADA_ECOHS      --LSDGAAAMLVMSESRAHELGLKPMAVVGCDPSIMGY------------GPVPASKLALKKAGLSASDI
FADI_SHISS      --LTDGAAAVILMTESRAKELGLVPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMSEL
FADI_SHIFL      --LTDGATAVILMTESRAKELGLVPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMSEL
FADI_SHEFN      --LTDGASAIILMSEGRAKALGYQPI---GYIKSY-AFTAI-DVWQDMLMGPSYATPLALKRAGMELEDL
FADI_SHEDO      --LTDGASAIILMSEGRAKALGYQPI---GYIKSY-AFTAI-DVWQDMLMGPSYATPLALKRAGMELEDL
FADI_SALTI      TPLTDGAAAVILMTESRAKELGLRPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMADL
FADI_SALSV      TPLTDGAAAVILMTESRAKELG---LHPLGYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMADL
FADI_SALPK      TPLTDGAAAVILMTESRAKELG---LHPLGYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMADL
FADI_SALPC      TPLTDGAAAVILMTESRAKELGLRPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMADL
FADI_SALPB      TPLTDGAAAVIMMTESRAKELGLRPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMADL
FADI_SALPA      TPLTDGAAAVILMTESRAKELG---LHPLGYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMADL
FADI_SALNS      TPLTDGAAAVILMTESRAKELG---LHPLGYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMADL
FADI_SALHS      TPLTDGAAAVILMTESRAKELGLRPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMADL
FADI_SALEP      TPLTDGAAAVIMMTESRAKELGLRPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMADL
FADI_SALDC      TPLTDGAAAVIMMTESRAKELGLRPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMADL
FADI_SALA4      TPLTDGAAAVIMMTESRAKELGLRPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMADL
FADA_VIBVY      --LSDGASAMLIMSEEKANELGVTRARIKGMAIADPSIMGY---------GPVPATQKALKRAGLSIEDM
FADA_VIBVU      --LSDGASAMLIMSEEKANELGVTRARIKGMAIADPSIMGY---------GPVPATQKALKRAGLSIEDM
FADI_SALTY      TPLTDGAAAVILMTESRAKELGLRPL---GYLRTY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMADL
FADA_SHEDO      --LSDGASAMLVMEESKARALGLPSMAVAGCDAAIMGY------------GPVPATQKALARAGLTVADL
FADA_SERP5      --------------------------------------------------GPVPASKLALKRAGLSVQDI
FADA_ERWT9      --------------------------------------------------GPVPASQLALKRAGLSIADI
FADA_ALISL      --------------------------------------------------GPVPATKKALKRAGLSIDDI
FADI_SHIBS      --LTDGAAAVILMTESRAKELGLVPL---GYLRSY-AFTAI-DVWQDMLFGPAWSTPLALERAGLTMSDL
FADI_SHIB3      --LTDGAAAVILMTESRAKELGLVPL---GYLRSY-AFTAI-DVWQDMLFGPAWSTPLALERAGLTMSDL
FADI_SALCH      --LTDGAAAVILMTESRAKELGLRPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMADL
FADI_SALAR      --LTDGAAAVILMTESRAKELGLRPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMADL
FADI_ECOSM      --LTDGAAAVILMTESRAKELGLVPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMSDL
FADI_ECOSE      --LTDGAAAVILMTESRAKELGLVPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMSDL
FADI_ECOLU      --LTDGAAAVILMTESRAKELGLVPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMSDL
FADI_ECOLI      --LTDGAAAVILMTESRAKELGLVPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMSDL
FADI_ECOLC      --LTDGAAAVILMTESRAKELGLVPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMSDL
FADI_ECOL6      --LTDGAAAVILMTESRAKELGLVPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMSDL
FADI_ECOHS      --LTDGAAAVILMTESRAKELGLVPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMSDL
FADI_ECODH      --LTDGAAAVILMTESRAKELGLVPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMSDL
FADI_ECOBW      --LTDGAAAVILMTESRAKELGLVPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMSDL
FADI_ECO8A      --LTDGAAAVILMTESRAKELGLVPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMSDL
FADI_ECO7I      --LTDGAAAVILMTESRAKELGLVPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMSDL
FADI_ECO55      --LTDGAAAVILMTESRAKELGLVPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMSDL
FADI_ECO27      --LTDGAAAVILMTESRAKELGLVPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMSDL
FADI_ECO24      --LTDGAAAVILMTESRAKELGLVPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTMSDL
FADI_CITK8      --LTDGAAAVILMTESRAKELGLAPL---GYLRSY-AFTAI-DVWQDMLLGPAWSTPLALERAGLTLADL
FADA_SHEAM      --LSDGAAAMLVMEEEKARALGLTSMAVAGCDAAIMGY------------GPVPATQKALARAGLSIQDM
FADA_PSEPU      --ITDGASCMIVMSGQRAMDLGIQPLAVMAVAGVDPAIMGY---------GPVPSTQKALKRAGLTMADI
FADA_PSEPK      --ITDGASCMIVMSGQRAMDLGIQPLAVMAVAGVDPAIMGY---------GPVPSTQKALKRAGLTMADI
FADA_PSEP1      --ITDGASCMIVMSGQRAMDLGIQPLAVMAVAGVDPAIMGY---------GPVPSTQKALKRAGLTMADI
FADA_PSEE4      --ITDGASCMIVMSGQRAMDLGIQPLAVMAVAGVDPAIMGY---------GPVPSTQKALKRAGLTMADI


                         .         *         .         .         .         .         +:350
query           DIREIYDCFTYTTLLTLEDYGFCAKGEGGEFVASGALAPGGSHPTNTGGGELSSYYMWGMTPLSEAVxxx
Y793_METTH      DLVEVHDCFSINGILAVEDLGFVEKGEGGRAFEDGMTRIDGDIPVNPSGGLKARGHPLGATGIAQA----
NLTP_RAT        DVIELHDCFSTNELLTYEALGLCPEGQGGALVDRGDNTYGGKWVINPSGGLISKGHPLGATGLAQ-----
NLTP_RABIT      DVIELHDCFSANELLTYEALGLCPEGKGGALVDRGDNTYGGKWVINPSGGLISKGHPLGATGLAQ-----
Y1549_METJA     DVAEVHDCFAINGLILMEELGFCKKGEAGKIVYDKKIA--------------------------------
NLTP_MOUSE      DVIELHDCFSVNELITYEALGLCPEGQGGTLVDRGDNTYGGKWVINPSGGLISKGHPLGATGLAQ-----
NLTP_BOVIN      DVIELHDCFSANELITYEALGLCPEGQGGKLVERGDNTYGGKWVINPSGGLISKGHPLGATGLAQCV---
NLTP_HUMAN      DVIELHDCFSTNELLTYEALGLCPEGQGATLVDRGDNTYGGKWVINPSGGLISKGHPLGATGLAQ-----
NLTP_CHICK      DVIELHDCFSVNEFITYEALGLCPEGKACDLIDRGDNTYGGKWVINPSGGLISKGHPLGATGLAQS----
FADA_AERS4      DLVELNEAFAAQSLPCVKDLGLLDVAEEKVNLNGGAIALG--HPLGCSGSRIST----------------
FADA_IDILO      DVVELNEAFAAQSLPVLKGLKLFDKMEEKVNLNGGAIALG--HPLGCSGARIST----------------
FADA_AERHH      DLFELNEAFAAQSLPCVKDLGLQDVVDEKVNLNGGAIALG--HPLGCSGARIST----------------
FADA_ENT38      DVFEMNEAFAAQILPCIKDLGLMEQIDEKINLNGGAIALG--HPLGCSGARIST----------------
FADA_MARAV      DFWELNEAFAGQSLPVLKDLKLLGVMEEKVNLNGGAIALG--HPLGCSGARIST----------------
FADA_ENTCL      DLFEMNEAFAAQILPCIKDLGLMGQIDEKINLNGGAIALG--HPLGCSGARIST----------------
FADA_ALCBS      DYVELNEAFAAQSLPVAXXXXXXXXMEEKVNLNGGAIALG--HPLGCSGARIT-----------------
FADA_ENTS8      DLFEMNEAFAAQILPCIKDLGLMEQIDEKINLNGGAIALG--HPLGCSGARIST----------------
THIKB_RAT       DIFEINEAFASQALYCVEKLGIPAEKVN---PLGGAIALG--HPLGCTG---------------------
THIKA_RAT       DIFEINEAFASQALYCVEKLGIPAEKVN---PLGGAIALG--HPLGCTG---------------------
FADA_PSEHT      GVVELNEAFAAQSLPVMKDLGLMDVVDEKVNLNGGAIALG--HPLGCSGSRIST----------------
FADA_SALTY      DVFEMNEAFAAQILPCIKDLGLMEQIDEKINLNGGAIALG--HPLGCSGARIST----------------
FADA_SALTI      DVFEMNEAFAAQILPCIKDLGLMEQIDEKINLNGGAIALG--HPLGCSGARIST----------------
FADA_SALPA      DVFEMNEAFAAQILPCIKDLGLMEQIDEKINLNGGAIALG--HPLGCSGARIST----------------
FADA_SALCH      DVFEMNEAFAAQILPCIKDLGLMEQIDEKINLNGGAIALG--HPLGCSGARIST----------------
THIKB_MOUSE     DIFEINEAFASQAVYCVEKLGIPAEKVN---PLGGAIALG--HPLGCTG---------------------
THIKA_MOUSE     DIFEINEAFASQAVYCVEKLGIPAEKVN---PLGGAIALG--HPLGCTG---------------------
FADA_ECO24      GVFEMNEAFAAQILPCIKDLGLIEQIDEKINLNGGAIALG--HPLGCSGARIST----------------
