[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ55524.1

[Show Plain Result]


## Summary of Sequence Search
    1::656
   85::620     3e-63  32%  678 aa  STCD_RHIME RecName: Full=Probable N-methylproline demethylase;     
    2::541     6e-61  33%  651 aa  NADO_THEBR RecName: Full=NADH oxidase;         EC=1.-.-.-;
   10::693     2e-52  31%  730 aa  DHTM_METME RecName: Full=Trimethylamine dehydrogenase;       
    6::661     5e-51  30%  661 aa  BAIH_EUBSP RecName: Full=NADH-dependent flavin oxidoreductase;     
    3::500     3e-50  28%  672 aa  FADH_ECOLI RecName: Full=2,4-dienoyl-CoA reductase [NADPH];        
   82::633     2e-44  28%  639 aa  BAICD_EUBSP RecName: Full=Bile acid-inducible operon protein
    6::699     7e-43  30%  736 aa  DHDM_HYPSX RecName: Full=Dimethylamine dehydrogenase;       
    5::314     9e-25  31%  338 aa  NAMA_BACSU RecName: Full=NADPH dehydrogenase;       
   85::314     4e-24  34%  340 aa  NAMA_GEOKA RecName: Full=NADPH dehydrogenase;       
   87::322     5e-23  33%  338 aa  NAMA_BACA2 RecName: Full=NADPH dehydrogenase;       
   80::313     6e-23  33%  338 aa  NAMA_BACHD RecName: Full=NADPH dehydrogenase;       
   83::314     1e-22  35%  340 aa  NAMA_GEOSW RecName: Full=NADPH dehydrogenase;       
   59::314     2e-22  34%  340 aa  NAMA_GEOTN RecName: Full=NADPH dehydrogenase;       
    6::336     7e-22  33%  365 aa  NEMA_ECOLI RecName: Full=N-ethylmaleimide reductase;       
   84::315     7e-22  32%  339 aa  NAMA_BACLD RecName: Full=NADPH dehydrogenase;       
  155::364     1e-21  32%  400 aa  OYE2_YEAST RecName: Full=NADPH dehydrogenase 2;       
  155::364     3e-21  30%  400 aa  OYE3_YEAST RecName: Full=NADPH dehydrogenase 3;       
   84::313     1e-20  30%  338 aa  NAMA_LISW6 RecName: Full=NADPH dehydrogenase;       
  156::364     3e-20  29%  400 aa  OYE1_SACPS RecName: Full=NADPH dehydrogenase 1;       
   12::354     2e-19  28%  396 aa  OPR3_SOLLC RecName: Full=12-oxophytodienoate reductase 3;       
   12::355     3e-19  28%  391 aa  OPR3_ARATH RecName: Full=12-oxophytodienoate reductase 3;       
   85::322     3e-19  29%  339 aa  NAMA_CLOAB RecName: Full=NADPH dehydrogenase;       
    1::335     9e-19  31%  372 aa  OPR1_ARATH RecName: Full=12-oxophytodienoate reductase 1;       
   46::312     2e-18  32%  324 aa  OPRL1_ARATH RecName: Full=Putative 12-oxophytodienoate
  137::314     2e-18  33%  338 aa  NAMA_BACP2 RecName: Full=NADPH dehydrogenase;       
  105::343     2e-17  30%  372 aa  YQIG_BACSU RecName: Full=Probable NADH-dependent flavin
   85::314     2e-17  29%  345 aa  NAMA_BACWK RecName: Full=NADPH dehydrogenase;       
  129::314     2e-17  34%  346 aa  NAMA_BACCN RecName: Full=NADPH dehydrogenase;       
   84::313     4e-17  29%  338 aa  NAMA_LISMF RecName: Full=NADPH dehydrogenase;       
   84::313     4e-17  29%  338 aa  NAMA_LISMC RecName: Full=NADPH dehydrogenase;       
   84::321     4e-17  29%  338 aa  NAMA_LISIN RecName: Full=NADPH dehydrogenase;       
   85::314     5e-17  30%  345 aa  NAMA_BACC2 RecName: Full=NADPH dehydrogenase;       
   85::314     7e-17  30%  345 aa  NAMA_BACC0 RecName: Full=NADPH dehydrogenase;       
  157::339     9e-17  30%  376 aa  OPR1_SOLLC RecName: Full=12-oxophytodienoate reductase 1;       
   85::314     9e-17  31%  345 aa  NAMA_BACCZ RecName: Full=NADPH dehydrogenase;       
  155::337     1e-16  32%  374 aa  OPR2_ARATH RecName: Full=12-oxophytodienoate reductase 2;       
   84::321     1e-16  28%  338 aa  NAMA_LISMH RecName: Full=NADPH dehydrogenase;       
   85::314     2e-16  32%  345 aa  NAMA_BACC3 RecName: Full=NADPH dehydrogenase;       
   85::314     2e-16  32%  345 aa  NAMA_BACAH RecName: Full=NADPH dehydrogenase;       
   84::313     2e-16  29%  338 aa  NAMA_LISMO RecName: Full=NADPH dehydrogenase;       
   85::314     2e-16  32%  345 aa  NAMA_BACAN RecName: Full=NADPH dehydrogenase;       
   85::314     2e-16  32%  345 aa  NAMA_BACAC RecName: Full=NADPH dehydrogenase;       
   85::314     2e-16  32%  345 aa  NAMA_BACAA RecName: Full=NADPH dehydrogenase;       
   85::314     3e-16  30%  345 aa  NAMA_BACHK RecName: Full=NADPH dehydrogenase;       
   85::314     3e-16  30%  345 aa  NAMA_BACCR RecName: Full=NADPH dehydrogenase;       
   85::314     3e-16  31%  345 aa  NAMA_BACC4 RecName: Full=NADPH dehydrogenase;       
   85::314     3e-16  30%  345 aa  NAMA_BACC1 RecName: Full=NADPH dehydrogenase;       
   14::363     3e-16  26%  398 aa  KYE1_KLULA RecName: Full=Enoate reductase 1;AltName: Full=2-enoate
   31::371     9e-16  24%  395 aa  OYEC_SCHPO RecName: Full=Putative NADPH dehydrogenase C23G7.10c;   
   85::314     9e-16  30%  345 aa  NAMA_BACCQ RecName: Full=NADPH dehydrogenase;       
   85::314     9e-16  30%  345 aa  NAMA_BACC7 RecName: Full=NADPH dehydrogenase;       
   87::229     1e-15  35%  269 aa  OPRL2_ARATH RecName: Full=Putative 12-oxophytodienoate
  145::318     4e-11  25%  355 aa  OPRL_SOLLC RecName: Full=12-oxophytodienoate reductase-like
  108::263     4e-11  35%  407 aa  EBP1_CANAL RecName: Full=Probable NADPH dehydrogenase;       
 1747::1795    2e-07  48% 2111 aa  GLT1_SCHPO RecName: Full=Putative glutamate synthase [NADPH];        
  161::349     3e-07  29%  392 aa  OYEB_SCHPO RecName: Full=Putative NADPH dehydrogenase C5H10.10;    
 1816::1863    3e-07  49% 2194 aa  GLSN_MEDSA RecName: Full=Glutamate synthase [NADH], amyloplastic;    
 1774::1889    4e-07  32% 2145 aa  GLT1_YEAST RecName: Full=Glutamate synthase [NADH];       
  119::206     5e-07  30%  412 aa  YEIT_ECO57 RecName: Full=Uncharacterized oxidoreductase yeiT;      
   45::91      6e-07  45%  516 aa  OXLA_CROAT RecName: Full=L-amino-acid oxidase;         Short=LAAO; 
   45::91      6e-07  45%  516 aa  OXLA_CROAD RecName: Full=L-amino-acid oxidase;         Short=LAAO; 
  146::189     6e-07  45%  493 aa  GLTB_BACSU RecName: Full=Glutamate synthase [NADPH] small chain;   
  119::206     1e-06  30%  412 aa  YEIT_ECOLI RecName: Full=Uncharacterized oxidoreductase yeiT;      
   52::91      1e-06  52%  517 aa  OXLA_PSEAU RecName: Full=L-amino-acid oxidase;         Short=LAAO; 
   40::86      1e-06  43%  497 aa  OXLA_BOTJR RecName: Full=L-amino-acid oxidase;         Short=LAAO; 
   33::79      3e-06  40%  478 aa  OXLA_BOTMO RecName: Full=L-amino-acid oxidase;         Short=LAAO; 
  135::343     4e-06  29%  382 aa  OYEA_SCHPO RecName: Full=Putative NADPH dehydrogenase C5H10.04;    
   45::91      4e-06  43%  516 aa  OXLA_TRIST RecName: Full=L-amino-acid oxidase;         Short=LAAO; 
   46::91      4e-06  46%  517 aa  OXLA_OXYSC RecName: Full=L-amino-acid oxidase;         Short=LAAO; 
  119::164     5e-06  37%  413 aa  YEIT_SALTY RecName: Full=Uncharacterized oxidoreductase yeiT;      
  119::164     5e-06  37%  413 aa  YEIT_SALTI RecName: Full=Uncharacterized oxidoreductase yeiT;      
   52::91      7e-06  50%  517 aa  OXLA_NOTSC RecName: Full=L-amino-acid oxidase;         Short=LAAO; 
   46::91      7e-06  46%  517 aa  OXLA_DEMVE RecName: Full=L-amino-acid oxidase;         Short=LAAO; 
   45::91      7e-06  43%  516 aa  OXLA_AGKRH RecName: Full=L-amino-acid oxidase;         Short=LAAO; 
    4::42      7e-06  51%  335 aa  GPDA_GEOSM RecName: Full=Glycerol-3-phosphate dehydrogenase
    4::42      7e-06  51%  335 aa  GPDA_GEOBB RecName: Full=Glycerol-3-phosphate dehydrogenase
   26::65      2e-05  48%  492 aa  YR656_MIMIV RecName: Full=Uncharacterized protein R656;Flags:
   45::91      2e-05  40%  504 aa  OXLA_AGKHP RecName: Full=L-amino-acid oxidase;         Short=LAAO; 
  263::301     2e-05  49%  623 aa  MNMC_ACIBC RecName: Full=tRNA 5-methylaminomethyl-2-thiouridine
  553::590     2e-05  50% 1032 aa  YGFK_ECOLI RecName: Full=Uncharacterized protein ygfK;
  553::590     2e-05  50% 1032 aa  YGFK_ECO57 RecName: Full=Uncharacterized protein ygfK;
   45::91      2e-05  38%  504 aa  OXLA_AGKHA RecName: Full=L-amino-acid oxidase;         Short=LAAO; 
  272::313     2e-05  48%  666 aa  MNMC_LEGPL RecName: Full=tRNA 5-methylaminomethyl-2-thiouridine
  272::313     2e-05  48%  666 aa  MNMC_LEGPH RecName: Full=tRNA 5-methylaminomethyl-2-thiouridine
  272::313     2e-05  48%  666 aa  MNMC_LEGPC RecName: Full=tRNA 5-methylaminomethyl-2-thiouridine
  272::313     2e-05  48%  666 aa  MNMC_LEGPA RecName: Full=tRNA 5-methylaminomethyl-2-thiouridine
    9::47      2e-05  46%  462 aa  GSOX3_ARATH RecName: Full=Flavin-containing monooxygenase FMO
    7::44      3e-05  50%  340 aa  GPDA_PSEMY RecName: Full=Glycerol-3-phosphate dehydrogenase
  325::452     3e-05  24%  659 aa  AEGA_ECOLI RecName: Full=Protein aegA;
  263::301     4e-05  46%  623 aa  MNMC_ACIBT RecName: Full=tRNA 5-methylaminomethyl-2-thiouridine
    2::39      4e-05  39%  502 aa  CRTN_STAAW RecName: Full=Dehydrosqualene desaturase;       
    2::39      4e-05  39%  502 aa  CRTN_STAAS RecName: Full=Dehydrosqualene desaturase;       
    2::39      4e-05  39%  502 aa  CRTN_STAAR RecName: Full=Dehydrosqualene desaturase;       
    2::39      4e-05  39%  502 aa  CRTN_STAAN RecName: Full=Dehydrosqualene desaturase;       
    2::39      4e-05  39%  502 aa  CRTN_STAAM RecName: Full=Dehydrosqualene desaturase;       
    2::39      4e-05  39%  502 aa  CRTN_STAAE RecName: Full=Dehydrosqualene desaturase;       
    2::39      4e-05  39%  502 aa  CRTN_STAA8 RecName: Full=Dehydrosqualene desaturase;       
    2::39      4e-05  39%  502 aa  CRTN_STAA3 RecName: Full=Dehydrosqualene desaturase;       
    2::39      6e-05  39%  502 aa  CRTN_STAAB RecName: Full=Dehydrosqualene desaturase;       
  147::184     8e-05  50%  656 aa  HDRA2_METKA RecName: Full=CoB--CoM heterodisulfide reductase
    3::45      8e-05  42%  341 aa  GPDA_PSEU2 RecName: Full=Glycerol-3-phosphate dehydrogenase
    3::45      8e-05  42%  341 aa  GPDA_PSESM RecName: Full=Glycerol-3-phosphate dehydrogenase
    3::45      8e-05  42%  341 aa  GPDA_PSE14 RecName: Full=Glycerol-3-phosphate dehydrogenase
    4::36      8e-05  48%  338 aa  GPDA_LACRJ RecName: Full=Glycerol-3-phosphate dehydrogenase
    4::36      8e-05  48%  338 aa  GPDA_LACRD RecName: Full=Glycerol-3-phosphate dehydrogenase
   25::53      1e-04  59%  261 aa  THI4_PYRIL RecName: Full=Putative thiazole biosynthetic enzyme;
   28::64      1e-04  51%  258 aa  THI4_DESOH RecName: Full=Putative thiazole biosynthetic enzyme;
    3::44      1e-04  50%  340 aa  GPDA_AZOVD RecName: Full=Glycerol-3-phosphate dehydrogenase
   13::58      1e-04  37%  474 aa  YOBN_BACSU RecName: Full=Putative L-amino-acid oxidase yobN;       
  312::447     1e-04  27%  639 aa  YGFT_ECOLI RecName: Full=Uncharacterized protein ygfT;
    3::35      1e-04  55%  216 aa  TRKA_METTH RecName: Full=Trk system potassium uptake protein trkA
  231::324     1e-04  31%  648 aa  MNMC_BURS3 RecName: Full=tRNA 5-methylaminomethyl-2-thiouridine
   18::58      1e-04  41%  354 aa  GPDA_PSEPF RecName: Full=Glycerol-3-phosphate dehydrogenase
   83::229     1e-04  30%  332 aa  DUSB_PSEAE RecName: Full=tRNA-dihydrouridine synthase B;       
    2::39      1e-04  39%  502 aa  CRTN_STAAC RecName: Full=Dehydrosqualene desaturase;       
   39::118     2e-04  31%  588 aa  ZDS_SOLLC RecName: Full=Zeta-carotene desaturase,
    4::42      2e-04  49%  335 aa  GPDA_GEOSL RecName: Full=Glycerol-3-phosphate dehydrogenase
    4::42      2e-04  46%  335 aa  GPDA_GEOMG RecName: Full=Glycerol-3-phosphate dehydrogenase
  228::332     2e-04  34%  653 aa  MNMC_BURVG RecName: Full=tRNA 5-methylaminomethyl-2-thiouridine
  187::279     2e-04  33%  643 aa  MNMC_BURCC RecName: Full=tRNA 5-methylaminomethyl-2-thiouridine
    5::45      2e-04  41%  341 aa  GPDA_PSEF5 RecName: Full=Glycerol-3-phosphate dehydrogenase
    5::40      2e-04  50%  333 aa  GPDA_PELCD RecName: Full=Glycerol-3-phosphate dehydrogenase
  178::266     2e-04  31% 1025 aa  DPYD_BOVIN RecName: Full=Dihydropyrimidine dehydrogenase [NADP+];  
   28::64      3e-04  51%  260 aa  THI4_METAC RecName: Full=Putative thiazole biosynthetic enzyme;
    7::34      3e-04  57%  301 aa  GPDA_SYNR3 RecName: Full=Glycerol-3-phosphate dehydrogenase
    5::45      3e-04  41%  341 aa  GPDA_PSEFS RecName: Full=Glycerol-3-phosphate dehydrogenase
    7::45      3e-04  46%  341 aa  GPDA_PSEE4 RecName: Full=Glycerol-3-phosphate dehydrogenase
    2::39      4e-04  47%  489 aa  ZDS_SYNY3 RecName: Full=Zeta-carotene desaturase;       
   28::64      4e-04  49%  260 aa  THI4_METMA RecName: Full=Putative thiazole biosynthetic enzyme;
    6::40      4e-04  49%  333 aa  GPDA_PARL1 RecName: Full=Glycerol-3-phosphate dehydrogenase
    2::34      4e-04  48%  337 aa  GPDA_LACF3 RecName: Full=Glycerol-3-phosphate dehydrogenase
   51::103     5e-04  42%  574 aa  ZDS_NARPS RecName: Full=Zeta-carotene desaturase,
   28::64      5e-04  46%  260 aa  THI4_METBF RecName: Full=Putative thiazole biosynthetic enzyme;
   29::62      5e-04  50%  307 aa  THI4_HALWD RecName: Full=Putative thiazole biosynthetic enzyme;
  332::369     5e-04  47%  631 aa  MERA_BACCE RecName: Full=Mercuric reductase;       
    2::31      5e-04  53%  351 aa  GPDA_LACCB RecName: Full=Glycerol-3-phosphate dehydrogenase
    2::31      5e-04  53%  351 aa  GPDA_LACC3 RecName: Full=Glycerol-3-phosphate dehydrogenase
    2::35      5e-04  44%  329 aa  GPDA_DESAD RecName: Full=Glycerol-3-phosphate dehydrogenase
   11::47      5e-04  46%  331 aa  FENR_DEIGD RecName: Full=Ferredoxin--NADP reductase;       
    9::48      5e-04  45%  529 aa  CRTI_MYXXA RecName: Full=Phytoene dehydrogenase;       
  261::299     6e-04  44%  623 aa  MNMC_ACIAD RecName: Full=tRNA 5-methylaminomethyl-2-thiouridine
    7::44      6e-04  47%  506 aa  KMO_CRYNE RecName: Full=Kynurenine 3-monooxygenase;       
   29::119     6e-04  30%  251 aa  HIS6_STRAW RecName: Full=Imidazole glycerol phosphate synthase
    2::34      6e-04  39%  333 aa  GPDA_LEPBP RecName: Full=Glycerol-3-phosphate dehydrogenase
    2::34      6e-04  39%  333 aa  GPDA_LEPBA RecName: Full=Glycerol-3-phosphate dehydrogenase
   87::131     6e-04  38%  566 aa  CRTI_ARATH RecName: Full=Phytoene dehydrogenase,
   66::103     8e-04  42%  570 aa  ZDS_MAIZE RecName: Full=Zeta-carotene desaturase,
   49::95      8e-04  34%  558 aa  ZDS_ARATH RecName: Full=Zeta-carotene desaturase,
   28::60      8e-04  55%  263 aa  THI4_DESMR RecName: Full=Putative thiazole biosynthetic enzyme;
  245::325     8e-04  36%  652 aa  MNMC_BURA4 RecName: Full=tRNA 5-methylaminomethyl-2-thiouridine
  144::183     8e-04  32%  472 aa  GLTD_ECOLI RecName: Full=Glutamate synthase [NADPH] small chain;   
    7::44      8e-04  45%  407 aa  GGR_METMA RecName: Full=Digeranylgeranylglycerophospholipid
    7::44      8e-04  45%  407 aa  GGR_METBF RecName: Full=Digeranylgeranylglycerophospholipid
    7::44      8e-04  45%  407 aa  GGR_METAC RecName: Full=Digeranylgeranylglycerophospholipid
  110::231     8e-04  31%  322 aa  DUSC_RALEH RecName: Full=tRNA-dihydrouridine synthase C;       
  176::238     8e-04  33%  332 aa  DUSB_XANAC RecName: Full=tRNA-dihydrouridine synthase B;       
  184::226     8e-04  42%  321 aa  DUSB_ERWCA RecName: Full=tRNA-dihydrouridine synthase B;       
    2::39      8e-04  42%  474 aa  CRTI_SYNE7 RecName: Full=Phytoene dehydrogenase;       
  172::272     8e-04  31%  373 aa  CATB_RHOOP RecName: Full=Muconate cycloisomerase 1;       
    1::656

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKPRETTQFTHLFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXISA
STCD_RHIME      ----------------------------------------------------------------------
NADO_THEBR      ------THFPNLFSEGRIGNLVIRNRIVMPPMAT---NLANEDGSVSQRLIDYYVARARGGVGLII----
DHTM_METME      -----------LFEPIQIGPKTLRNRFYQVPHCIGAGSD-KPGFQSAHRSVKAEGGWAALNTEYCSINPE
BAIH_EUBSP      ---------SRLFSPLQIGSLTLSNRVGMAPMSMD----YEAADGTVPKRLADVFVRRAEGGTGYVMIDA
FADH_ECOLI      --------YPSLFAPLDLGFTTLKNRVLMGSMHTGLEEY--PDGAER--------LAAFYAERARHGVAL
BAICD_EUBSP     ----------------------------------------------------------------------
DHDM_HYPSX      -------RFDILFTPLKLGSKTIRNRFYQVPHCNGAGTN-SPGMNMAHRGIKAEGGWGAVNTE-------
NAMA_BACSU      -----------LFTPITIKDMTLKNRIVMSPMC-----MYSSHEKDGKLT----------PFHMAHYISR
NAMA_GEOKA      ----------------------------------------------------------------------
NAMA_BACA2      ----------------------------------------------------------------------
NAMA_BACHD      ----------------------------------------------------------------------
NAMA_GEOSW      ----------------------------------------------------------------------
NAMA_GEOTN      ----------------------------------------------------------------------
NEMA_ECOLI      -----------LYSPLKVGAITAANRIFMAPRSIEPGDIPTPLMAEYYRQ----------------RASA
NAMA_BACLD      ----------------------------------------------------------------------
OYE2_YEAST      ----------------------------------------------------------------------
OYE3_YEAST      ----------------------------------------------------------------------
NAMA_LISW6      ----------------------------------------------------------------------
OYE1_SACPS      ----------------------------------------------------------------------
OPR3_SOLLC      -----------LFSPYKMGKFNLSHRVVLAPMT----------RCRALNNIPQAALGEYYEQRATAGGFL
OPR3_ARATH      -----------LFSSYKMGRFDLSHRVVLAPMTRCRALNGVPNAALAEY---------------------
NAMA_CLOAB      ----------------------------------------------------------------------
OPR1_ARATH      MENGEAKQSVPLLTPYKMGRFNLSHRVVLAPRQRSYGNVPQPHAA------------------------I
OPRL1_ARATH     ----------------------------------------------------------------------
NAMA_BACP2      ----------------------------------------------------------------------
YQIG_BACSU      ----------------------------------------------------------------------
NAMA_BACWK      ----------------------------------------------------------------------
NAMA_BACCN      ----------------------------------------------------------------------
NAMA_LISMF      ----------------------------------------------------------------------
NAMA_LISMC      ----------------------------------------------------------------------
NAMA_LISIN      ----------------------------------------------------------------------
NAMA_BACC2      ----------------------------------------------------------------------
NAMA_BACC0      ----------------------------------------------------------------------
OPR1_SOLLC      ----------------------------------------------------------------------
NAMA_BACCZ      ----------------------------------------------------------------------