FADA_SHESA      DVIELNEAFAAQSLPCVKDLGLLDVVEDKINLNGGAIALG--HPLGCSGARIST----------------
FADA_SHELP      DLIELNEAFAAQSLPCVKDLGLMDLVDEKVNLNGGAIALG--HPLGCSGARIST----------------
FADA_SACD2      DVVELNEAFAAQALPVLKDLNLLDAMEDKVNLYGGAIALG--HPFGCSGTRIT-----------------
THIL_YARLI      ALWEINEAFSGVALANLMRLGI---DKSKVNVKGGAVALG--HPIGASGNRI------------------
THIL_MYCTU      DVVEINEAFAAVALASIRELGLNPQIVN---VNGGAIAVG--HPLGMSGTRIT-----------------
THIL_MYCBO      DVVEINEAFAAVALASIRELGLNPQIVN---VNGGAIAVG--HPLGMSGTRIT-----------------
THIA_CANTR      DFFELNEAFSVVGLANAELVNIPLEKLN---VYGGAVAMG--HPLGCSGARI------------------
FADA_KLEP7      DVFEMNEAFAAQILPCIKDLGLMEQIDEKINLNGGAIALG--HPLGCSGARIST----------------
FADA_HAHCH      DFWELNEAFAAQSLPVIKDLKLMGVVDQKVNLNGGAIALG--HPLGCSGARIST----------------
FADA_ECOL6      GVFEMNEAFAAQILPCIKDLGLMEQIDEKINLNGGAIALG--HPLGCSGARIST----------------
FADA_ECOL5      GVFEMNEAFAAQILPCIKDLGLMEQIDEKINLNGGAIALG--HPLGCSGARIST----------------
FADA_SHIDS      GVFEMNEAFAAQILPCIKDLGLIEQIDEKINLNGGAIALG--HPLGCSGARIST----------------
FADA_ECO57      GVFEMNEAFAAQILPCIKDLGLIEQIDEKINLNGGAIALG--HPLGCSGARIST----------------
THLA_CLOAB      DLIESNEAFAAQSLAVAKDLKFDMNKVN---VNGGAIALG--HPIGASGARI------------------
THIB_CANTR      DFFELNEAFSVVGLANAE----------------------------------------------------
FADI_ENT38      TLIDMHEAFAAQTLANLQLLG-------------------------------------------------
FADI_SHIF8      TLIDMHEAFAAQTLANIQLLG-------------------------------------------------
FADA_SHIBS      GVFEMNEAFAAQILPCIKDLGLMEQIDEKINLNGGAIALG--HPLGCSGARIST----------------
FADA_SHESR      DVIELNEAFAAQSLPCVKDLGLLDVVDEKINLNGGAIALG--HPLGCSGARIST----------------
FADA_SHESM      DVIELNEAFAAQSLPCVKDLGLLDVVDEKINLNGGAIALG--HPLGCSGARIST----------------
FADA_PSEU5      SHVELNEAFAAQALPVXXXXXXXXXXXXXVNLHGGAIALG--HPFGCSGARIS-----------------
THIL_SCHPO      DYYEINEAFSVVAVANTKILGLDPERVN---INGGGVAMG--HPLGSSGSRI------------------
FADI_KLEP7      TLIDMHEAFAAQTLANLQ----------------------------------------------------
FADA_SHISS      GVFEMNEAFAAQILPCIKDLGLMEQIDEKINLNGGAIALG--HPLGCSGARIST----------------
FADA_SHESW      DVIELNEAFAAQSLPCVKDLGLADVVDDKINLNGGAIALG--HPLGCSGARIST----------------
FADA_SHEON      DVIELNEAFAAQSLPCVKDLGLLDVVDEKINLNGGAIALG--HPLGCSGARIST----------------
FADA_PSEAE      DFVELNEAFAAQALPVXXXXXXXXXXXXXVNLHGGAIALG--HPFGCSGARIS-----------------
FADA_PSEAB      DFVELNEAFAAQALPVXXXXXXXXXXXXXVNLHGGAIALG--HPFGCSGARIS-----------------
FADA_PSEA7      DFVELNEAFAAQALPVXXXXXXXXXXXXXVNLHGGAIALG--HPFGCSGARIS-----------------
FADA_ECOUT      GVFEMNEAFAAQILPCIKDLGLMEQIDEKINLNGGAIALG--HPLGCSGARIST----------------
FADA_ECOK1      GVFEMNEAFAAQILPCIKDLGLMEQIDEKINLNGGAIALG--HPLGCSGARIST----------------
FADI_KLEP3      TLIDMHEAFAAQTLANLQ----------------------------------------------------
FADI_ERWT9      SLIDMHEAFAAQTLANLK----------------------------------------------------
FADA_VIBPA      DVVELNEAFAAQSLPCAKDLGLLEVMDEKVNLNGGAIALG--HPLGCSGARIST----------------
FADA_SHIFL      GVFEMNEAFAAQILPCIKDLGLMEQIDEKINLNGGAIALG--HPLGCSGARIST----------------
FADA_SHIF8      GVFEMNEAFAAQILPCIKDLGLMEQIDEKINLNGGAIALG--HPLGCSGARIST----------------
FADA_SHEPC      DVIELNEAFAAQSLPCVKDLGLADVVDDKINLNGGAIALG--HPLGCSGARIST----------------
FADA_SHEB8      DVIELNEAFAAQSLPCVKDLGLADVVDDKINLNGGAIALG--HPLGCSGARIST----------------
FADA_SHEB5      DVIELNEAFAAQSLPCVKDLGLADVVDDKINLNGGAIALG--HPLGCSGARIST----------------
FADA_ECOLI      GVFEMNEAFAAQILPCIKDLGLIEQIDEKINLNGGAIALG--HPLGCSGARIST----------------