OPR2_ARATH      ----------------------------------------------------------------------
NAMA_LISMH      ----------------------------------------------------------------------
NAMA_BACC3      ----------------------------------------------------------------------
NAMA_BACAH      ----------------------------------------------------------------------
NAMA_LISMO      ----------------------------------------------------------------------
NAMA_BACAN      ----------------------------------------------------------------------
NAMA_BACAC      ----------------------------------------------------------------------
NAMA_BACAA      ----------------------------------------------------------------------
NAMA_BACHK      ----------------------------------------------------------------------
NAMA_BACCR      ----------------------------------------------------------------------
NAMA_BACC4      ----------------------------------------------------------------------
NAMA_BACC1      ----------------------------------------------------------------------
KYE1_KLULA      ---------TDIFKPIKIGNTELKHRVLTRMRALHPGNVPNPDWAVEYYRQRSQYPGTMIITEGAFPSAQ
OYEC_SCHPO      ---------TKLFTPLKIRGVEFHNRMFVSPMCT-----YSADQEGTDFHLVHLGAMGMRGPGLVMVEAT
NAMA_BACCQ      ----------------------------------------------------------------------
NAMA_BACC7      ----------------------------------------------------------------------
OPRL2_ARATH     ----------------------------------------------------------------------
OPRL_SOLLC      ----------------------------------------------------------------------
EBP1_CANAL      ----------------------------------------------------------------------
GLT1_SCHPO      ----------------------------------------------------------------------
OYEB_SCHPO      ----------------------------------------------------------------------
GLSN_MEDSA      ----------------------------------------------------------------------
GLT1_YEAST      ----------------------------------------------------------------------
YEIT_ECO57      ----------------------------------------------------------------------
OXLA_CROAT      ----------------------------------------------------------------------
OXLA_CROAD      ----------------------------------------------------------------------
GLTB_BACSU      ----------------------------------------------------------------------
YEIT_ECOLI      ----------------------------------------------------------------------
OXLA_PSEAU      ----------------------------------------------------------------------
OXLA_BOTJR      ----------------------------------------------------------------------
OXLA_BOTMO      ----------------------------------------------------------------------
OYEA_SCHPO      ----------------------------------------------------------------------
OXLA_TRIST      ----------------------------------------------------------------------
OXLA_OXYSC      ----------------------------------------------------------------------
YEIT_SALTY      ----------------------------------------------------------------------
YEIT_SALTI      ----------------------------------------------------------------------
OXLA_NOTSC      ----------------------------------------------------------------------
OXLA_DEMVE      ----------------------------------------------------------------------
OXLA_AGKRH      ----------------------------------------------------------------------
GPDA_GEOSM      ----------------------------------------------------------------------
GPDA_GEOBB      ----------------------------------------------------------------------
YR656_MIMIV     ----------------------------------------------------------------------
OXLA_AGKHP      ----------------------------------------------------------------------
MNMC_ACIBC      ----------------------------------------------------------------------
YGFK_ECOLI      ----------------------------------------------------------------------
YGFK_ECO57      ----------------------------------------------------------------------
OXLA_AGKHA      ----------------------------------------------------------------------
MNMC_LEGPL      ----------------------------------------------------------------------
MNMC_LEGPH      ----------------------------------------------------------------------
MNMC_LEGPC      ----------------------------------------------------------------------
MNMC_LEGPA      ----------------------------------------------------------------------
GSOX3_ARATH     ----------------------------------------------------------------------
GPDA_PSEMY      ----------------------------------------------------------------------
AEGA_ECOLI      ----------------------------------------------------------------------
MNMC_ACIBT      ----------------------------------------------------------------------
CRTN_STAAW      ----------------------------------------------------------------------
CRTN_STAAS      ----------------------------------------------------------------------
CRTN_STAAR      ----------------------------------------------------------------------
CRTN_STAAN      ----------------------------------------------------------------------
CRTN_STAAM      ----------------------------------------------------------------------
CRTN_STAAE      ----------------------------------------------------------------------
CRTN_STAA8      ----------------------------------------------------------------------
CRTN_STAA3      ----------------------------------------------------------------------
CRTN_STAAB      ----------------------------------------------------------------------
HDRA2_METKA     ----------------------------------------------------------------------
GPDA_PSEU2      ----------------------------------------------------------------------
GPDA_PSESM      ----------------------------------------------------------------------
GPDA_PSE14      ----------------------------------------------------------------------
GPDA_LACRJ      ----------------------------------------------------------------------
GPDA_LACRD      ----------------------------------------------------------------------
THI4_PYRIL      ----------------------------------------------------------------------
THI4_DESOH      ----------------------------------------------------------------------
GPDA_AZOVD      ----------------------------------------------------------------------
YOBN_BACSU      ----------------------------------------------------------------------
YGFT_ECOLI      ----------------------------------------------------------------------
TRKA_METTH      ----------------------------------------------------------------------
MNMC_BURS3      ----------------------------------------------------------------------
GPDA_PSEPF      ----------------------------------------------------------------------
DUSB_PSEAE      ----------------------------------------------------------------------
CRTN_STAAC      ----------------------------------------------------------------------
ZDS_SOLLC       ----------------------------------------------------------------------
GPDA_GEOSL      ----------------------------------------------------------------------
GPDA_GEOMG      ----------------------------------------------------------------------
MNMC_BURVG      ----------------------------------------------------------------------
MNMC_BURCC      ----------------------------------------------------------------------
GPDA_PSEF5      ----------------------------------------------------------------------
GPDA_PELCD      ----------------------------------------------------------------------
DPYD_BOVIN      ----------------------------------------------------------------------
THI4_METAC      ----------------------------------------------------------------------
GPDA_SYNR3      ----------------------------------------------------------------------
GPDA_PSEFS      ----------------------------------------------------------------------
GPDA_PSEE4      ----------------------------------------------------------------------
ZDS_SYNY3       ----------------------------------------------------------------------
THI4_METMA      ----------------------------------------------------------------------
GPDA_PARL1      ----------------------------------------------------------------------
GPDA_LACF3      ----------------------------------------------------------------------
ZDS_NARPS       ----------------------------------------------------------------------
THI4_METBF      ----------------------------------------------------------------------
THI4_HALWD      ----------------------------------------------------------------------
MERA_BACCE      ----------------------------------------------------------------------
GPDA_LACCB      ----------------------------------------------------------------------
GPDA_LACC3      ----------------------------------------------------------------------
GPDA_DESAD      ----------------------------------------------------------------------
FENR_DEIGD      ----------------------------------------------------------------------
CRTI_MYXXA      ----------------------------------------------------------------------
MNMC_ACIAD      ----------------------------------------------------------------------
KMO_CRYNE       ----------------------------------------------------------------------
HIS6_STRAW      ----------------------------------------------------------------------
GPDA_LEPBP      ----------------------------------------------------------------------
GPDA_LEPBA      ----------------------------------------------------------------------
CRTI_ARATH      ----------------------------------------------------------------------
ZDS_MAIZE       ----------------------------------------------------------------------
ZDS_ARATH       ----------------------------------------------------------------------
THI4_DESMR      ----------------------------------------------------------------------
MNMC_BURA4      ----------------------------------------------------------------------
GLTD_ECOLI      ----------------------------------------------------------------------
GGR_METMA       ----------------------------------------------------------------------
GGR_METBF       ----------------------------------------------------------------------
GGR_METAC       ----------------------------------------------------------------------
DUSC_RALEH      ----------------------------------------------------------------------
DUSB_XANAC      ----------------------------------------------------------------------
DUSB_ERWCA      ----------------------------------------------------------------------
CRTI_SYNE7      ----------------------------------------------------------------------
CATB_RHOOP      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ALENHLVPGFEPTGVGAAARGVFRLPYFHDRIRKLTDTLHEAGAYVTAQLIMQGGMPHGPSPTVTAYVAN
STCD_RHIME      -------------------------------IREMTDAVHEEGAVIMIQLTHLGRRTRWDKPVVAPSHHR
NADO_THEBR      -LENVQVDYPQGKNVACQLRGFFELAEVHSYGAKIFMQIHHAGRQTTPG-ITEGLQPVAPSPVPCSFLGT
DHTM_METME      SDDTHRL------SARIWDEGDVR------NLKAMTDEVHKYGALAGVELWYGGATPRGPSQYASEFETL
BAIH_EUBSP      VTIDSKYPYMGNTTALDRDELVPQFKEFADRVK-------EAGSTLVPQIIHPGPAPLGPSANTNANC--
FADH_ECOLI      IVSGGIAPDLTGVGMGAMLNDASQIPHH----RTITEAVHQEGGKIALQILHTGRQPHLVAPSALQAPIN
BAICD_EUBSP     -----------------------------EQLKKLTDAVHEAGGKMGIQL-WHGGF----SPQMFFDETN
DHDM_HYPSX      --QCSIHPECDDT-LRITARGDMR------NLRAMVDHVHSHGSLAGCELFYGG--PHAPAATVPGCPGF
NAMA_BACSU      AIGQVGLIIVEASAVNPQGRGIWSDEHI-EGFAKLTEQVKEQGSKIGIQLAHAGRKAELEAPSAIAFDEQ
NAMA_GEOKA      -------------------------------LRELVGLVKEHGAAIGIQLAHAGRKSQVPGEIIAPSASS
NAMA_BACA2      ---------------------------------KLTEQVKAQGSKIGIQLAHAGGDIYAPS-AIPFDEQS
NAMA_BACHD      -----------------------------DHISGLTETIHAHGAKAAIQLAHAGRKAEGPAPSAISYDKM
NAMA_GEOSW      -----------------------------DGLRELASLVKEHGAKIGIQLAHAGGEIIAPS-AIPFSEKT
NAMA_GEOTN      ----------EATGVTPQGRGIWDDDHIHG-LHELVGLVKEHGAAIGIQLAHAGRKSEVPGEIISAIPFN
NEMA_ECOLI      GLIIS-----EATQISAQAKGYAGAPGIHSAWKKITAGVHAENGHMAVQLWHTGRISHGQAPVAPSAVET
NAMA_BACLD      -----------------------------DGLAALTSQIKTYGSKTAIQLAHAGGTIYGPS-AIPFDENS
OYE2_YEAST      --------------------------------------------------------------------AN
OYE3_YEAST      --------------------------------------------------------------------AN
NAMA_LISW6      -------------------------------LKHLVDGLHSHGAKAGIQLAHAGRKAVLPAPSAIAYDEK
OYE1_SACPS      ---------------------------------------------------------------------N
OPR3_SOLLC      ITEGTMI---SPTSAGFPVPGIFTKEQVREW-KKIVDVVHAKGAVIFCQLWHVGRASHAPISSTEKPISN
OPR3_ARATH      -YAQRTTPGSEGTMVSPGSAGFPHVPYSDEQVKQVVEAVHAKGGFIFCQLWHVGRQPNGGSPISSSHVKY
NAMA_CLOAB      ----------------------------------LVKEVKKYGSKIAIQLNHSGRKYEGTSPSALAFDEN
OPR1_ARATH      YYSQRTTPGTEATGVSDTAQGYQDTPGIWTKEKPIVDAVHAKGGIFFCQISNSGFQPNGKAPIMPQIRSN
OPRL1_ARATH     ----------EATGVSETAMAYQNMPWRKEQIKPIVDAVHSHGGIFFCQLWHAGRVPNGESPVSSTDKSN
NAMA_BACP2      ----------------------------------------------------------------------
YQIG_BACSU      --------------------------------------IHHGGIECPSELVPQQDVV-GPSDVFDN--GK
NAMA_BACWK      -------------------------------LHKTTTFIHNNGAKAAIQLAHAGRKAEAPS-AIPFNDRM
NAMA_BACCN      ----------------------------------------------------------------------
NAMA_LISMF      -------------------------------LKKLVDGLHYHGAKAGIQLAHAGRKAVLPGEIVSAIAFD
NAMA_LISMC      -------------------------------LKKLVDGLHYHGAKAGIQLAHAGRKAVLPGEIVSAIAFD
NAMA_LISIN      -------------------------------LKRLVDGLHYHGAKAGIQLAHAGRKAVLPGEIVSAIPFD
NAMA_BACC2      -------------------------------LHKTTTFIHDNGAKAAIQLAHAGRKANAFAPSAIPFSDT
NAMA_BACC0      -------------------------------LHKTTTFIHDNGAKAAIQLAHAGRKAELETDALSAVPFN
OPR1_SOLLC      ----------------------------------------------------------------------
NAMA_BACCZ      -------------------------------LHKTTTFIHDNGAKAAIQLAHAGRKAELETDALSAIPFN
OPR2_ARATH      ----------------------------------------------------------------------
NAMA_LISMH      -------------------------------LKRLVDGLHYHGAKAGIQLAHAGRKAVLPGEIVSAIPFD
NAMA_BACC3      -------------------------------LHKTTTFIHDNGAKAAIQLAHAGRKAEAPS-AVPFNETM
NAMA_BACAH      -------------------------------LHKTTTFIHDNGAKAAIQLAHAGRKAEAPS-AVPFNETM
NAMA_LISMO      -------------------------------LKKLVGGLHYHGAKAGIQLAHAGRKAVLPGEIVSAIAFD
NAMA_BACAN      -------------------------------LHKTTTFIHDNGAKAAIQLAHAGRKAEAPS-AVPFNETM
NAMA_BACAC      -------------------------------LHKTTTFIHDNGAKAAIQLAHAGRKAEAPS-AVPFNETM
NAMA_BACAA      -------------------------------LHKTTTFIHDNGAKAAIQLAHAGRKAEAPS-AVPFNETM
NAMA_BACHK      -------------------------------LHKTTTFIHDNGAKAAIQLAHAGRKAELETDALSAIPFN
NAMA_BACCR      -------------------------------LHKTTTFIHDNGAKAAIQLAHAGRKANAFAPSAIPFNDK
NAMA_BACC4      -------------------------------LHKTTTFIHDNGAKAAIQLAHAGRKANAFAPSAIPFNDK
NAMA_BACC1      -------------------------------LHKTTTFIHDNGAKAAIQLAHAGRKAELETDALSAIPFN
KYE1_KLULA      SGGYDNAPGVWSEEQLAQWRKIFKA--IHDNKSFVWVQLWVLGRQAFADNLARDGLRYGEDEKERAIRSN
OYEC_SCHPO      AVEGRISPNDSGLWMESQMKPLRRIVEFHSQNQKIGIQLAHAGRKATVATEAQGGWENDVGPNEDRWDEN
NAMA_BACCQ      -------------------------------LHKATTFIHDNGAKAAIQLAHAGRKAELETDALSAIPFN
NAMA_BACC7      -------------------------------LHKATTFIHDNGAKAAIQLAHAGRKAELETDALSAIPFN
OPRL2_ARATH     --------------------------------KPIVDAVHSKGGIFFCQIWHGGRVFHQDQPNGEAPVSS
OPRL_SOLLC      ----------------------------------------------------------------------
EBP1_CANAL      --------------------------------KKINEAIHGNGSFSSVQLLKDSGLPLAPSAVYLAKEAG
GLT1_SCHPO      ----------------------------------------------------------------------
OYEB_SCHPO      ----------------------------------------------------------------------
GLSN_MEDSA      ----------------------------------------------------------------------
GLT1_YEAST      ----------------------------------------------------------------------
YEIT_ECO57      ----------------------------------------------------------------------
OXLA_CROAT      ----------------------------------------------------------------------
OXLA_CROAD      ----------------------------------------------------------------------
GLTB_BACSU      ----------------------------------------------------------------------
YEIT_ECOLI      ----------------------------------------------------------------------
OXLA_PSEAU      ----------------------------------------------------------------------
OXLA_BOTJR      ----------------------------------------------------------------------
OXLA_BOTMO      ----------------------------------------------------------------------
OYEA_SCHPO      -----------------------------------------------------GGLPAGAVQGVEVYKKK
OXLA_TRIST      ----------------------------------------------------------------------
OXLA_OXYSC      ----------------------------------------------------------------------
YEIT_SALTY      ----------------------------------------------------------------------
YEIT_SALTI      ----------------------------------------------------------------------
OXLA_NOTSC      ----------------------------------------------------------------------
OXLA_DEMVE      ----------------------------------------------------------------------
OXLA_AGKRH      ----------------------------------------------------------------------
GPDA_GEOSM      ----------------------------------------------------------------------
GPDA_GEOBB      ----------------------------------------------------------------------
YR656_MIMIV     ----------------------------------------------------------------------
OXLA_AGKHP      ----------------------------------------------------------------------
MNMC_ACIBC      ----------------------------------------------------------------------
YGFK_ECOLI      ----------------------------------------------------------------------
YGFK_ECO57      ----------------------------------------------------------------------
OXLA_AGKHA      ----------------------------------------------------------------------
MNMC_LEGPL      ----------------------------------------------------------------------
MNMC_LEGPH      ----------------------------------------------------------------------
MNMC_LEGPC      ----------------------------------------------------------------------
MNMC_LEGPA      ----------------------------------------------------------------------
GSOX3_ARATH     ----------------------------------------------------------------------
GPDA_PSEMY      ----------------------------------------------------------------------