FADA_ECOHS      GVFEMNEAFAAQILPCIKDLGLMEQIDEKINLNGGAIALG--HPLGCSGARIST----------------
FADI_SHISS      TLIDMHEAFAAQTLANIQLLG-------------------------------------------------
FADI_SHIFL      TLIDMHEAFAAQTLANIQLLG-------------------------------------------------
FADI_SHEFN      TLIEMHEAFAAQTLANMQMFG-------------------------------------------------
FADI_SHEDO      TLIEMHEAFAAQTLANMQMFG-------------------------------------------------
FADI_SALTI      TLFDMHEAFAAQTLANLQLLG-------------------------------------------------
FADI_SALSV      TLFDMHEAFAAQTLANLQLLG-------------------------------------------------
FADI_SALPK      TLFDMHEAFAAQTLANLQLLG-------------------------------------------------
FADI_SALPC      TLFDMHEAFAAQTLANLQLLG-------------------------------------------------
FADI_SALPB      TLFDMHEAFAAQTLANLQLLG-------------------------------------------------
FADI_SALPA      TLFDMHEAFAAQTLANLQLLG-------------------------------------------------
FADI_SALNS      TLFDMHEAFAAQTLANLQLLG-------------------------------------------------
FADI_SALHS      TLFDMHEAFAAQTLANLQLLG-------------------------------------------------
FADI_SALEP      TLFDMHEAFAAQTLANLQLLG-------------------------------------------------
FADI_SALDC      TLFDMHEAFAAQTLANLQLLG-------------------------------------------------
FADI_SALA4      TLFDMHEAFAAQTLANLQLLG-------------------------------------------------
FADA_VIBVY      DVIELNEAFAAQSLPCAKDLGLLDVMDEKVNLNGGAIALG--HPLGCSGARIST----------------
FADA_VIBVU      DVIELNEAFAAQSLPCAKDLGLLDVMDEKVNLNGGAIALG--HPLGCSGARIST----------------
FADI_SALTY      TLFDMHEAFAAQTLANLQLLG-------------------------------------------------
FADA_SHEDO      DVIELNEAFAAQSLPCVKDLGLQDVVEEKINLNGGAIALG--HPLGCSGARIST----------------
FADA_SERP5      DLFELNEAFAAQSLPCIKDLGLLDSIDDKINLNGGAIALG--HPLGCSGSRIST----------------
FADA_ERWT9      GVFELNEAFAAQTLPCIKDLGLMDKLDEKVNLNGGAIALG--HPLGCSGARIST----------------
FADA_ALISL      DLFELNEAFAAQSLPCIKDLGLFDVMEEKINLNGGAIALG--HPLGCSGSRIAT----------------
FADI_SHIBS      TLIDMHEAFAAQTLANIQLLG-------------------------------------------------
FADI_SHIB3      TLIDMHEAFAAQTLANIQLLG-------------------------------------------------
FADI_SALCH      TLFDMHEAFAAQTLANLQLLG-------------------------------------------------
FADI_SALAR      TLFDMHEAFAAQTLANLQLLG-------------------------------------------------
FADI_ECOSM      TLIDMHEAFAAQTLANIQLLG-------------------------------------------------
FADI_ECOSE      TLIDMHEAFAAQTLANIQLLG-------------------------------------------------
FADI_ECOLU      TLIDMHEAFAAQTLANIQLLG-------------------------------------------------
FADI_ECOLI      TLIDMHEAFAAQTLANIQLLG-------------------------------------------------
FADI_ECOLC      TLIDMHEAFAAQTLANIQLLG-------------------------------------------------
FADI_ECOL6      TLIDMHEAFAAQTLANIQLLG-------------------------------------------------
FADI_ECOHS      TLIDMHEAFAAQTLANIQLLG-------------------------------------------------
FADI_ECODH      TLIDMHEAFAAQTLANIQLLG-------------------------------------------------
FADI_ECOBW      TLIDMHEAFAAQTLANIQLLG-------------------------------------------------
FADI_ECO8A      TLIDMHEAFAAQTLANIQLLG-------------------------------------------------
FADI_ECO7I      TLIDMHEAFAAQTLANIQLLG-------------------------------------------------
FADI_ECO55      TLIDMHEAFAAQTLANIQLLG-------------------------------------------------
FADI_ECO27      TLIDMHEAFAAQTLANIQLLG-------------------------------------------------