AEGA_ECOLI      ----------------------------------------------------------------------
MNMC_ACIBT      ----------------------------------------------------------------------
CRTN_STAAW      ----------------------------------------------------------------------
CRTN_STAAS      ----------------------------------------------------------------------
CRTN_STAAR      ----------------------------------------------------------------------
CRTN_STAAN      ----------------------------------------------------------------------
CRTN_STAAM      ----------------------------------------------------------------------
CRTN_STAAE      ----------------------------------------------------------------------
CRTN_STAA8      ----------------------------------------------------------------------
CRTN_STAA3      ----------------------------------------------------------------------
CRTN_STAAB      ----------------------------------------------------------------------
HDRA2_METKA     ----------------------------------------------------------------------
GPDA_PSEU2      ----------------------------------------------------------------------
GPDA_PSESM      ----------------------------------------------------------------------
GPDA_PSE14      ----------------------------------------------------------------------
GPDA_LACRJ      ----------------------------------------------------------------------
GPDA_LACRD      ----------------------------------------------------------------------
THI4_PYRIL      ----------------------------------------------------------------------
THI4_DESOH      ----------------------------------------------------------------------
GPDA_AZOVD      ----------------------------------------------------------------------
YOBN_BACSU      ----------------------------------------------------------------------
YGFT_ECOLI      ----------------------------------------------------------------------
TRKA_METTH      ----------------------------------------------------------------------
MNMC_BURS3      ----------------------------------------------------------------------
GPDA_PSEPF      ----------------------------------------------------------------------
DUSB_PSEAE      ----------------------------------------------------------------------
CRTN_STAAC      ----------------------------------------------------------------------
ZDS_SOLLC       ----------------------------------------------------------------------
GPDA_GEOSL      ----------------------------------------------------------------------
GPDA_GEOMG      ----------------------------------------------------------------------
MNMC_BURVG      ----------------------------------------------------------------------
MNMC_BURCC      ----------------------------------------------------------------------
GPDA_PSEF5      ----------------------------------------------------------------------
GPDA_PELCD      ----------------------------------------------------------------------
DPYD_BOVIN      ----------------------------------------------------------------------
THI4_METAC      ----------------------------------------------------------------------
GPDA_SYNR3      ----------------------------------------------------------------------
GPDA_PSEFS      ----------------------------------------------------------------------
GPDA_PSEE4      ----------------------------------------------------------------------
ZDS_SYNY3       ----------------------------------------------------------------------
THI4_METMA      ----------------------------------------------------------------------
GPDA_PARL1      ----------------------------------------------------------------------
GPDA_LACF3      ----------------------------------------------------------------------
ZDS_NARPS       ----------------------------------------------------------------------
THI4_METBF      ----------------------------------------------------------------------
THI4_HALWD      ----------------------------------------------------------------------
MERA_BACCE      ----------------------------------------------------------------------
GPDA_LACCB      ----------------------------------------------------------------------
GPDA_LACC3      ----------------------------------------------------------------------
GPDA_DESAD      ----------------------------------------------------------------------
FENR_DEIGD      ----------------------------------------------------------------------
CRTI_MYXXA      ----------------------------------------------------------------------
MNMC_ACIAD      ----------------------------------------------------------------------
KMO_CRYNE       ----------------------------------------------------------------------
HIS6_STRAW      ----------------------------------------------------------------------
GPDA_LEPBP      ----------------------------------------------------------------------
GPDA_LEPBA      ----------------------------------------------------------------------
CRTI_ARATH      ----------------------------------------------------------------------
ZDS_MAIZE       ----------------------------------------------------------------------
ZDS_ARATH       ----------------------------------------------------------------------
THI4_DESMR      ----------------------------------------------------------------------
MNMC_BURA4      ----------------------------------------------------------------------
GLTD_ECOLI      ----------------------------------------------------------------------
GGR_METMA       ----------------------------------------------------------------------
GGR_METBF       ----------------------------------------------------------------------
GGR_METAC       ----------------------------------------------------------------------
DUSC_RALEH      ----------------------------------------------------------------------
DUSB_XANAC      ----------------------------------------------------------------------
DUSB_ERWCA      ----------------------------------------------------------------------
CRTI_SYNE7      ----------------------------------------------------------------------
CATB_RHOOP      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QVSHALDRDEIAWFINEYAESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLL
STCD_RHIME      EAAHRIEDWDIDRIIKDFADAAERMKAGGMDGVELEA-YGHLIDQFASPLTNELDGPYGGSLDNRMRFCF
NADO_THEBR      Q-PRELTINEIEEIIQKFVDAAVRAKGAMFDGIELHGAHGYLIGQFMSPRTNRRVDKYGGSFERRMRFPL
DHTM_METME      SYCKEMDLSDIAQVQQFYVDAAKRSRDAGFDIVYVYGAHSYLPLQFLNPYYNKRTDKYGGSLENRARFWL
BAIH_EUBSP      HVSRSISIDEIHDIIKQFGQXXXXXXXXXXXXISLHCAHAYMLPGFLSPLRNKRMDEYGGSLDNRARFVI
FADH_ECOLI      RVPHELSHEEILQLIDNFARCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQRSDQWGGDYRNXXXXXX
BAICD_EUBSP     ETPDTLTVERIHEIVEEFGRGARMAVQAGFDAVEFHAAHSYLPHEFLSPGMNKRTDEYGGSFENRCRFCY
DHDM_HYPSX      TYNHEADIDELERLQQQYVDAALRARDTGFDLVNVYGAHAYGPMQWLNPYYNRRTDKYGGSFDNRARFWI
NAMA_BACSU      SATPVMSAEKVKETVQEFKQAAARAKEAGFDVIEIHAAHGYLIHEFLSPLSNHRTDEYGGSPENRYRFLR
NAMA_GEOKA      PTPKEMTKADIEETVQAFQNGARRAKEAGFDVIEIHAAHGYLINEFLSPLSNRRQDEYGGSPENRYRFLG
NAMA_BACA2      KTPAEMTTEQIKETIQEFKQAAARAKEAGFDIIELHAAHGYLMHEFLSPLSNHRTDEYGGSHENRYRFLG
NAMA_BACHD      KTPDAMTEEQISETIEAFKLGALRAKKAGFDIIEIHGAHGYLINEFLSPLTNKRTDAYGGSLENRYRLLR
NAMA_GEOSW      RTPKEMTKADIEETIQAFQNGARRAKEAGFDIIEIHGAHGYLINEFLSPLSNRRQDEYGGSPENRYRFLG
NAMA_GEOTN      ESSPTMTKADIEKTVQAFQDGARRAKKAGFDVIEIHAAHGYLINEFLSPLSNRRQDEYGGSPENRYHFLG
NEMA_ECOLI      SMPRALELEEIPGIVNDFRQAIANAREAGFDLVELHSAHGYLLHQFLSPSSNHRTDQYGGSVENRARLVL
NAMA_BACLD      RTPVEMTKEDIKETVQAFKKGAERAKAAGFDIIEIHGAHGYLINEFLSPLSNKREDEYGGSPENRYRLLR
OYE2_YEAST      NPQHSITKDEIKQYVKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNNRTDEYGGSIENRARFTL
OYE3_YEAST      NLEHSLTKDDIKQYIKDYIHAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNKRTDEYGGTIENRARFTL
NAMA_LISW6      SAKPVLTKEAIKEVVADFKRAAYRAKEAGFDVIEIHAAHGYLIHQFLSPITNRREDNYGGPAGNRYKILS
OYE1_SACPS      NPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTL
OPR3_SOLLC      RKPRAIGTYEISQVVEDYRRSALNAIEAGFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSLANRCKFIT
OPR3_ARATH      PKPRALEASEIPRVVEDYCLSALNAIRAGFDGIEIHGAHGYLIDQFLKDGINDRTDQYGGSIANRCRFLK
NAMA_CLOAB      KTPKELTKNEIKEIILXXXXXXXXXXXXGFDAIEIHGAHGYLINQFLSPLSNFRDDEYGGSTENRTRFLK
OPR1_ARATH      GIDEALFTEEIPGIVNDFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDTVNDRTDEYGGSLQNRCKFPL
OPRL1_ARATH     EFTRRLRTDEIPTIINDFRLAARNATEAGFDGVEIHGAHGYLIDQFMKDSVNDRTDSYGGSLENRCRFAL
NAMA_BACP2      --------DQIKDTVQAFQDAAVRAKKAGFDIIEIHGAHGYLINEFLSPLANHRTDDYGGSPENRYRFLR
YQIG_BACSU      QIARALTEEEVENIVKAFGEATRRAIEAGFDGVEIHGANGYLIQQFYSPKTNQRTDRWGGSDEKRLAFPL
NAMA_BACWK      KIPVEMNKQQIKETVSAFQKAALRSKRAGVDVIELHGAHGYLINEFLSPLSNKRIDEYGGSPENRYRFLR
NAMA_BACCN      KVPVAMSKEQIQDTITAFQKAAIRSKQAGFDVIELHGAHGYLINEFLSPLSNKRTDEYGGTAENRYRFLR
NAMA_LISMF      EKSDKLTKEAIKEVVADFKRAAYRAKEAGFDVIEIHAAHGYLIHQFLSPITNRREDNYGGPAGNRYKILS
NAMA_LISMC      EKSDKLTKEAIKEVVADFKRAAYRAKEAGFDVIEIHAAHGYLIHQFLSPITNRREDNYGGPAGNRYKILS
NAMA_LISIN      EKSAKLTKEAIKEVVADFKRAAYRAKEAGFDVIEIHAAHGYLIHQFLSPISNRREDNYGGPAGNRYKILS
NAMA_BACC2      KIPVEMNIQQIKETILAFQRAALRSKQAGFDVIELHGAHGYLINEFLSPLTNKRTDEYGGSPENRYRFLR
NAMA_BACC0      ETMKTMSKHQIKDTVLAFQQAAIRSKQAGFDVIEIHGAHGYLINEFLSPLSNKRTDEYGGSPENRYRFLR
OPR1_SOLLC      -----LTTDEIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNDRSDKYGGSLENRCRFAL
NAMA_BACCZ      ETMKTMSKHQIKDTILAFQQAAIRSKQAGFDVIEIHGAHGYLINEFLSPLSNKRTDEYGGSPENRYRFLR
OPR2_ARATH      -----LSIEEIPGIVNDFRLAARNAMEAGFDGVEIHGAHGYLIDQFMKDKVNDRTDEYGGSLQNRCKFAL
NAMA_LISMH      EKSAKLTKEAIKEVVADFKRAAYRAKEAGFDVIEIHAAHGYLIHQFLSPITNRREDNYGGPAGNRYKILS
NAMA_BACC3      KIPVEMSIQQIKNTILAFQQAAVRSKQAGFDVIEIHGAHGYLINEFLSPLSNKRTDEYGGSPEKRYRFLR
NAMA_BACAH      KIPVEMSIQQIKNTILAFQQAAVRSKQAGFDVIEIHGAHGYLINEFLSPLSNKRTDEYGGSPEKRYRFLR
NAMA_LISMO      EKSDKLTKEAIKEVVADFKRAAYRAKEAGFDVIEIHAAHGYLIHQFLSPITNRREDNYGGPAGNRYKILS
NAMA_BACAN      KIPVEMSIHQIKNTILAFQQAAIRSKQAGFDVIEIHGAHGYLINEFLSPLSNKRTDEYGGSPENRYRFLR
NAMA_BACAC      KIPVEMSIHQIKNTILAFQQAAIRSKQAGFDVIEIHGAHGYLINEFLSPLSNKRTDEYGGSPENRYRFLR
NAMA_BACAA      KIPVEMSIHQIKNTILAFQQAAIRSKQAGFDVIEIHGAHGYLINEFLSPLSNKRTDEYGGSPENRYRFLR
NAMA_BACHK      EIPVEMSIQQIKNTILAFQQAAVRSKQAGFDVIEIHGAHGYLINEFLSPLSNKRTDEYGGSPEKRYRFLR
NAMA_BACCR      KIPVEMNIQQIKETILAFQRAALRSKQAGFDVIELHGAHGYLINEFLSPLTNKRTDKYGGSPENRYRFLR
NAMA_BACC4      KIPVEMNIQQIKETILAFQRAALRSKQAGFDVIELHGAHGYLINEFLSPLTNKRTDKYGGSPENRYRFLR
NAMA_BACC1      ETMKMMSKHQIKDTVLAFQQAAVRSKQAGFDVIEIHGAHGYLINEFLSPLTNKRTDEYGGSPENRYRFLR
KYE1_KLULA      NPQHGITKDEIKQYIRDYVDAAKKCIDAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFVL
OYEC_SCHPO      HAQHKLTEKQYDELVDKFVVAAKRAVEIGFDVIEIHGAHGYLISSTVSPATNDRNDKYGGTFEKRILFPM
NAMA_BACCQ      ETMKMMSKHQIKDTVLAFQQAAVRSKQAGFDVIEIHGAHGYLINEFLSPLTNKRTDEYGGSPENRYRFLR
NAMA_BACC7      ETMKMMSKHQIKDTVLAFQQAAVRSKQAGFDVIEIHGAHGYLINEFLSPLTNKRTDEYGGSPENRYRFLR
OPRL2_ARATH     KPPRRLRSDELPAIVNDFRIAARNAIEAGFDGVEVHGAHGYLIDQFLKDKVNDRSDQYGGSLENRCRFAL
OPRL_SOLLC      -----LESDKIPCIVNDFRIAARNAIKAGFDGIEINASSGGLIDEFMNDQVHGWTDEYDESIKDRCRLAL
EBP1_CANAL      NELRALTEEEIDHIVEEYPNAAKHALEAGFDYVEIHGAHGYLLDQFLNLASNKRTDKYGGSIENRARLLL
GLT1_SCHPO      ----------------------------------------------------------------------
OYEB_SCHPO      -VDKFMTKQDIQEHITTYTEAAKRAVGCGADGVEVHQVNGFLLDKFLNGYGDKCDPEYCGSLENRARFCL
GLSN_MEDSA      ----------------------------------------------------------------------
GLT1_YEAST      ----------------------------------------------------------------------
YEIT_ECO57      ----------------------------------------------------------------------
OXLA_CROAT      ----------------------------------------------------------------------
OXLA_CROAD      ----------------------------------------------------------------------
GLTB_BACSU      ----------------------------------------------------------------------
YEIT_ECOLI      ----------------------------------------------------------------------
OXLA_PSEAU      ----------------------------------------------------------------------
OXLA_BOTJR      ----------------------------------------------------------------------
OXLA_BOTMO      ----------------------------------------------------------------------
OYEA_SCHPO      YMSKRDIQEHIQDFVNAADLAVNIAKA---DGVEIHQVNGFLLDRFLGGFGDQCDPEYRGSIENRCRFPL
OXLA_TRIST      ----------------------------------------------------------------------
OXLA_OXYSC      ----------------------------------------------------------------------
YEIT_SALTY      ----------------------------------------------------------------------
YEIT_SALTI      ----------------------------------------------------------------------
OXLA_NOTSC      ----------------------------------------------------------------------
OXLA_DEMVE      ----------------------------------------------------------------------
OXLA_AGKRH      ----------------------------------------------------------------------
GPDA_GEOSM      ----------------------------------------------------------------------
GPDA_GEOBB      ----------------------------------------------------------------------
YR656_MIMIV     ----------------------------------------------------------------------
OXLA_AGKHP      ----------------------------------------------------------------------
MNMC_ACIBC      ----------------------------------------------------------------------
YGFK_ECOLI      ----------------------------------------------------------------------
YGFK_ECO57      ----------------------------------------------------------------------
OXLA_AGKHA      ----------------------------------------------------------------------
MNMC_LEGPL      ----------------------------------------------------------------------
MNMC_LEGPH      ----------------------------------------------------------------------
MNMC_LEGPC      ----------------------------------------------------------------------
MNMC_LEGPA      ----------------------------------------------------------------------
GSOX3_ARATH     ----------------------------------------------------------------------
GPDA_PSEMY      ----------------------------------------------------------------------
AEGA_ECOLI      ----------------------------------------------------------------------
MNMC_ACIBT      ----------------------------------------------------------------------
CRTN_STAAW      ----------------------------------------------------------------------
CRTN_STAAS      ----------------------------------------------------------------------
CRTN_STAAR      ----------------------------------------------------------------------
CRTN_STAAN      ----------------------------------------------------------------------
CRTN_STAAM      ----------------------------------------------------------------------
CRTN_STAAE      ----------------------------------------------------------------------
CRTN_STAA8      ----------------------------------------------------------------------
CRTN_STAA3      ----------------------------------------------------------------------
CRTN_STAAB      ----------------------------------------------------------------------
HDRA2_METKA     ----------------------------------------------------------------------
GPDA_PSEU2      ----------------------------------------------------------------------
GPDA_PSESM      ----------------------------------------------------------------------
GPDA_PSE14      ----------------------------------------------------------------------
GPDA_LACRJ      ----------------------------------------------------------------------
GPDA_LACRD      ----------------------------------------------------------------------
THI4_PYRIL      ----------------------------------------------------------------------
THI4_DESOH      ----------------------------------------------------------------------
GPDA_AZOVD      ----------------------------------------------------------------------
YOBN_BACSU      ----------------------------------------------------------------------
YGFT_ECOLI      ----------------------------------------------------------------------
TRKA_METTH      ----------------------------------------------------------------------
MNMC_BURS3      ----------------------------------------------------------------------
GPDA_PSEPF      ----------------------------------------------------------------------
DUSB_PSEAE      ------------------AEAAQRNVELGAQIIDINMG---------CPAKKVCNKAAGSALLRDEALVA
CRTN_STAAC      ----------------------------------------------------------------------
ZDS_SOLLC       ----------------------------------------------------------------------
GPDA_GEOSL      ----------------------------------------------------------------------
GPDA_GEOMG      ----------------------------------------------------------------------
MNMC_BURVG      ----------------------------------------------------------------------
MNMC_BURCC      ----------------------------------------------------------------------
GPDA_PSEF5      ----------------------------------------------------------------------
GPDA_PELCD      ----------------------------------------------------------------------
DPYD_BOVIN      ----------------------------------------------------------------------
THI4_METAC      ----------------------------------------------------------------------
GPDA_SYNR3      ----------------------------------------------------------------------
GPDA_PSEFS      ----------------------------------------------------------------------
GPDA_PSEE4      ----------------------------------------------------------------------
ZDS_SYNY3       ----------------------------------------------------------------------
THI4_METMA      ----------------------------------------------------------------------
GPDA_PARL1      ----------------------------------------------------------------------
GPDA_LACF3      ----------------------------------------------------------------------
ZDS_NARPS       ----------------------------------------------------------------------
THI4_METBF      ----------------------------------------------------------------------
THI4_HALWD      ----------------------------------------------------------------------
MERA_BACCE      ----------------------------------------------------------------------
GPDA_LACCB      ----------------------------------------------------------------------
GPDA_LACC3      ----------------------------------------------------------------------
GPDA_DESAD      ----------------------------------------------------------------------
FENR_DEIGD      ----------------------------------------------------------------------
CRTI_MYXXA      ----------------------------------------------------------------------
MNMC_ACIAD      ----------------------------------------------------------------------
KMO_CRYNE       ----------------------------------------------------------------------
HIS6_STRAW      ----------------------------------------------------------------------
GPDA_LEPBP      ----------------------------------------------------------------------
GPDA_LEPBA      ----------------------------------------------------------------------
CRTI_ARATH      ----------------------------------------------------------------------
ZDS_MAIZE       ----------------------------------------------------------------------
ZDS_ARATH       ----------------------------------------------------------------------
THI4_DESMR      ----------------------------------------------------------------------
MNMC_BURA4      ----------------------------------------------------------------------
GLTD_ECOLI      ----------------------------------------------------------------------
GGR_METMA       ----------------------------------------------------------------------
GGR_METBF       ----------------------------------------------------------------------
GGR_METAC       ----------------------------------------------------------------------
DUSC_RALEH      ----------------------------------------------------------GAMLLTNPELLN
DUSB_XANAC      ----------------------------------------------------------------------
DUSB_ERWCA      ----------------------------------------------------------------------
CRTI_SYNE7      ----------------------------------------------------------------------
CATB_RHOOP      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EIIDAIRAEVGPDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHYY
STCD_RHIME      DVLKAIRARVGDEFILGVRYTADECLPGGTDKAEGLEISKRLKESGLIDYLNIIRGTDPGLTDVIPIQGM
NADO_THEBR      EIIRRIKEAVGEDYPISFRFSADEFVEGGNTLEEGKQIAKMLEEAG-VHVLHVSAGIYESMPTLLEPSRF
DHTM_METME      ETLEKVKHAVGSDCAIATRFGVDTVYGPGQIEAE-VDGQKFVEADSLVDMWDITIGDEWGEDAGPSRFYQ
BAIH_EUBSP      EMIEEARRNVSPDFPIFLRISGDERMVGGNSLEDMLYLAPKFEAAG-VSMLEVSGGTQYEGLEHIIP-CQ
FADH_ECOLI      XXXXXXXXXXGNDFIIIYRLSMLDLVEDGGTFAETVELAQAIEAAGATIINTGIGWHEARIPTIATPVPR
BAICD_EUBSP     EVVQAIRSNIPDDMPFFMRADCIDEL-----MEQTMTEEEIVTFINKCAELGVDVADRGNATSFATVYEV
DHDM_HYPSX      ETLEKIRRAVNDDVALVTRC----ATDTLY-GTKGVELTRFIEASPYLDLWDVNIGDEWGEDAG-PSRFY
NAMA_BACSU      EIIDEVKQVW--DGPLFVRVSASDYTDKGLDIADHIGFAKWMKEQG-VDLIDCSSGALVHADINVFPGYQ
NAMA_GEOKA      EVIDAVR-EVW-DGPLFVRISASDYHPDGLTAKDYVPYAKRMKEQG-VDLVDVSSGAIVPARMNVYPGYQ
NAMA_BACA2      ETIEAVK-EVW-DGPLFVRISASDYTDKGLDIADHIGFAKWMKEQG-VDLIDCSSGALVQADINVFPGYQ
NAMA_BACHD      EIISEIQTVW--DGPLFVRISAAEYAEGGNELSDFITLAKWMKKQG-IDLIDCSSGAVVPAPIPVYPGYQ
NAMA_GEOSW      EIIDAVR-EVW-DGPLFVRISASDYHPEGLTVKDYVPYAKRMKEQG-VDLIDVSSGAVVPAKIRVYPGYQ
NAMA_GEOTN      EVIDAVR-EVW-DGPLFVRISASDYHPDGLTVKDYVPYVKRMKEQG-VDLVDVSSGAVVPARIDVYPGYQ
NEMA_ECOLI      EVVDAGIEEWGAD-RIGIRVSTFQNTDNGPN--EEADALYLIEQLGKIAYLHMSEPDWAGGEPYTDA---
NAMA_BACLD      EVIDAVKVWAGPLF---VRVSASDYKTKGLDVADYVGFAKWMKEQG-VDLIDVSSGAVVPADINVFPGYQ
OYE2_YEAST      EVVDAVVDAIGPE-KVGLRLSPYGVFNSMSGGAETGIVAQYAYVLGELE-RRAKAGKRLAFVHLVEPRVT
OYE3_YEAST      EVVDALIETIGPE-RVGLRLSPYGTFNSMSGGAEPGIIAQYSYVLGELE-KRAKAGKRLAFVHLVEPRVT
NAMA_LISW6      DIIKAVK-EVW-DGPIIVRVSATDYAHGGLQLEDYIPFAKWMKADG-VELIDVSTGGLVNVAPPVFPGYQ
OYE1_SACPS      EVVDALVEAIGHE-KVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELE-KRAKAGKRLAFVHLVEPRVT
OPR3_SOLLC      QVVQAVVSAIGAD-RVGVRVS--PAID-HLDAMDSNPLSLGLAVVERLNKIQLHSGSKLAYLHVTQPRYY
OPR3_ARATH      QVVEGVVSAIGAS-KVGVRVS--PAID-HLDATDSDPLSLGLAVVGMLNKLQGVNGSKLAYLHVTQPRYH
NAMA_CLOAB      EVLEAVREVWPKEKPILLRVSAEDYRGGGITPNEMVNIINIVK-----DLIDVVVSSGGVAPAHINLY--
OPR1_ARATH      EIVDAVAKEIGPD-RVGIRLSPFDYMESGNPGALGLYMAESLNKYG-ILYCHVIMGEVHACPHTLMP---
OPRL1_ARATH     QVIEAVSKEIGPD-RVGIRLSPFDYMESGDTDPKGLYMAKSLNRF-EILYCHM-----------IEPRMK
NAMA_BACP2      EVVNAVN-EVW-DGPLFVRVSASDYTTKGLDIADYIGIATWLKEQG-VDLIDVSSGAVVQARISTFPGYQ
YQIG_BACSU      AIVDEVKKAASEHFLVGYRLSPEEPETPGLTMTETYTLVDAL-GDKELDYLHISLMDNSKARRGADPTRT
NAMA_BACWK      EIIDAVNEVWNGPLFVRISANDYH--------PDGLTVQDYVQYTGWMKEQGVLIDCSSGAPAHIDVY--
NAMA_BACCN      EIIHAVK-EVGPLF---VRISADDYHPEGLTVNDYVQFAKWMKEQG-VDLIDCSSGA--VVPAHIDVY--
NAMA_LISMF      DIIKAVK-EVW-DGPIIVRVSATDYAHGGLQLEDHIPFAKWMKADG-VELIDVSTGGLVNVAPPVFPGYQ
NAMA_LISMC      DIIKAVK-EVW-DGPIIVRVSATDYAHGGLQLEDHIPFAKWMKADG-VELIDVSTGGLVNVAPPVFPGYQ
NAMA_LISIN      DIIKAVK-EVW-DGPIIVRVSATDYAHGGLQLEDHIPFAKWMKADG-VELIDVSTGGLVNVEPPVFPGYQ
NAMA_BACC2      EIIDSVKVWDGPIF---VRISANDYHPDGLTVQDYVQYTKWMKEQG-IDLIDCSSGA--VVPAHIDVYPG
NAMA_BACC0      EIIDSIN-EVGPLF---VRISANDYHPDGLTVQDYVQYTKWMKEQG-VDLIDCSSGAVVPARIDVYPGYQ
OPR1_SOLLC      EIVEAVANEIGSD-RVGIRISPFAHYNEAGDTNPTALGLYMVESLNKYDLAYCHV---------VEPRMW
NAMA_BACCZ      EIIDSIN-EVGPLF---VRISANDYHPDGLTVQDYVQYTKWMKEQG-VDLIDCSSGAVVPARIDVYPGYQ
OPR2_ARATH      EVVDAVAKEIGPD-RVGIRLSPFDYMESGDTNPEGLYMVESLNKYGMIEPRMKTVGEIAACSHTLMP---
NAMA_LISMH      DIIKAVK-EVW-DGPIIVRVSATDYAHGGLQLEDHIPFAKWMKADG-VELIDVSTGGLVNVAPPVFPGYQ
NAMA_BACC3      EIIDSIN-EVGPLF---VRISANDYHPDGLTVQDYVQYTKWMKEQG-VDLIDCSSGAVVPARIDVYPGYQ
NAMA_BACAH      EIIDSIN-EVGPLF---VRISANDYHPDGLTVQDYVQYTKWMKEQG-VDLIDCSSGAVVPARIDVYPGYQ
NAMA_LISMO      DIIKAVK-EVW-DGPIIVRVSATDYAHGGLQLEDHIPFAKWMKADG-VELIDVSTGGLVNVAPPVFPGYQ
NAMA_BACAN      EIIDSIN-EVGPLF---VRISANDYHPDGLTVQDYVQYTKWMKEQG-VDLIDCSSGAVVPARIDVYPGYQ
NAMA_BACAC      EIIDSIN-EVGPLF---VRISANDYHPDGLTVQDYVQYTKWMKEQG-VDLIDCSSGAVVPARIDVYPGYQ
NAMA_BACAA      EIIDSIN-EVGPLF---VRISANDYHPDGLTVQDYVQYTKWMKEQG-VDLIDCSSGAVVPARIDVYPGYQ
NAMA_BACHK      EIIDSIN-EVGPLF---VRISANDYHPDGLTVQDYIQYTKWMKEQG-VDLIDCSSGAVVPARIDVYPGYQ
NAMA_BACCR      EIIDSVN-EVGPIF---VRISANDYHPDGLTVQDYVQYTKWMKEQG-IDLIDCSSGA--VVPAHIDVY--
NAMA_BACC4      EIIDSVN-EVGPIF---VRISANDYHPDGLTVQDYVQYTKWMKEQG-IDLIDCSSGA--VVPAHIDVYPG
NAMA_BACC1      EIIDSIN-EVGPLF---VRISANDYHPDGLTVQDYVQYTKWMKEQG-VDLIDCSSGAVVPARIDVYPGYQ
KYE1_KLULA      EXXXXXXXXXGAERT-SIRFSVFGTMSGGSDAYVLAELEKRAKAGKRLAYVDLV------EPRVTSPFQP
OYEC_SCHPO      EVVHSVRKAIPDSMPLFYRVTATDWLGQGWEIEDTVALAARLR-DGGVDLIDVSSGGNHKDQRIEVKDCY
NAMA_BACCQ      EIIESIN-EVGPLF---VRISANDYHPDGLTVQDYVQYTKWMKEQG-VDLIDCSSGAVVPARIDVYPGYQ
NAMA_BACC7      EIIESIN-EVGPLF---VRISANDYHPDGLTVQDYVQYTKWMKEQG-VDLIDCSSGAVVPARIDVYPGYQ
OPRL2_ARATH     EVIEAVVNEIGSD-RVGIRLS-------------------------------------------------
OPRL_SOLLC      EIVEAVANEIGAD-KIGIKLSPFDGKKDSNSEALATYMANELSKLGVL-YL----------------HVM
EBP1_CANAL      RVVDKLIEVVGAN-RLALRLSPWASFQG------------------------------------------
GLT1_SCHPO      ----------------------------------------------------------------------
OYEB_SCHPO      ELLESVVNAIGQE-RVGYRISPFSDIWKDKDSFEAFMIKKIKERFPNLAYL----------------HAI
GLSN_MEDSA      ----------------------------------------------------------------------
GLT1_YEAST      ----------------------------------------------------------------------
YEIT_ECO57      ----------------------------------------------------------------------
OXLA_CROAT      ----------------------------------------------------------------------
OXLA_CROAD      ----------------------------------------------------------------------
GLTB_BACSU      ----------------------------------------------------------------------
YEIT_ECOLI      ----------------------------------------------------------------------
OXLA_PSEAU      ----------------------------------------------------------------------
OXLA_BOTJR      ----------------------------------------------------------------------
OXLA_BOTMO      ----------------------------------------------------------------------
OYEA_SCHPO      EVLEAVTRKIGQE-RVGYRISPFSGWMQKIDFME-VNIYLMSEIAKRFPKLAYI--------HAIEPRKY
OXLA_TRIST      ----------------------------------------------------------------------
OXLA_OXYSC      ----------------------------------------------------------------------
YEIT_SALTY      ----------------------------------------------------------------------
YEIT_SALTI      ----------------------------------------------------------------------
OXLA_NOTSC      ----------------------------------------------------------------------
OXLA_DEMVE      ----------------------------------------------------------------------
OXLA_AGKRH      ----------------------------------------------------------------------
GPDA_GEOSM      ----------------------------------------------------------------------
GPDA_GEOBB      ----------------------------------------------------------------------
YR656_MIMIV     ----------------------------------------------------------------------
OXLA_AGKHP      ----------------------------------------------------------------------
MNMC_ACIBC      ----------------------------------------------------------------------
YGFK_ECOLI      ----------------------------------------------------------------------
YGFK_ECO57      ----------------------------------------------------------------------
OXLA_AGKHA      ----------------------------------------------------------------------
MNMC_LEGPL      ----------------------------------------------------------------------
MNMC_LEGPH      ----------------------------------------------------------------------
MNMC_LEGPC      ----------------------------------------------------------------------
MNMC_LEGPA      ----------------------------------------------------------------------
GSOX3_ARATH     ----------------------------------------------------------------------
GPDA_PSEMY      ----------------------------------------------------------------------
AEGA_ECOLI      ----------------------------------------------------------------------
MNMC_ACIBT      ----------------------------------------------------------------------
CRTN_STAAW      ----------------------------------------------------------------------
CRTN_STAAS      ----------------------------------------------------------------------
CRTN_STAAR      ----------------------------------------------------------------------
CRTN_STAAN      ----------------------------------------------------------------------
CRTN_STAAM      ----------------------------------------------------------------------
CRTN_STAAE      ----------------------------------------------------------------------
CRTN_STAA8      ----------------------------------------------------------------------
CRTN_STAA3      ----------------------------------------------------------------------
CRTN_STAAB      ----------------------------------------------------------------------
HDRA2_METKA     ----------------------------------------------------------------------
GPDA_PSEU2      ----------------------------------------------------------------------
GPDA_PSESM      ----------------------------------------------------------------------
GPDA_PSE14      ----------------------------------------------------------------------
GPDA_LACRJ      ----------------------------------------------------------------------
GPDA_LACRD      ----------------------------------------------------------------------
THI4_PYRIL      ----------------------------------------------------------------------
THI4_DESOH      ----------------------------------------------------------------------
GPDA_AZOVD      ----------------------------------------------------------------------
YOBN_BACSU      ----------------------------------------------------------------------
YGFT_ECOLI      ----------------------------------------------------------------------
TRKA_METTH      ----------------------------------------------------------------------
MNMC_BURS3      ----------------------------------------------------------------------
GPDA_PSEPF      ----------------------------------------------------------------------
DUSB_PSEAE      EILDAVVRAVDVPVTLKIRTGWDR------DNRNGVTVAKLAEQAG---IQALAVHGRTRADLYTGEAEY
CRTN_STAAC      ----------------------------------------------------------------------
ZDS_SOLLC       ----------------------------------------------------------------------
GPDA_GEOSL      ----------------------------------------------------------------------
GPDA_GEOMG      ----------------------------------------------------------------------
MNMC_BURVG      ----------------------------------------------------------------------
MNMC_BURCC      ----------------------------------------------------------------------
GPDA_PSEF5      ----------------------------------------------------------------------
GPDA_PELCD      ----------------------------------------------------------------------
DPYD_BOVIN      ----------------------------------------------------------------------
THI4_METAC      ----------------------------------------------------------------------
GPDA_SYNR3      ----------------------------------------------------------------------
GPDA_PSEFS      ----------------------------------------------------------------------
GPDA_PSEE4      ----------------------------------------------------------------------
ZDS_SYNY3       ----------------------------------------------------------------------
THI4_METMA      ----------------------------------------------------------------------
GPDA_PARL1      ----------------------------------------------------------------------
GPDA_LACF3      ----------------------------------------------------------------------
ZDS_NARPS       ----------------------------------------------------------------------
THI4_METBF      ----------------------------------------------------------------------
THI4_HALWD      ----------------------------------------------------------------------
MERA_BACCE      ----------------------------------------------------------------------
GPDA_LACCB      ----------------------------------------------------------------------
GPDA_LACC3      ----------------------------------------------------------------------
GPDA_DESAD      ----------------------------------------------------------------------
FENR_DEIGD      ----------------------------------------------------------------------
CRTI_MYXXA      ----------------------------------------------------------------------
MNMC_ACIAD      ----------------------------------------------------------------------
KMO_CRYNE       ----------------------------------------------------------------------
HIS6_STRAW      ------------------------------DAGDPVEMAKVYDAEGELTFLDITASSGNRETTY------
GPDA_LEPBP      ----------------------------------------------------------------------
GPDA_LEPBA      ----------------------------------------------------------------------
CRTI_ARATH      ----------------------------------------------------------------------
ZDS_MAIZE       ----------------------------------------------------------------------
ZDS_ARATH       ----------------------------------------------------------------------
THI4_DESMR      ----------------------------------------------------------------------
MNMC_BURA4      ----------------------------------------------------------------------
GLTD_ECOLI      ----------------------------------------------------------------------
GGR_METMA       ----------------------------------------------------------------------
GGR_METBF       ----------------------------------------------------------------------
GGR_METAC       ----------------------------------------------------------------------
DUSC_RALEH      RIVASVRAAVPAHIAVTAKMRL-----GVSDASLAIDCATALAEGGAA---SLVVH------ARTRDHGY
DUSB_XANAC      -------------------------------------------------------------------HYT
DUSB_ERWCA      ----------------------------------------------------------------------
CRTI_SYNE7      ----------------------------------------------------------------------
CATB_RHOOP      ------------------------ALDPAVDTARVVQIAQALQGKAGVRIDVNARWDRLTALKYV-PRLV


                         .         *         .         .         .         .         +:350
query           QPAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEIITKTAQGRVHEIRP
STCD_RHIME      ANSPHLDFAGEIRAATNFPTFHAAKIPDVATARHAIASGKVDMVGMTRAHMTDPHIVRKIIEKREEDIRP
NADO_THEBR      EQGWRVYLAEEIKKVVNIPVITVGVIREPEFAEKIIAEGRADFVAVGRGLIADPEWPKKAKEGRQNEIRK
DHTM_METME      QTIPWVKLVKQVSKK---PVLGVGRYTDPEKMIEIVTKGYADIIGCARPSIADPFLPQKVEQGRYDDIRV
BAIH_EUBSP      NKSRGVNVASEIKKVVGIPVYAVGKINDIRYAAEIVERGLVDGVAMGRPLLADPDLCKKAVEGQFDEITP
FADH_ECOLI      GAFSW--VTRKLKGHVSLPLVTTNRINDPQVADDILSRGDADMVSMARPFLADAELLSKAQSGRADEINT
BAICD_EUBSP     PPFNLAENIYNIKKQINIPVMGVGRINTGEMANKVIEEGKFDLVGIGRAQLADPNWITKVREGKEDLIRH
DHDM_HYPSX      PIAHENDWIRHIKQATNKPVVGVGRYYDPEKMLQVXXXXXXXXXXXXRPSIADPWLPRKIDEGRVDDIRT
NAMA_BACSU      -----VSFAEKIREQADMATGAVGMITDGSMAEEILQNGRADLIFIGRELLRDP----------------
NAMA_GEOKA      VP-----FAELIRREADIPTGAVGLITSGWQAEEILQNGRADLVFLGRELLRNP----------------
NAMA_BACA2      -----VSFAEKIREQAEIATGAVGLITTGTMAEEILQNNRADLIFVARELLRDPHFARSAAK--------
NAMA_BACHD      VP-----LAEAIRHEANIATGAVGLITSGIQAEEILQNERADLIFVARELLRNP----------------
NAMA_GEOSW      VP-----FAETIRREANIATGAVGLITSGLQAEEILRNGRADLVFLARELLRNP----------------
NAMA_GEOTN      VP-----FAEFIRREAGIPTGAVGLITSGWQAEEVLHNGRADLVFLGRELLRNP----------------
NEMA_ECOLI      -------FREKVRARFHGPIIGAGAYT-VEKAETLIGKGLIDAVAFGRDWIANPDLVAR-----------
NAMA_BACLD      -----VGFADTIRAQAEIQTGAVGLITSGLQAEEILQNGRADLIFVARELLRDP----------------
OYE2_YEAST      NPSIWKGPIIRAGNFALHPEVVREEVKDPRT-----------LIGYGRFFISNPDLVDRLEKG-------
OYE3_YEAST      DPSGTNDFAYSIWKG---PIIRAGNYALHPEVVREQVKDPRTLIGYGRFFISNPDLVYRLEEG-------
NAMA_LISW6      VP-----FADEIRRGAGIATGVLGLITRGEQAEEILCNERADLIIIGRELLRNP----------------
OYE1_SACPS      NPGEYEGGSNDFVYSIKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKG-------
OPR3_SOLLC      GQTEAGRLGSEEEEARLMRTLYQGTCSGGYTREEAVAQGDADLVSYGRLFISNPDLVMR-----------
OPR3_ARATH      ESGRQGSDEEEAKLMKSLRMAYNGTFMNKELGMQAVQQGDADLVSYGRLFIANPDLVSR-----------
NAMA_CLOAB      -PGYQVKLSEVIKNECNVPTIAVGLICDINMVEEILSNNRADLVALGRELLRNPYFVLSSAR--------
OPR1_ARATH      -----------MRKAFKGTFISAGGFT-REDGNEAVSKGRTDLVAYGRWFLANPDL--------------
OPRL1_ARATH     TVSEIFECRESLTNAFNGTFIVAGGYT-REDGNKAVAEGRTDLVAYGRLFLANPDL--------------
NAMA_BACP2      -----VTFAEKIKEGAGIQTGAVGLITSGVQAEEILRNQRADLIFIGREFLRDP----------------
YQIG_BACSU      R----MDLLNERV-GNKVPLIAVGSIHSADDALAVIENG-IPLVAMGREILVDPNWTVKVKEGREKQIET
NAMA_BACWK      -PGYQVQYAKHIKEHVNIATGAVGLITTGSQAEQILNNNEADLIFIGRELLRNP----------------
NAMA_BACCN      -PGYQVKYAKHLKEHAQIATGAVGLITSGVQAEQILVNSEADLIFVGRELLRNP----------------
NAMA_LISMF      VP-----FADEXXXXXXXXXXXXXXXXRGEQAEEILCNERADLIIVGRELLRNP----------------
NAMA_LISMC      VP-----FADEXXXXXXXXXXXXXXXXRGEQAEEILCNERADLIIVGRELLRNP----------------