FADI_ECO24      TLIDMHEAFAAQTLANIQLLG-------------------------------------------------
FADI_CITK8      SLIDMHEAFAAQTLANIQLLG-------------------------------------------------
FADA_SHEAM      DVIELNEAFAAQSLPCVKDLGLMDVVEDKVNLNGGAIALG--HPLGCSGARIST----------------
FADA_PSEPU      DFIELNEAFAAQALPXXXXXXXXXXXXXXXNLHGGAIALG--HPFGCSGARIS-----------------
FADA_PSEPK      DFIELNEAFAAQALPXXXXXXXXXXXXXXXNLHGGAIALG--HPFGCSGARIS-----------------
FADA_PSEP1      DFIELNEAFAAQALPXXXXXXXXXXXXXXXNLHGGAIALG--HPFGCSGARIS-----------------
FADA_PSEE4      DFIELNEAFAAQALPXXXXXXXXXXXXXXXNLHGGAIALG--HPFGCSGARIS-----------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Y793_METTH      ---------------------------------------
NLTP_RAT        ---------------------------------------
NLTP_RABIT      ---------------------------------------
Y1549_METJA     ---------------------------------------
NLTP_MOUSE      ---------------------------------------
NLTP_BOVIN      ---------------------------------------
NLTP_HUMAN      ---------------------------------------
NLTP_CHICK      ---------------------------------------
FADA_AERS4      ---------------------------------------
FADA_IDILO      ---------------------------------------
FADA_AERHH      ---------------------------------------
FADA_ENT38      ---------------------------------------
FADA_MARAV      ---------------------------------------
FADA_ENTCL      ---------------------------------------
FADA_ALCBS      ---------------------------------------
FADA_ENTS8      ---------------------------------------
THIKB_RAT       ---------------------------------------
THIKA_RAT       ---------------------------------------
FADA_PSEHT      ---------------------------------------
FADA_SALTY      ---------------------------------------
FADA_SALTI      ---------------------------------------
FADA_SALPA      ---------------------------------------
FADA_SALCH      ---------------------------------------
THIKB_MOUSE     ---------------------------------------
THIKA_MOUSE     ---------------------------------------
FADA_ECO24      ---------------------------------------
FADA_SHESA      ---------------------------------------
FADA_SHELP      ---------------------------------------
FADA_SACD2      ---------------------------------------
THIL_YARLI      ---------------------------------------
THIL_MYCTU      ---------------------------------------
THIL_MYCBO      ---------------------------------------
THIA_CANTR      ---------------------------------------
FADA_KLEP7      ---------------------------------------
FADA_HAHCH      ---------------------------------------
FADA_ECOL6      ---------------------------------------
FADA_ECOL5      ---------------------------------------
FADA_SHIDS      ---------------------------------------
FADA_ECO57      ---------------------------------------
THLA_CLOAB      ---------------------------------------
THIB_CANTR      ---------------------------------------
FADI_ENT38      ---------------------------------------
FADI_SHIF8      ---------------------------------------
FADA_SHIBS      ---------------------------------------
FADA_SHESR      ---------------------------------------
FADA_SHESM      ---------------------------------------
FADA_PSEU5      ---------------------------------------
THIL_SCHPO      ---------------------------------------
FADI_KLEP7      ---------------------------------------
FADA_SHISS      ---------------------------------------
FADA_SHESW      ---------------------------------------