NAMA_LISIN      VP-----FADEXXXXXXXXXXXXXXXXRGEQAEEILCNERADLIIIGRELLRNPYFAKEAAE--------
NAMA_BACC2      YQVQYAKHIKEYTKIATGAV---GLITTGSQAEQILNDNEADLIFIGRELLRNP----------------
NAMA_BACC0      -----VQYAKHIKEHANIATGAVGLITTGAQAEQILTNNEADLIFIGRELLRNP----------------
OPR1_SOLLC      EKIECTESLVPMRKAYKGTFIVAGGY-DREDGNRALIEDRADLVAYGRLFISNPDL--------------
NAMA_BACCZ      -----VQYAKHIKEHANIATGAVGLITTGAQAEQILNNNEADLIFIGRELLRNP----------------
OPR2_ARATH      -----------MREAFKGTFISAGGFT-REDGNEAVAKGRTDLVAYGRWFLANPDL--------------
NAMA_LISMH      VP-----FADEXXXXXXXXXXXXXXXXRGEQAEEILCNERADLIIVGRELLRNPYFAKDAAE--------
NAMA_BACC3      -----VQYAKHIKEHANIATGAVGLITTGAQAEQILTNNEADLIFIGRELLRNP----------------
NAMA_BACAH      -----VQYAKHIKEHANIATGAVGLITTGAQAEQILTNNEADLIFIGRELLRNP----------------
NAMA_LISMO      VP-----FADEXXXXXXXXXXXXXXXXRGEQAEEILCNERADLIIVGRELLRNP----------------
NAMA_BACAN      -----VQYAKHIKEHANIATGAVGLITTGAQAEQILNNNEADLIFIGRELLRNP----------------
NAMA_BACAC      -----VQYAKHIKEHANIATGAVGLITTGAQAEQILNNNEADLIFIGRELLRNP----------------
NAMA_BACAA      -----VQYAKHIKEHANIATGAVGLITTGAQAEQILNNNEADLIFIGRELLRNP----------------
NAMA_BACHK      -----VQYAKHIKEHANIATGAVGLITTGAQAEQILTNNEADLIFIGRELLRNP----------------
NAMA_BACCR      -PGYQVQYAKHIKEHTNIATGAVGLITTGSQAEQILNNNEADLIFIGRELLRNP----------------
NAMA_BACC4      YQVQYAKHIKEHTKIATGAV---GLITTGSQAEQILNNNEADLIFIGRELLRNP----------------
NAMA_BACC1      -----VQYAKHIKEHANIATGAVGLITTGAQAEQILNNNEADLIFIGRELLRNP----------------
KYE1_KLULA      EFEGWYKGGTNVYSVWKGNVLRVGNYALDPDAAITDSKNPNTLIGYGRAFIANPDLVERLEKG-------
OYEC_SCHPO      Q-VPFAEKIKDQVNGILLGAV--GMIRDGLTANEILESGKADVTFVAREFLRNPSLVLDSA---------
NAMA_BACCQ      -----VQYAKHIKEHANIATGAVGLITTGAQAEQILNNNEADLIFIGRELLRNP----------------
NAMA_BACC7      -----VQYAKHIKEHANIATGAVGLITTGAQAEQILNNNEADLIFIGRELLRNP----------------
OPRL2_ARATH     ----------------------------------------------------------------------
OPRL_SOLLC      EPRETVNRSLLPIRKAFKGTLIASGGYGKSDGEKAIDENYADLISFGRMFLANPDL--------------
EBP1_CANAL      ----------------------------------------------------------------------
GLT1_SCHPO      ----------------------------------------------------------------------
OYEB_SCHPO      EPRQYWNGHVHITQEKN-TLIYKNLWGDPHDRDSAIAEQENTLVAFGRYFLSNPDL--------------
GLSN_MEDSA      ----------------------------------------------------------------------
GLT1_YEAST      ----------------------------------------------------------------------
YEIT_ECO57      ----------------------------------------------------------------------
OXLA_CROAT      ----------------------------------------------------------------------
OXLA_CROAD      ----------------------------------------------------------------------
GLTB_BACSU      ----------------------------------------------------------------------
YEIT_ECOLI      ----------------------------------------------------------------------
OXLA_PSEAU      ----------------------------------------------------------------------
OXLA_BOTJR      ----------------------------------------------------------------------
OXLA_BOTMO      ----------------------------------------------------------------------
OYEA_SCHPO      WSGHKLVSSEQNTSFLQKPFITAGGY-DPETAVQA-ANERGVLVAFGRNFIANPDLV-------------
OXLA_TRIST      ----------------------------------------------------------------------
OXLA_OXYSC      ----------------------------------------------------------------------
YEIT_SALTY      ----------------------------------------------------------------------
YEIT_SALTI      ----------------------------------------------------------------------
OXLA_NOTSC      ----------------------------------------------------------------------
OXLA_DEMVE      ----------------------------------------------------------------------
OXLA_AGKRH      ----------------------------------------------------------------------
GPDA_GEOSM      ----------------------------------------------------------------------
GPDA_GEOBB      ----------------------------------------------------------------------
YR656_MIMIV     ----------------------------------------------------------------------
OXLA_AGKHP      ----------------------------------------------------------------------
MNMC_ACIBC      ----------------------------------------------------------------------
YGFK_ECOLI      ----------------------------------------------------------------------
YGFK_ECO57      ----------------------------------------------------------------------
OXLA_AGKHA      ----------------------------------------------------------------------
MNMC_LEGPL      ----------------------------------------------------------------------
MNMC_LEGPH      ----------------------------------------------------------------------
MNMC_LEGPC      ----------------------------------------------------------------------
MNMC_LEGPA      ----------------------------------------------------------------------
GSOX3_ARATH     ----------------------------------------------------------------------
GPDA_PSEMY      ----------------------------------------------------------------------
AEGA_ECOLI      ----------------------------------------------------------------------
MNMC_ACIBT      ----------------------------------------------------------------------
CRTN_STAAW      ----------------------------------------------------------------------
CRTN_STAAS      ----------------------------------------------------------------------
CRTN_STAAR      ----------------------------------------------------------------------
CRTN_STAAN      ----------------------------------------------------------------------
CRTN_STAAM      ----------------------------------------------------------------------
CRTN_STAAE      ----------------------------------------------------------------------
CRTN_STAA8      ----------------------------------------------------------------------
CRTN_STAA3      ----------------------------------------------------------------------
CRTN_STAAB      ----------------------------------------------------------------------
HDRA2_METKA     ----------------------------------------------------------------------
GPDA_PSEU2      ----------------------------------------------------------------------
GPDA_PSESM      ----------------------------------------------------------------------
GPDA_PSE14      ----------------------------------------------------------------------
GPDA_LACRJ      ----------------------------------------------------------------------
GPDA_LACRD      ----------------------------------------------------------------------
THI4_PYRIL      ----------------------------------------------------------------------
THI4_DESOH      ----------------------------------------------------------------------
GPDA_AZOVD      ----------------------------------------------------------------------
YOBN_BACSU      ----------------------------------------------------------------------
YGFT_ECOLI      ----------------------------------------------------------------------
TRKA_METTH      ----------------------------------------------------------------------
MNMC_BURS3      ----------------------------------------------------------------------
GPDA_PSEPF      ----------------------------------------------------------------------
DUSB_PSEAE      ETI------AAIKQAVSIPVFANGDIDSPEKARKVIEQTGVDALLIGRA---------------------
CRTN_STAAC      ----------------------------------------------------------------------
ZDS_SOLLC       ----------------------------------------------------------------------
GPDA_GEOSL      ----------------------------------------------------------------------
GPDA_GEOMG      ----------------------------------------------------------------------
MNMC_BURVG      ----------------------------------------------------------------------
MNMC_BURCC      ------------------------------------------------------EHATFATHAKSDDVKH
GPDA_PSEF5      ----------------------------------------------------------------------
GPDA_PELCD      ----------------------------------------------------------------------
DPYD_BOVIN      ----------------------------------------------------------------------
THI4_METAC      ----------------------------------------------------------------------
GPDA_SYNR3      ----------------------------------------------------------------------
GPDA_PSEFS      ----------------------------------------------------------------------
GPDA_PSEE4      ----------------------------------------------------------------------
ZDS_SYNY3       ----------------------------------------------------------------------
THI4_METMA      ----------------------------------------------------------------------
GPDA_PARL1      ----------------------------------------------------------------------
GPDA_LACF3      ----------------------------------------------------------------------
ZDS_NARPS       ----------------------------------------------------------------------
THI4_METBF      ----------------------------------------------------------------------
THI4_HALWD      ----------------------------------------------------------------------
MERA_BACCE      ----------------------------------------------------------------------
GPDA_LACCB      ----------------------------------------------------------------------
GPDA_LACC3      ----------------------------------------------------------------------
GPDA_DESAD      ----------------------------------------------------------------------
FENR_DEIGD      ----------------------------------------------------------------------
CRTI_MYXXA      ----------------------------------------------------------------------
MNMC_ACIAD      ----------------------------------------------------------------------
KMO_CRYNE       ----------------------------------------------------------------------
HIS6_STRAW      ------DVVRRTAEQVFIPLTVGGGVRTPDDVDKLLRAG-ADKVGVNTAAIARPELIREIAE--------
GPDA_LEPBP      ----------------------------------------------------------------------
GPDA_LEPBA      ----------------------------------------------------------------------
CRTI_ARATH      ----------------------------------------------------------------------
ZDS_MAIZE       ----------------------------------------------------------------------
ZDS_ARATH       ----------------------------------------------------------------------
THI4_DESMR      ----------------------------------------------------------------------
MNMC_BURA4      ----------------------------------------------------------------------
GLTD_ECOLI      ----------------------------------------------------------------------
GGR_METMA       ----------------------------------------------------------------------
GGR_METBF       ----------------------------------------------------------------------
GGR_METAC       ----------------------------------------------------------------------
DUSC_RALEH      RPPAHWDWIARIAAAVDVPVIANGDVWTVADWERCRAVSGCADVMIGRGAVSDP----------------
DUSB_XANAC      GSAEYATIA-QIKAALQIPVVANGDIDSPQKAAQVLRETGADAVMIGRAAQGRPWIFGEVA---------
DUSB_ERWCA      ------DSIRAVKQAVSIPIIANGDITDPHKARAVLDYTGADALMIGRA---------------------
CRTI_SYNE7      ----------------------------------------------------------------------
CATB_RHOOP      EPGEQLEVLAELNRLVPVPVMADESVQTPHDALEVARRGAADVIAL------------------------


                         .         .         .         .         *         .         .:420
query           CIGCNECIHRRLVDKLPFACAINPYASRELDGPLPPARTPRRVLVVGGGPAGMELAGLLAERGHEVTLWE
STCD_RHIME      CVGANYCLDRIYQGGAAY-CIHNAATGRELTMPIAKAHCRRKVVVVGTGPAGLEAARVAGERGHEVIVFE
NADO_THEBR      CISCNGCIGGRVFQNLRLRCTVNPVAGREVYSEIXXXXXXXXXXXXXXXXXXXXXXITAAKRGHQVILYE
DHTM_METME      CIGCNVCISRWEIGGPPMICTQNATAGEEYRRGWHPTKNKDSVLIVGAGPSGSEAARVLMESGYTVHLTD
BAIH_EUBSP      CASCGSCISRS--EAAPECCHINPRLGREYEFPDVPAEKSKKVLVIGAGPGGMMAAVTAAERGHDVTVWE
FADH_ECOLI      CIGCNQCLDQIFVGKVT-SCLVNPRACHETKMPILPAVQKKNXXXXXXXXXXXXXXINAAARGHQVTLFD
BAICD_EUBSP     CIGCDQCYDAVINPKMKITCTHNPGLCLEYQG-MPKTDAPKKXXXXXXXXXXXXXXEVLKTRGHNPVIFE
DHDM_HYPSX      CIGCNVCISRWEMGGVPFICTQNATAGEEYPEKFEPKKSDHDVLIVGAGPAGSECARVLMERGYTVHLVD
NAMA_BACSU      ----------------------------------------------------------------------
NAMA_GEOKA      ----------------------------------------------------------------------
NAMA_BACA2      ----------------------------------------------------------------------
NAMA_BACHD      ----------------------------------------------------------------------
NAMA_GEOSW      ----------------------------------------------------------------------
NAMA_GEOTN      ----------------------------------------------------------------------
NEMA_ECOLI      ----------------------------------------------------------------------
NAMA_BACLD      ----------------------------------------------------------------------
OYE2_YEAST      ----------------------------------------------------------------------
OYE3_YEAST      ----------------------------------------------------------------------
NAMA_LISW6      ----------------------------------------------------------------------
OYE1_SACPS      ----------------------------------------------------------------------
OPR3_SOLLC      ----------------------------------------------------------------------
OPR3_ARATH      ----------------------------------------------------------------------
NAMA_CLOAB      ----------------------------------------------------------------------
OPR1_ARATH      ----------------------------------------------------------------------
OPRL1_ARATH     ----------------------------------------------------------------------
NAMA_BACP2      ----------------------------------------------------------------------
YQIG_BACSU      VI--------------------------------------------------------------------
NAMA_BACWK      ----------------------------------------------------------------------
NAMA_BACCN      ----------------------------------------------------------------------
NAMA_LISMF      ----------------------------------------------------------------------
NAMA_LISMC      ----------------------------------------------------------------------
NAMA_LISIN      ----------------------------------------------------------------------
NAMA_BACC2      ----------------------------------------------------------------------
NAMA_BACC0      ----------------------------------------------------------------------
OPR1_SOLLC      ----------------------------------------------------------------------
NAMA_BACCZ      ----------------------------------------------------------------------
OPR2_ARATH      ----------------------------------------------------------------------
NAMA_LISMH      ----------------------------------------------------------------------
NAMA_BACC3      ----------------------------------------------------------------------
NAMA_BACAH      ----------------------------------------------------------------------
NAMA_LISMO      ----------------------------------------------------------------------
NAMA_BACAN      ----------------------------------------------------------------------
NAMA_BACAC      ----------------------------------------------------------------------
NAMA_BACAA      ----------------------------------------------------------------------
NAMA_BACHK      ----------------------------------------------------------------------
NAMA_BACCR      ----------------------------------------------------------------------
NAMA_BACC4      ----------------------------------------------------------------------
NAMA_BACC1      ----------------------------------------------------------------------
KYE1_KLULA      ----------------------------------------------------------------------
OYEC_SCHPO      ----------------------------------------------------------------------
NAMA_BACCQ      ----------------------------------------------------------------------
NAMA_BACC7      ----------------------------------------------------------------------
OPRL2_ARATH     ----------------------------------------------------------------------
OPRL_SOLLC      ----------------------------------------------------------------------
EBP1_CANAL      ----------------------------------------------------------------------
GLT1_SCHPO      --------------------------------PRPPARTGRRVAIIGSGPAGLAAADQLNRAGHHVVIYE
OYEB_SCHPO      ----------------------------------------------------------------------
GLSN_MEDSA      --------------------------------PRPPVRTGKRVAIVGSGPSGLAAADQLNKMGHIVTVFE
GLT1_YEAST      --------------------------------PCPPSRTGFTVGVIGSGPAGLACADMLNRAGHTVTVYE
YEIT_ECO57      ----------------------------------PGTKTLGKVAIIGAGPAGLQASVTLTNQGYDVTIYE
OXLA_CROAT      ---------------------------------LTATSNPKRVVIVGAGMAGLSAAYVLAGAGHQVTVLE
OXLA_CROAD      ---------------------------------LTATSNPKRVVIVGAGMAGLSAAYVLAGAGHQVTVLE
GLTB_BACSU      ---------------------------------IPKKRTGKKVAIVGSGPAGLASADQLNQAGHSVTVFE
YEIT_ECOLI      ----------------------------------PGTKTLGKVAIIGAGPAGLQASVTLTNQGYDVTIYE
OXLA_PSEAU      ---------------------------------------PKRVVVVGAGMAGLSAAYVLAGAGHQVTLLE
OXLA_BOTJR      ---------------------------------LSTTSNPKRVVIVGAGMSGLSAAYVLANAGHQVTVLE
OXLA_BOTMO      ---------------------------------LSTTSNPKRVVIVGAGMSGLSAAYVLANAGHQVTVLE
OYEA_SCHPO      ----------------------------------------------------------------------
OXLA_TRIST      ---------------------------------LKATSNPKHVVIVGAGMSGLSAAYVLAGAGHEVTVLE
OXLA_OXYSC      ---------------------------------LKKTSNPKHVVVVGAGMAGLSAAYVLAGAGHKVTLLE
YEIT_SALTY      ----------------------------------PGSKTRGKVAIIGAGPAGLQASVTLTHLGYDVTIYE
YEIT_SALTI      ----------------------------------PGSKTRGKVAIIGAGPAGLQASVTLTHLGYDVTIYE
OXLA_NOTSC      ---------------------------------------PKHVVVVGAGMAGLSAAYVLAGAGHNVTLLE
OXLA_DEMVE      ---------------------------------LKQTSNPKRVVVVGAGMAGLSAAYVLAGAGHNVMLLE
OXLA_AGKRH      ---------------------------------LKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLE
GPDA_GEOSM      -----------------------------------------KIAVIGAGSWGTTLADLLAKKGHEVTLWA
GPDA_GEOBB      -----------------------------------------KIAVIGAGSWGTTLADLLAKKGHEVTLWA
YR656_MIMIV     -------------------------------------KVKRDVCVIGGGAAGMSIATLLKDRGYDPVVLE
OXLA_AGKHP      ---------------------------------LKATSNPKHVVVVGAGMSGLSAAYVLSGAGHQVTVLE
MNMC_ACIBC      --------------------------------------TQQRIAVIGAGIAGLSTAWAFAQRGHQVTLFE
YGFK_ECOLI      ------------------------------------------VAVIGAGPAGLAAGYFLARAGHPVTLFE
YGFK_ECO57      ------------------------------------------VAVIGAGPAGLAAGYFLARAGHPVTLFE
OXLA_AGKHA      ---------------------------------LKATSNPKHVVIVGAGMSGLSAAYVLSGAGHQVTVLE
MNMC_LEGPL      ----------------------------------PVTKEERTALIVGGGLAGCFIANSLAKRGWEVTILE
MNMC_LEGPH      ----------------------------------PVTKDERTALIVGGGLAGCFIANSLAKRGWEVTILE
MNMC_LEGPC      ----------------------------------PVTKDERTALIVGGGLAGCFIANSLAKRGWEVTILE
MNMC_LEGPA      ----------------------------------PVTKDERTALIVGGGLAGCFIANSLAKRGWEVTILE
GSOX3_ARATH     --------------------------------------TSKHVAVIGAGPAGLITSRELRREGHSVVVFE
GPDA_PSEMY      ------------------------------------------IAVLGGGSFGTALANLLAENGQRVLQWM
AEGA_ECOLI      -------------------------------------KVDKRVAIIGAGPAGLACADVLTRNGVGVTVYD
MNMC_ACIBT      --------------------------------------TQQHIAVIGAGIAGLSTAWAFAQRGHQVTLFE
CRTN_STAAW      -----------------------------------------KIAVIGAGVTGLAAAARIASQGHEVTIFE
CRTN_STAAS      -----------------------------------------KIAVIGAGVTGLAAAARIASQGHEVTIFE
CRTN_STAAR      -----------------------------------------KIAVIGAGVTGLAAAARIASQGHEVTIFE
CRTN_STAAN      -----------------------------------------KIAVIGAGVTGLAAAARIASQGHEVTIFE
CRTN_STAAM      -----------------------------------------KIAVIGAGVTGLAAAARIASQGHEVTIFE
CRTN_STAAE      -----------------------------------------KIAVIGAGVTGLAAAARIASQGHEVTIFE
CRTN_STAA8      -----------------------------------------KIAVIGAGVTGLAAAARIASQGHEVTIFE
CRTN_STAA3      -----------------------------------------KIAVIGAGVTGLAAAARIASQGHEVTIFE
CRTN_STAAB      -----------------------------------------KIAVIGAGVTGLAAAARIASQGHEVTIFE
HDRA2_METKA     -----------------------------------------RALVIGGGVSGIQAALDLADMGFEVILVE
GPDA_PSEU2      --------------------------------------TQQPVAVLGGGSFGTAIANLLAENGHQVRQWM
GPDA_PSESM      --------------------------------------TQQPVAVLGGGSFGTAIANLLAENGHQVRQWM
GPDA_PSE14      --------------------------------------TQQPVAVLGGGSFGTAIANLLAENGHQVLQWM
GPDA_LACRJ      -----------------------------------------KIAVLGAGSWGSVLANMLTENGHDVTLWS
GPDA_LACRD      -----------------------------------------KIAVLGAGSWGSVLANMLTENGHDVTLWS
THI4_PYRIL      ------------------------------------------VAIVGAGPAGLTAARYLAERGHKVVVYE
THI4_DESOH      ------------------------------------------VAVVGGGPSGLVAAWRLARAGRKVALFE
GPDA_AZOVD      ------------------------------------ARQP--IAVLGGGSFGTALANLLAENGHVVRLWM
YOBN_BACSU      ---------------------------------LSASQHPKHILVIGAGMSGLVSASLLKNAGHRVTILE
YGFT_ECOLI      -----------------------------------------KVAVIGAGPAGLGCADILARAGVQVDVFD
TRKA_METTH      ------------------------------------------VVIMGGGRVGLTLANLLISDGHDVTLIE
MNMC_BURS3      ------------------------WRARRHEPPLALPVATRRAIVIGAGLAGCAVVERLAARGWEVTLIE
GPDA_PSEPF      ----------------------------------------RPIAVLGGGSFGTAVANLLAENGHQVRQWM
DUSB_PSEAE      ----------------------------------------------------------------------
CRTN_STAAC      -----------------------------------------KIAVIGAGVTGLAAAARIASQGHEVTIFE
ZDS_SOLLC       ----NRLVTRKSVIRADLDSMVSDMSTNAPKGLFPPERGPKKVAIIGAGLAGMSTAVELLDQGHEVDIYE
GPDA_GEOSL      -----------------------------------------RIGVIGAGSWGTTLANLLARKGLDVTLWA
GPDA_GEOMG      -----------------------------------------KIGVIGAGSWGTTLANLLAKKGLDVTLWA
MNMC_BURVG      -----------------FAMLVGEYAPRRMRRHEPPRALPREAIVIGAGLAGCALVERLAARGWHVTLIE
MNMC_BURCC      ALGETGFTFREVDDRL-----VGDYAPRWRARRHEPPRTTRRAIVIGAGLAGCAVVERLAARGWDVTLIE
GPDA_PSEF5      ----------------------------------------RPIAVLGGGSFGTAVANLLAENGHRVRQWM
GPDA_PELCD      --------------------------------------------VIGAGSWGTTLADLLSKNGHAVTLWA
DPYD_BOVIN      ----------------------------------PPEKMPEKIALLGAGPASISCASFLARLGYDITIFE
THI4_METAC      ------------------------------------------VALVGGGPANLVAAKYLAEAGVKVALYE
GPDA_SYNR3      --------------------------------------------VLGGGAWGSTLAGLLSQGGHRVQIWR
GPDA_PSEFS      ----------------------------------------RPIAVLGGGSFGTAVANLLAENGHAVRQWM
GPDA_PSEE4      ------------------------------------------VAVLGGGSFGTAVANLLAENGHPVRQWM
ZDS_SYNY3       -----------------------------------------RVAIVGAGLAGMATAVELVDAGHEVELYE
THI4_METMA      ------------------------------------------VALVGGGPANLVAAKYLAEAGAKVAIYE
GPDA_PARL1      ----------------------------------------RKIAVVGAGAWGTALAQVAASAGREVVLWA
GPDA_LACF3      ----------------------------------------KKVAVLGAGSWGSVLANLLVENGHQVMLWS
ZDS_NARPS       -------------------------------GLFPPERGPKKVAIIGAGLAGMSTAVELLDQGHEVDIYE
THI4_METBF      ------------------------------------------VALIGGGPANLVAARYLAEAGAKVAIYE
THI4_HALWD      -------------------------------------RVDTEVIIVGGGPSGLVTAKELAERGVDVTIVE
MERA_BACCE      -------------------------------------KVPNRLTVIGSGYIGMELGQLFHNLGSEVTLIQ
GPDA_LACCB      ---------------------------------------PTKIAVLGAGSWGTVLANLLTENGHEVDLW-
GPDA_LACC3      ---------------------------------------PTKIAVLGAGSWGTVLANLLTENGHEVDLW-
GPDA_DESAD      -----------------------------------------KIAVIGAGAWGTTLANTLAKKGHNTHLWV
FENR_DEIGD      ------------------------------------------ILVIGGGPAGLHAAFYAAWRGLSVRVLE
CRTI_MYXXA      ----------------------------------------RHVIVVGAGPGGLSAAINLAGQGFRVTVVE
MNMC_ACIAD      --------------------------------------TQQHFAVIGAGIAGLHCAWSLAQRGHRVTLVD
KMO_CRYNE       ----------------------------------------RKVLIVGAGPVGALTALSLHRRGWEVEVWE
HIS6_STRAW      ----------------------------------------------------------------------
GPDA_LEPBP      -----------------------------------------KIGIIGAGSFGTALGSILADKGYDVTLWT
GPDA_LEPBA      -----------------------------------------KIGIIGAGSFGTALGSILADKGYDVTLWT
CRTI_ARATH      ----------------------------------PRPAKPLKVVIAGAGLAGLSTAKYLADAGHKPLLLE
ZDS_MAIZE       -----------------------------------------KVAIIGAGLAGMSTAVELLDQGHEVDLYE
ZDS_ARATH       --------------------------------PVPYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYD
THI4_DESMR      ------------------------------------------VAIVGGGPSGMTAARLLAADGFNVALFE
MNMC_BURA4      ----------------------------------PPRALPREAIVIGAGLAGCAVVERLAARGWNITLIE
GLTD_ECOLI      -------------------------------------QTGKKVAIIGAGPAGLACADVLTRNGVKAVVFD
GGR_METMA       ------------------------------------------VLVIGAGPAGSIAAKTAAEKGLDVLLIE
GGR_METBF       ------------------------------------------VLVIGAGPAGSIAARTAAEKGLDVLLIE
GGR_METAC       ------------------------------------------VLVIGAGPAGSIAAKTAAEKGLDVLLIE
DUSC_RALEH      ----------------------------------------------------------------------
DUSB_XANAC      ----------------------------------------------------------------------
DUSB_ERWCA      ----------------------------------------------------------------------
CRTI_SYNE7      -----------------------------------------RVAIAGAGLAGLSCAKYLADAGHTPIVYE
CATB_RHOOP      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           REEQLGGQMRIXXXXXXXXXYHDFVTWQEGRLRRAGVTVELGRTATVDNVLSFXXXXXXXXXXXXPRRLP
STCD_RHIME      AASDPGGQVRLTAQSPRRREMISIIDWRMSQCEKLGVTFHFNTWAEAEAIQAESPDVVIIATGGLP-HTE
NADO_THEBR      KKQHLGGQLEIASASPGKAKIKWFRDWLEAELSRAGVEVRSGVTADAETIAALSPDYVILATGSEPVTPR
DHTM_METME      TAEKIGGQVAALPGLGEWSYHRDYRETQITKLLKKNKESQLAKPMTADDVLQYTGARWNTDGTNCLTHDP
BAIH_EUBSP      ADDKIGGQLNLAVVAPGKQEMTQWMVHLNYRAKKAGVKFEFNKEATAEDVKALAPEAVIVATGAKPLVPP
FADH_ECOLI      AHSEIGGQFNIAKQIPGKEEFYETLRYYRRMIEVTGVTLKLNHTVTADQLQAF--DETILASGIVPRTPP
BAICD_EUBSP     ASDKLAGQFRLAGVAPMKQDWADVAEWEAKEVERLGIEVRLNTEVTAETIKEFNPDNVIIAVGSTYALPE
DHDM_HYPSX      TREKTGGDVATLPGLGEWSFHRDYRQTQLEKLLKKNPECQIAKPMTADDILQYTGAKWSTTGVNHRTHEP
NAMA_BACSU      ----------------------------------------------------------------------
NAMA_GEOKA      ----------------------------------------------------------------------
NAMA_BACA2      ----------------------------------------------------------------------
NAMA_BACHD      ----------------------------------------------------------------------
NAMA_GEOSW      ----------------------------------------------------------------------
NAMA_GEOTN      ----------------------------------------------------------------------
NEMA_ECOLI      ----------------------------------------------------------------------
NAMA_BACLD      ----------------------------------------------------------------------
OYE2_YEAST      ----------------------------------------------------------------------
OYE3_YEAST      ----------------------------------------------------------------------
NAMA_LISW6      ----------------------------------------------------------------------
OYE1_SACPS      ----------------------------------------------------------------------
OPR3_SOLLC      ----------------------------------------------------------------------
OPR3_ARATH      ----------------------------------------------------------------------
NAMA_CLOAB      ----------------------------------------------------------------------
OPR1_ARATH      ----------------------------------------------------------------------
OPRL1_ARATH     ----------------------------------------------------------------------
NAMA_BACP2      ----------------------------------------------------------------------
YQIG_BACSU      ----------------------------------------------------------------------
NAMA_BACWK      ----------------------------------------------------------------------
NAMA_BACCN      ----------------------------------------------------------------------
NAMA_LISMF      ----------------------------------------------------------------------
NAMA_LISMC      ----------------------------------------------------------------------
NAMA_LISIN      ----------------------------------------------------------------------
NAMA_BACC2      ----------------------------------------------------------------------
NAMA_BACC0      ----------------------------------------------------------------------
OPR1_SOLLC      ----------------------------------------------------------------------
NAMA_BACCZ      ----------------------------------------------------------------------
OPR2_ARATH      ----------------------------------------------------------------------
NAMA_LISMH      ----------------------------------------------------------------------
NAMA_BACC3      ----------------------------------------------------------------------
NAMA_BACAH      ----------------------------------------------------------------------
NAMA_LISMO      ----------------------------------------------------------------------
NAMA_BACAN      ----------------------------------------------------------------------
NAMA_BACAC      ----------------------------------------------------------------------
NAMA_BACAA      ----------------------------------------------------------------------
NAMA_BACHK      ----------------------------------------------------------------------
NAMA_BACCR      ----------------------------------------------------------------------
NAMA_BACC4      ----------------------------------------------------------------------
NAMA_BACC1      ----------------------------------------------------------------------
KYE1_KLULA      ----------------------------------------------------------------------
OYEC_SCHPO      ----------------------------------------------------------------------
NAMA_BACCQ      ----------------------------------------------------------------------
NAMA_BACC7      ----------------------------------------------------------------------
OPRL2_ARATH     ----------------------------------------------------------------------
OPRL_SOLLC      ----------------------------------------------------------------------
EBP1_CANAL      ----------------------------------------------------------------------
GLT1_SCHPO      RADRPGGLLQ------------------------------------------------------------
OYEB_SCHPO      ----------------------------------------------------------------------
GLSN_MEDSA      RADRIGGLM-------------------------------------------------------------
GLT1_YEAST      RSDRCGGLLMYGIPNMKLD--KAIVQRRIDLLSAEGINTEIGKTISMDELKNKHNAVVYAIGSTIPRDLP
YEIT_ECO57      KEAHPGGWLR--NGIPQFRLPQSVLDAEIARIEKMGVTIEIGKTLTLEQL--------------------
OXLA_CROAT      ASERVGGRVR------------------------------------------------------------
OXLA_CROAD      ASERVGGRVR------------------------------------------------------------
GLTB_BACSU      RADRAGG---------------------------------------------------------------
YEIT_ECOLI      KEAHPGGWLR--NGIPQFRLPQSVLDAEIARIEKMGVTIEVGNTLTLEQL--------------------
OXLA_PSEAU      ASERVGGRV-------------------------------------------------------------
OXLA_BOTJR      ASERAGGQVK------------------------------------------------------------
OXLA_BOTMO      ASERAGGRVK------------------------------------------------------------
OYEA_SCHPO      ----------------------------------------------------------------------
OXLA_TRIST      ASERAGGRVR------------------------------------------------------------
OXLA_OXYSC      ASERVGGRV-------------------------------------------------------------
YEIT_SALTY      KQPQPGGWLR------------------------------------------------------------
YEIT_SALTI      KQPQPGGWLR------------------------------------------------------------
OXLA_NOTSC      ASERVGGRV-------------------------------------------------------------
OXLA_DEMVE      ASERVGGRV-------------------------------------------------------------
OXLA_AGKRH      ASERPGGRVR------------------------------------------------------------
GPDA_GEOSM      YEPELVLEMR------------------------------------------------------------
GPDA_GEOBB      YEPELVLEMR------------------------------------------------------------
YR656_MIMIV     RESVVGG---------------------------------------------------------------
OXLA_AGKHP      ASERAGGRVR------------------------------------------------------------
MNMC_ACIBC      RTVPLSG---------------------------------------------------------------
YGFK_ECOLI      REANAGGVVK------------------------------------------------------------
YGFK_ECO57      REANAGGVVK------------------------------------------------------------
OXLA_AGKHA      ASERAGGRVR------------------------------------------------------------
MNMC_LEGPL      EKEKVG----------------------------------------------------------------
MNMC_LEGPH      EKEKVG----------------------------------------------------------------
MNMC_LEGPC      EKEKVG----------------------------------------------------------------
MNMC_LEGPA      EKEKVG----------------------------------------------------------------
GSOX3_ARATH     REKQVGG---------------------------------------------------------------
GPDA_PSEMY      RDPEQAGQMR------------------------------------------------------------
AEGA_ECOLI      RHPEIGGLLTFGIPSFKLD--KSLLARRREIFSAMGIHFELGKDVSLDSLLEQYDAVFVGVGTYRSMKAG
MNMC_ACIBT      RTAPLSG---------------------------------------------------------------
CRTN_STAAW      KNNNVGGRM-------------------------------------------------------------
CRTN_STAAS      KNNNVGGRM-------------------------------------------------------------
CRTN_STAAR      KNNNVGGRM-------------------------------------------------------------
CRTN_STAAN      KNNNVGGRM-------------------------------------------------------------
CRTN_STAAM      KNNNVGGRM-------------------------------------------------------------
CRTN_STAAE      KNNNVGGRM-------------------------------------------------------------
CRTN_STAA8      KNNNVGGRM-------------------------------------------------------------
CRTN_STAA3      KNNNVGGRM-------------------------------------------------------------
CRTN_STAAB      KNTNVGGRM-------------------------------------------------------------
HDRA2_METKA     KEPSIGGRM-------------------------------------------------------------
GPDA_PSEU2      RDPEQAEAIRV-----------------------------------------------------------
GPDA_PSESM      RDPEQAEAIRV-----------------------------------------------------------
GPDA_PSE14      RDPEQAQAIRV-----------------------------------------------------------
GPDA_LACRJ      RNEE------------------------------------------------------------------
GPDA_LACRD      RNEE------------------------------------------------------------------
THI4_PYRIL      R---------------------------------------------------------------------
THI4_DESOH      RKLSIGGGM-------------------------------------------------------------
GPDA_AZOVD      RDPEQAEAIR------------------------------------------------------------
YOBN_BACSU      ASGRAGGRV-------------------------------------------------------------
YGFT_ECOLI      RHPEIGGMLTF---GIPPFKLDKTVLSQRREIFTAHLNCEIGRDITFSDLTSEYDAVFIGVGTYGMMRAD
TRKA_METTH      NEETL-----------------------------------------------------------------
MNMC_BURS3      RHDRIASD----ASGNPAGVFHPLMTRDDSRLTRGGFLHAIARWRALEN---------------------
GPDA_PSEPF      RDPEQAEAIRV-----------------------------------------------------------
DUSB_PSEAE      ----------------------------------------------------------------------
CRTN_STAAC      KNNNVGGCM-------------------------------------------------------------
ZDS_SOLLC       SRTFIGGKV-------------------------------------------------------------
GPDA_GEOSL      YEAELVEEMR------------------------------------------------------------
GPDA_GEOMG      YEPELVAEMR------------------------------------------------------------
MNMC_BURVG      RHAQIASE----ASGNPAGVFHPLMTRDDSRLTRSGFLHALARWRALEH---------------------
MNMC_BURCC      RHERIASE--------------------------------------------------------------
GPDA_PSEF5      RDPEQAEAIRV-----------------------------------------------------------
GPDA_PELCD      YEQDLVERMR------------------------------------------------------------
DPYD_BOVIN      KQEYVGGQFRLP---------YDVVNFEIELMKDLGVKIICGKSLSVNDI--------------------
THI4_METAC      QKLSLGGGM-------------------------------------------------------------
GPDA_SYNR3      RE--------------------------------------------------------------------
GPDA_PSEFS      RDPEQAEAIRV-----------------------------------------------------------
GPDA_PSEE4      RDPAQAESMRV-----------------------------------------------------------
ZDS_SYNY3       ARSFIGGKV-------------------------------------------------------------
THI4_METMA      QKLSLGGGM-------------------------------------------------------------
GPDA_PARL1      REDEL-----------------------------------------------------------------
GPDA_LACF3      RNQ-------------------------------------------------------------------
ZDS_NARPS       SRQFIGGKV-------------------------------------------------------------
THI4_METBF      QKLSLGGGM-------------------------------------------------------------