FADA_SHEON      ---------------------------------------
FADA_PSEAE      ---------------------------------------
FADA_PSEAB      ---------------------------------------
FADA_PSEA7      ---------------------------------------
FADA_ECOUT      ---------------------------------------
FADA_ECOK1      ---------------------------------------
FADI_KLEP3      ---------------------------------------
FADI_ERWT9      ---------------------------------------
FADA_VIBPA      ---------------------------------------
FADA_SHIFL      ---------------------------------------
FADA_SHIF8      ---------------------------------------
FADA_SHEPC      ---------------------------------------
FADA_SHEB8      ---------------------------------------
FADA_SHEB5      ---------------------------------------
FADA_ECOLI      ---------------------------------------
FADA_ECOHS      ---------------------------------------
FADI_SHISS      ---------------------------------------
FADI_SHIFL      ---------------------------------------
FADI_SHEFN      ---------------------------------------
FADI_SHEDO      ---------------------------------------
FADI_SALTI      ---------------------------------------
FADI_SALSV      ---------------------------------------
FADI_SALPK      ---------------------------------------
FADI_SALPC      ---------------------------------------
FADI_SALPB      ---------------------------------------
FADI_SALPA      ---------------------------------------
FADI_SALNS      ---------------------------------------
FADI_SALHS      ---------------------------------------
FADI_SALEP      ---------------------------------------
FADI_SALDC      ---------------------------------------
FADI_SALA4      ---------------------------------------
FADA_VIBVY      ---------------------------------------
FADA_VIBVU      ---------------------------------------
FADI_SALTY      ---------------------------------------
FADA_SHEDO      ---------------------------------------
FADA_SERP5      ---------------------------------------
FADA_ERWT9      ---------------------------------------
FADA_ALISL      ---------------------------------------
FADI_SHIBS      ---------------------------------------
FADI_SHIB3      ---------------------------------------
FADI_SALCH      ---------------------------------------
FADI_SALAR      ---------------------------------------
FADI_ECOSM      ---------------------------------------
FADI_ECOSE      ---------------------------------------
FADI_ECOLU      ---------------------------------------
FADI_ECOLI      ---------------------------------------
FADI_ECOLC      ---------------------------------------
FADI_ECOL6      ---------------------------------------
FADI_ECOHS      ---------------------------------------
FADI_ECODH      ---------------------------------------
FADI_ECOBW      ---------------------------------------
FADI_ECO8A      ---------------------------------------
FADI_ECO7I      ---------------------------------------
FADI_ECO55      ---------------------------------------
FADI_ECO27      ---------------------------------------
FADI_ECO24      ---------------------------------------
FADI_CITK8      ---------------------------------------
FADA_SHEAM      ---------------------------------------
FADA_PSEPU      ---------------------------------------
FADA_PSEPK      ---------------------------------------
FADA_PSEP1      ---------------------------------------
FADA_PSEE4      ---------------------------------------