THI4_HALWD      K---------------------------------------------------------------------
MERA_BACCE      RSERL-----------------------------------------------------------------
GPDA_LACCB      ----------------------------------------------------------------------
GPDA_LACC3      ----------------------------------------------------------------------
GPDA_DESAD      REQEL-----------------------------------------------------------------
FENR_DEIGD      ARGEVGGQL-------------------------------------------------------------
CRTI_MYXXA      KDAVPGGRMK------------------------------------------------------------
MNMC_ACIAD      QSQPLSG---------------------------------------------------------------
KMO_CRYNE       TRDDPRGQ--------------------------------------------------------------
HIS6_STRAW      ----------------------------------------------------------------------
GPDA_LEPBP      RSEE------------------------------------------------------------------
GPDA_LEPBA      RSEE------------------------------------------------------------------
CRTI_ARATH      ARDVLGGKI-------------------------------------------------------------
ZDS_MAIZE       SRPFIGGKV-------------------------------------------------------------
ZDS_ARATH       SRTFIGGKV-------------------------------------------------------------
THI4_DESMR      RKLSL-----------------------------------------------------------------
MNMC_BURA4      RHEQIASE----ASGNPAGVFHPLMTRDDSRLTRSGFLHALAR---------------------------
GLTD_ECOLI      RHPEIGG---------------------------------------------------------------
GGR_METMA       KRQEIGDPVR------------------------------------------------------------
GGR_METBF       KRQEIGDPVR------------------------------------------------------------
GGR_METAC       KRQEIGDPVR------------------------------------------------------------
DUSC_RALEH      ----------------------------------------------------------------------
DUSB_XANAC      ----------------------------------------------------------------------
DUSB_ERWCA      ----------------------------------------------------------------------
CRTI_SYNE7      RRDVLGGKV-------------------------------------------------------------
CATB_RHOOP      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           IPGADAPFVVDGHAVLAGTAQIGERVLLTAAEDHMQPLTIAGYLADHGHHVHLVYQTPGPAPLVGKYTIX
STCD_RHIME      VLSRGNELVVSAWDIISGDAKPGTNVLIFDDAGDHXXXXXXXXXXXXXXRVEIMTPDRSFAPEVMAMNLV
NADO_THEBR      IKGAEKTFVFQAWDVLAGKVSFDKDEEXXXXXXXXXXCETAHYLAEKGAKVTIV----------------
DHTM_METME      IPGADAPDQLTPEQVMDGKKKIGKRVVILNADTYFMAPSLAEKLATAGHEVTIV-----SGVHLANYMHF
BAIH_EUBSP      IKGTQDYPVLTAHDFLRGKFVIPKRVCVTALENARPNSYTRGYDASIGDDVTLVEMAPNREPLIRKLKSK
FADH_ECOLI      IDGIDHPKVLSYLDVLRDKAPVGNKVAI------------------------------------------
BAICD_EUBSP     IPGIDSPSVYSQYQVLKGEVNPTGRVAVIGC--GLVGTEVAELLASRGAQV-IAIERKGVGTGLSMLRRM
DHDM_HYPSX      IPGADAPHVLTPEQVYEGKKAVGKRVMIINYDAYYTAPSLAEKFARAGHDVTVA--TVCGLGAYMEYTLE
NAMA_BACSU      ----------------------------------------------------------------------
NAMA_GEOKA      ----------------------------------------------------------------------
NAMA_BACA2      ----------------------------------------------------------------------
NAMA_BACHD      ----------------------------------------------------------------------
NAMA_GEOSW      ----------------------------------------------------------------------
NAMA_GEOTN      ----------------------------------------------------------------------
NEMA_ECOLI      ----------------------------------------------------------------------
NAMA_BACLD      ----------------------------------------------------------------------
OYE2_YEAST      ----------------------------------------------------------------------
OYE3_YEAST      ----------------------------------------------------------------------
NAMA_LISW6      ----------------------------------------------------------------------
OYE1_SACPS      ----------------------------------------------------------------------
OPR3_SOLLC      ----------------------------------------------------------------------
OPR3_ARATH      ----------------------------------------------------------------------
NAMA_CLOAB      ----------------------------------------------------------------------
OPR1_ARATH      ----------------------------------------------------------------------
OPRL1_ARATH     ----------------------------------------------------------------------
NAMA_BACP2      ----------------------------------------------------------------------
YQIG_BACSU      ----------------------------------------------------------------------
NAMA_BACWK      ----------------------------------------------------------------------
NAMA_BACCN      ----------------------------------------------------------------------
NAMA_LISMF      ----------------------------------------------------------------------
NAMA_LISMC      ----------------------------------------------------------------------
NAMA_LISIN      ----------------------------------------------------------------------
NAMA_BACC2      ----------------------------------------------------------------------
NAMA_BACC0      ----------------------------------------------------------------------
OPR1_SOLLC      ----------------------------------------------------------------------
NAMA_BACCZ      ----------------------------------------------------------------------
OPR2_ARATH      ----------------------------------------------------------------------
NAMA_LISMH      ----------------------------------------------------------------------
NAMA_BACC3      ----------------------------------------------------------------------
NAMA_BACAH      ----------------------------------------------------------------------
NAMA_LISMO      ----------------------------------------------------------------------
NAMA_BACAN      ----------------------------------------------------------------------
NAMA_BACAC      ----------------------------------------------------------------------
NAMA_BACAA      ----------------------------------------------------------------------
NAMA_BACHK      ----------------------------------------------------------------------
NAMA_BACCR      ----------------------------------------------------------------------
NAMA_BACC4      ----------------------------------------------------------------------
NAMA_BACC1      ----------------------------------------------------------------------
KYE1_KLULA      ----------------------------------------------------------------------
OYEC_SCHPO      ----------------------------------------------------------------------
NAMA_BACCQ      ----------------------------------------------------------------------
NAMA_BACC7      ----------------------------------------------------------------------
OPRL2_ARATH     ----------------------------------------------------------------------
OPRL_SOLLC      ----------------------------------------------------------------------
EBP1_CANAL      ----------------------------------------------------------------------
GLT1_SCHPO      ----------------------------------------------------------------------
OYEB_SCHPO      ----------------------------------------------------------------------
GLSN_MEDSA      ----------------------------------------------------------------------
GLT1_YEAST      IKGRE-----------------------------------------------------------------
YEIT_ECO57      ----------------------------------------------------------------------
OXLA_CROAT      ----------------------------------------------------------------------
OXLA_CROAD      ----------------------------------------------------------------------
GLTB_BACSU      ----------------------------------------------------------------------
YEIT_ECOLI      ----------------------------------------------------------------------
OXLA_PSEAU      ----------------------------------------------------------------------
OXLA_BOTJR      ----------------------------------------------------------------------
OXLA_BOTMO      ----------------------------------------------------------------------
OYEA_SCHPO      ----------------------------------------------------------------------
OXLA_TRIST      ----------------------------------------------------------------------
OXLA_OXYSC      ----------------------------------------------------------------------
YEIT_SALTY      ----------------------------------------------------------------------
YEIT_SALTI      ----------------------------------------------------------------------
OXLA_NOTSC      ----------------------------------------------------------------------
OXLA_DEMVE      ----------------------------------------------------------------------
OXLA_AGKRH      ----------------------------------------------------------------------
GPDA_GEOSM      ----------------------------------------------------------------------
GPDA_GEOBB      ----------------------------------------------------------------------
YR656_MIMIV     ----------------------------------------------------------------------
OXLA_AGKHP      ----------------------------------------------------------------------
MNMC_ACIBC      ----------------------------------------------------------------------
YGFK_ECOLI      ----------------------------------------------------------------------
YGFK_ECO57      ----------------------------------------------------------------------
OXLA_AGKHA      ----------------------------------------------------------------------
MNMC_LEGPL      ----------------------------------------------------------------------
MNMC_LEGPH      ----------------------------------------------------------------------
MNMC_LEGPC      ----------------------------------------------------------------------
MNMC_LEGPA      ----------------------------------------------------------------------
GSOX3_ARATH     ----------------------------------------------------------------------
GPDA_PSEMY      ----------------------------------------------------------------------
AEGA_ECOLI      LPNEDAPGVYDAPFLIANTKQV------------------------------------------------
MNMC_ACIBT      ----------------------------------------------------------------------
CRTN_STAAW      ----------------------------------------------------------------------
CRTN_STAAS      ----------------------------------------------------------------------
CRTN_STAAR      ----------------------------------------------------------------------
CRTN_STAAN      ----------------------------------------------------------------------
CRTN_STAAM      ----------------------------------------------------------------------
CRTN_STAAE      ----------------------------------------------------------------------
CRTN_STAA8      ----------------------------------------------------------------------
CRTN_STAA3      ----------------------------------------------------------------------
CRTN_STAAB      ----------------------------------------------------------------------
HDRA2_METKA     ----------------------------------------------------------------------
GPDA_PSEU2      ----------------------------------------------------------------------
GPDA_PSESM      ----------------------------------------------------------------------
GPDA_PSE14      ----------------------------------------------------------------------
GPDA_LACRJ      ----------------------------------------------------------------------
GPDA_LACRD      ----------------------------------------------------------------------
THI4_PYRIL      ----------------------------------------------------------------------
THI4_DESOH      ----------------------------------------------------------------------
GPDA_AZOVD      ----------------------------------------------------------------------
YOBN_BACSU      ----------------------------------------------------------------------
YGFT_ECOLI      LPHEDAPGVIQALPFLTAHT----RQLMGLPESEEYPLT-------------------------------
TRKA_METTH      ----------------------------------------------------------------------
MNMC_BURS3      ----------------------------------------------------------------------
GPDA_PSEPF      ----------------------------------------------------------------------
DUSB_PSEAE      ----------------------------------------------------------------------
CRTN_STAAC      ----------------------------------------------------------------------
ZDS_SOLLC       ----------------------------------------------------------------------
GPDA_GEOSL      ----------------------------------------------------------------------
GPDA_GEOMG      ----------------------------------------------------------------------
MNMC_BURVG      ----------------------------------------------------------------------
MNMC_BURCC      ----------------------------------------------------------------------
GPDA_PSEF5      ----------------------------------------------------------------------
GPDA_PELCD      ----------------------------------------------------------------------
DPYD_BOVIN      ----------------------------------------------------------------------
THI4_METAC      ----------------------------------------------------------------------
GPDA_SYNR3      ----------------------------------------------------------------------
GPDA_PSEFS      ----------------------------------------------------------------------
GPDA_PSEE4      ----------------------------------------------------------------------
ZDS_SYNY3       ----------------------------------------------------------------------
THI4_METMA      ----------------------------------------------------------------------
GPDA_PARL1      ----------------------------------------------------------------------
GPDA_LACF3      ----------------------------------------------------------------------
ZDS_NARPS       ----------------------------------------------------------------------
THI4_METBF      ----------------------------------------------------------------------
THI4_HALWD      ----------------------------------------------------------------------
MERA_BACCE      ----------------------------------------------------------------------
GPDA_LACCB      ----------------------------------------------------------------------
GPDA_LACC3      ----------------------------------------------------------------------
GPDA_DESAD      ----------------------------------------------------------------------
FENR_DEIGD      ----------------------------------------------------------------------
CRTI_MYXXA      ----------------------------------------------------------------------
MNMC_ACIAD      ----------------------------------------------------------------------
KMO_CRYNE       ----------------------------------------------------------------------
HIS6_STRAW      ----------------------------------------------------------------------
GPDA_LEPBP      ----------------------------------------------------------------------
GPDA_LEPBA      ----------------------------------------------------------------------
CRTI_ARATH      ----------------------------------------------------------------------
ZDS_MAIZE       ----------------------------------------------------------------------
ZDS_ARATH       ----------------------------------------------------------------------
THI4_DESMR      ----------------------------------------------------------------------
MNMC_BURA4      ----------------------------------------------------------------------
GLTD_ECOLI      ----------------------------------------------------------------------
GGR_METMA       ----------------------------------------------------------------------
GGR_METBF       ----------------------------------------------------------------------
GGR_METAC       ----------------------------------------------------------------------
DUSC_RALEH      ----------------------------------------------------------------------
DUSB_XANAC      ----------------------------------------------------------------------
DUSB_ERWCA      ----------------------------------------------------------------------
CRTI_SYNE7      ----------------------------------------------------------------------
CATB_RHOOP      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           XXXXXXXXXXXXXXXMQRVVQIEEGRVATRNIYSDIPGEITGFDSVVVAAGGVPDDSLYHELKRHGKANV
STCD_RHIME      PYMRCLQKLDVTFTVTYRLEAVEKGNELVAHVGSDYGGKQRTFDQVVVNHGTIPLDELYFELK-------
NADO_THEBR      ----------------------------------------------------------------------
DHTM_METME      TLEYPNMMRRLHELHVEELSRIEPGRMEIYNIWGDGPGRWIEFDSLVLVTGRHSECTLWNELKENDIKGI
BAIH_EUBSP      GVHINVNTKIMEVTDHEVKVQRQDGTQEW----------LEGFDYVLFGLGSRNYDPLSETLKEF-VPEV
FADH_ECOLI      ----------------------------------------------------------------------
BAICD_EUBSP     FMNPEFKYYKIAKMSGTNVTALEQGKVMTDKKTKEVTQGVLECDATVICTGARPSDGLKARCEELG-IPV
DHDM_HYPSX      GANMQRLIHELGIKVLGETSRVEQGRVELFNIWGELPNENTSHDTVILVTSRRSEDTLYRELKANGITNV
NAMA_BACSU      ----------------------------------------------------------------------
NAMA_GEOKA      ----------------------------------------------------------------------
NAMA_BACA2      ----------------------------------------------------------------------
NAMA_BACHD      ----------------------------------------------------------------------
NAMA_GEOSW      ----------------------------------------------------------------------
NAMA_GEOTN      ----------------------------------------------------------------------
NEMA_ECOLI      ----------------------------------------------------------------------
NAMA_BACLD      ----------------------------------------------------------------------
OYE2_YEAST      ----------------------------------------------------------------------
OYE3_YEAST      ----------------------------------------------------------------------
NAMA_LISW6      ----------------------------------------------------------------------
OYE1_SACPS      ----------------------------------------------------------------------
OPR3_SOLLC      ----------------------------------------------------------------------
OPR3_ARATH      ----------------------------------------------------------------------
NAMA_CLOAB      ----------------------------------------------------------------------
OPR1_ARATH      ----------------------------------------------------------------------
OPRL1_ARATH     ----------------------------------------------------------------------
NAMA_BACP2      ----------------------------------------------------------------------
YQIG_BACSU      ----------------------------------------------------------------------
NAMA_BACWK      ----------------------------------------------------------------------
NAMA_BACCN      ----------------------------------------------------------------------
NAMA_LISMF      ----------------------------------------------------------------------
NAMA_LISMC      ----------------------------------------------------------------------
NAMA_LISIN      ----------------------------------------------------------------------
NAMA_BACC2      ----------------------------------------------------------------------
NAMA_BACC0      ----------------------------------------------------------------------
OPR1_SOLLC      ----------------------------------------------------------------------
NAMA_BACCZ      ----------------------------------------------------------------------
OPR2_ARATH      ----------------------------------------------------------------------
NAMA_LISMH      ----------------------------------------------------------------------
NAMA_BACC3      ----------------------------------------------------------------------
NAMA_BACAH      ----------------------------------------------------------------------
NAMA_LISMO      ----------------------------------------------------------------------
NAMA_BACAN      ----------------------------------------------------------------------
NAMA_BACAC      ----------------------------------------------------------------------
NAMA_BACAA      ----------------------------------------------------------------------
NAMA_BACHK      ----------------------------------------------------------------------
NAMA_BACCR      ----------------------------------------------------------------------
NAMA_BACC4      ----------------------------------------------------------------------
NAMA_BACC1      ----------------------------------------------------------------------
KYE1_KLULA      ----------------------------------------------------------------------
OYEC_SCHPO      ----------------------------------------------------------------------
NAMA_BACCQ      ----------------------------------------------------------------------
NAMA_BACC7      ----------------------------------------------------------------------
OPRL2_ARATH     ----------------------------------------------------------------------
OPRL_SOLLC      ----------------------------------------------------------------------
EBP1_CANAL      ----------------------------------------------------------------------
GLT1_SCHPO      ----------------------------------------------------------------------
OYEB_SCHPO      ----------------------------------------------------------------------
GLSN_MEDSA      ----------------------------------------------------------------------
GLT1_YEAST      ----------------------------------------------------------------------
YEIT_ECO57      ----------------------------------------------------------------------
OXLA_CROAT      ----------------------------------------------------------------------
OXLA_CROAD      ----------------------------------------------------------------------
GLTB_BACSU      ----------------------------------------------------------------------
YEIT_ECOLI      ----------------------------------------------------------------------
OXLA_PSEAU      ----------------------------------------------------------------------
OXLA_BOTJR      ----------------------------------------------------------------------
OXLA_BOTMO      ----------------------------------------------------------------------
OYEA_SCHPO      ----------------------------------------------------------------------
OXLA_TRIST      ----------------------------------------------------------------------
OXLA_OXYSC      ----------------------------------------------------------------------
YEIT_SALTY      ----------------------------------------------------------------------
YEIT_SALTI      ----------------------------------------------------------------------
OXLA_NOTSC      ----------------------------------------------------------------------
OXLA_DEMVE      ----------------------------------------------------------------------
OXLA_AGKRH      ----------------------------------------------------------------------
GPDA_GEOSM      ----------------------------------------------------------------------
GPDA_GEOBB      ----------------------------------------------------------------------
YR656_MIMIV     ----------------------------------------------------------------------
OXLA_AGKHP      ----------------------------------------------------------------------
MNMC_ACIBC      ----------------------------------------------------------------------
YGFK_ECOLI      ----------------------------------------------------------------------
YGFK_ECO57      ----------------------------------------------------------------------
OXLA_AGKHA      ----------------------------------------------------------------------
MNMC_LEGPL      ----------------------------------------------------------------------
MNMC_LEGPH      ----------------------------------------------------------------------
MNMC_LEGPC      ----------------------------------------------------------------------
MNMC_LEGPA      ----------------------------------------------------------------------
GSOX3_ARATH     ----------------------------------------------------------------------
GPDA_PSEMY      ----------------------------------------------------------------------
AEGA_ECOLI      ----------------------------------------------------------------------
MNMC_ACIBT      ----------------------------------------------------------------------
CRTN_STAAW      ----------------------------------------------------------------------
CRTN_STAAS      ----------------------------------------------------------------------
CRTN_STAAR      ----------------------------------------------------------------------
CRTN_STAAN      ----------------------------------------------------------------------
CRTN_STAAM      ----------------------------------------------------------------------
CRTN_STAAE      ----------------------------------------------------------------------
CRTN_STAA8      ----------------------------------------------------------------------
CRTN_STAA3      ----------------------------------------------------------------------
CRTN_STAAB      ----------------------------------------------------------------------
HDRA2_METKA     ----------------------------------------------------------------------
GPDA_PSEU2      ----------------------------------------------------------------------
GPDA_PSESM      ----------------------------------------------------------------------
GPDA_PSE14      ----------------------------------------------------------------------
GPDA_LACRJ      ----------------------------------------------------------------------
GPDA_LACRD      ----------------------------------------------------------------------
THI4_PYRIL      ----------------------------------------------------------------------
THI4_DESOH      ----------------------------------------------------------------------
GPDA_AZOVD      ----------------------------------------------------------------------
YOBN_BACSU      ----------------------------------------------------------------------
YGFT_ECOLI      ----------------------------------------------------------------------
TRKA_METTH      ----------------------------------------------------------------------
MNMC_BURS3      ----------------------------------------------------------------------
GPDA_PSEPF      ----------------------------------------------------------------------
DUSB_PSEAE      ----------------------------------------------------------------------
CRTN_STAAC      ----------------------------------------------------------------------
ZDS_SOLLC       ----------------------------------------------------------------------
GPDA_GEOSL      ----------------------------------------------------------------------
GPDA_GEOMG      ----------------------------------------------------------------------
MNMC_BURVG      ----------------------------------------------------------------------
MNMC_BURCC      ----------------------------------------------------------------------
GPDA_PSEF5      ----------------------------------------------------------------------
GPDA_PELCD      ----------------------------------------------------------------------
DPYD_BOVIN      ----------------------------------------------------------------------
THI4_METAC      ----------------------------------------------------------------------
GPDA_SYNR3      ----------------------------------------------------------------------
GPDA_PSEFS      ----------------------------------------------------------------------
GPDA_PSEE4      ----------------------------------------------------------------------
ZDS_SYNY3       ----------------------------------------------------------------------
THI4_METMA      ----------------------------------------------------------------------
GPDA_PARL1      ----------------------------------------------------------------------
GPDA_LACF3      ----------------------------------------------------------------------
ZDS_NARPS       ----------------------------------------------------------------------
THI4_METBF      ----------------------------------------------------------------------
THI4_HALWD      ----------------------------------------------------------------------
MERA_BACCE      ----------------------------------------------------------------------
GPDA_LACCB      ----------------------------------------------------------------------
GPDA_LACC3      ----------------------------------------------------------------------
GPDA_DESAD      ----------------------------------------------------------------------
FENR_DEIGD      ----------------------------------------------------------------------
CRTI_MYXXA      ----------------------------------------------------------------------
MNMC_ACIAD      ----------------------------------------------------------------------
KMO_CRYNE       ----------------------------------------------------------------------
HIS6_STRAW      ----------------------------------------------------------------------
GPDA_LEPBP      ----------------------------------------------------------------------
GPDA_LEPBA      ----------------------------------------------------------------------
CRTI_ARATH      ----------------------------------------------------------------------
ZDS_MAIZE       ----------------------------------------------------------------------
ZDS_ARATH       ----------------------------------------------------------------------
THI4_DESMR      ----------------------------------------------------------------------
MNMC_BURA4      ----------------------------------------------------------------------
GLTD_ECOLI      ----------------------------------------------------------------------
GGR_METMA       ----------------------------------------------------------------------
GGR_METBF       ----------------------------------------------------------------------
GGR_METAC       ----------------------------------------------------------------------
DUSC_RALEH      ----------------------------------------------------------------------
DUSB_XANAC      ----------------------------------------------------------------------
DUSB_ERWCA      ----------------------------------------------------------------------
CRTI_SYNE7      ----------------------------------------------------------------------
CATB_RHOOP      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           HLLGDAYAPRRITFATQQAYALAxxx
STCD_RHIME      --------------------------
NADO_THEBR      --------------------------
DHTM_METME      YLIGDAEAPRLIADATFTGHRVA---
BAIH_EUBSP      HVIGDAVRARQASYAMEKAYSL----
FADH_ECOLI      --------------------------
BAICD_EUBSP     EVIGDAAGARDCTIATREGY------
DHDM_HYPSX      FVIGDAESPRIIADATFDGHRLA---
NAMA_BACSU      --------------------------
NAMA_GEOKA      --------------------------
NAMA_BACA2      --------------------------
NAMA_BACHD      --------------------------
NAMA_GEOSW      --------------------------
NAMA_GEOTN      --------------------------
NEMA_ECOLI      --------------------------
NAMA_BACLD      --------------------------
OYE2_YEAST      --------------------------
OYE3_YEAST      --------------------------
NAMA_LISW6      --------------------------
OYE1_SACPS      --------------------------
OPR3_SOLLC      --------------------------
OPR3_ARATH      --------------------------
NAMA_CLOAB      --------------------------
OPR1_ARATH      --------------------------
OPRL1_ARATH     --------------------------
NAMA_BACP2      --------------------------
YQIG_BACSU      --------------------------
NAMA_BACWK      --------------------------
NAMA_BACCN      --------------------------
NAMA_LISMF      --------------------------
NAMA_LISMC      --------------------------
NAMA_LISIN      --------------------------
NAMA_BACC2      --------------------------
NAMA_BACC0      --------------------------
OPR1_SOLLC      --------------------------
NAMA_BACCZ      --------------------------
OPR2_ARATH      --------------------------
NAMA_LISMH      --------------------------
NAMA_BACC3      --------------------------
NAMA_BACAH      --------------------------
NAMA_LISMO      --------------------------
NAMA_BACAN      --------------------------
NAMA_BACAC      --------------------------
NAMA_BACAA      --------------------------
NAMA_BACHK      --------------------------
NAMA_BACCR      --------------------------
NAMA_BACC4      --------------------------
NAMA_BACC1      --------------------------
KYE1_KLULA      --------------------------
OYEC_SCHPO      --------------------------
NAMA_BACCQ      --------------------------
NAMA_BACC7      --------------------------
OPRL2_ARATH     --------------------------
OPRL_SOLLC      --------------------------
EBP1_CANAL      --------------------------
GLT1_SCHPO      --------------------------
OYEB_SCHPO      --------------------------
GLSN_MEDSA      --------------------------
GLT1_YEAST      --------------------------
YEIT_ECO57      --------------------------
OXLA_CROAT      --------------------------
OXLA_CROAD      --------------------------
GLTB_BACSU      --------------------------
YEIT_ECOLI      --------------------------
OXLA_PSEAU      --------------------------
OXLA_BOTJR      --------------------------
OXLA_BOTMO      --------------------------
OYEA_SCHPO      --------------------------
OXLA_TRIST      --------------------------
OXLA_OXYSC      --------------------------
YEIT_SALTY      --------------------------
YEIT_SALTI      --------------------------
OXLA_NOTSC      --------------------------
OXLA_DEMVE      --------------------------
OXLA_AGKRH      --------------------------
GPDA_GEOSM      --------------------------
GPDA_GEOBB      --------------------------
YR656_MIMIV     --------------------------
OXLA_AGKHP      --------------------------
MNMC_ACIBC      --------------------------
YGFK_ECOLI      --------------------------
YGFK_ECO57      --------------------------
OXLA_AGKHA      --------------------------
MNMC_LEGPL      --------------------------
MNMC_LEGPH      --------------------------
MNMC_LEGPC      --------------------------
MNMC_LEGPA      --------------------------
GSOX3_ARATH     --------------------------
GPDA_PSEMY      --------------------------
AEGA_ECOLI      --------------------------
MNMC_ACIBT      --------------------------
CRTN_STAAW      --------------------------
CRTN_STAAS      --------------------------
CRTN_STAAR      --------------------------
CRTN_STAAN      --------------------------
CRTN_STAAM      --------------------------
CRTN_STAAE      --------------------------
CRTN_STAA8      --------------------------
CRTN_STAA3      --------------------------
CRTN_STAAB      --------------------------
HDRA2_METKA     --------------------------
GPDA_PSEU2      --------------------------
GPDA_PSESM      --------------------------
GPDA_PSE14      --------------------------
GPDA_LACRJ      --------------------------
GPDA_LACRD      --------------------------
THI4_PYRIL      --------------------------
THI4_DESOH      --------------------------
GPDA_AZOVD      --------------------------
YOBN_BACSU      --------------------------
YGFT_ECOLI      --------------------------
TRKA_METTH      --------------------------
MNMC_BURS3      --------------------------
GPDA_PSEPF      --------------------------
DUSB_PSEAE      --------------------------
CRTN_STAAC      --------------------------
ZDS_SOLLC       --------------------------
GPDA_GEOSL      --------------------------
GPDA_GEOMG      --------------------------
MNMC_BURVG      --------------------------
MNMC_BURCC      --------------------------
GPDA_PSEF5      --------------------------
GPDA_PELCD      --------------------------
DPYD_BOVIN      --------------------------
THI4_METAC      --------------------------
GPDA_SYNR3      --------------------------
GPDA_PSEFS      --------------------------
GPDA_PSEE4      --------------------------
ZDS_SYNY3       --------------------------
THI4_METMA      --------------------------
GPDA_PARL1      --------------------------
GPDA_LACF3      --------------------------
ZDS_NARPS       --------------------------
THI4_METBF      --------------------------
THI4_HALWD      --------------------------
MERA_BACCE      --------------------------
GPDA_LACCB      --------------------------
GPDA_LACC3      --------------------------
GPDA_DESAD      --------------------------
FENR_DEIGD      --------------------------
CRTI_MYXXA      --------------------------
MNMC_ACIAD      --------------------------
KMO_CRYNE       --------------------------
HIS6_STRAW      --------------------------
GPDA_LEPBP      --------------------------
GPDA_LEPBA      --------------------------
CRTI_ARATH      --------------------------
ZDS_MAIZE       --------------------------
ZDS_ARATH       --------------------------
THI4_DESMR      --------------------------
MNMC_BURA4      --------------------------
GLTD_ECOLI      --------------------------
GGR_METMA       --------------------------
GGR_METBF       --------------------------
GGR_METAC       --------------------------
DUSC_RALEH      --------------------------
DUSB_XANAC      --------------------------
DUSB_ERWCA      --------------------------
CRTI_SYNE7      --------------------------
CATB_RHOOP      --------------------------