[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ55595.1

[Show Plain Result]


## Summary of Sequence Search
    1::253
  664::919     4e-54  47%  926 aa  UVRA_AQUAE RecName: Full=UvrABC system protein A;       
  687::938     1e-52  47%  952 aa  UVRA_THET8 RecName: Full=UvrABC system protein A;       
  683::934     4e-52  46%  957 aa  UVRA_BACHD RecName: Full=UvrABC system protein A;       
  684::939     2e-51  44%  939 aa  UVRA_CLOPE RecName: Full=UvrABC system protein A;       
  696::953     6e-51  47%  969 aa  UVRA_MYCLE RecName: Full=UvrABC system protein A;       
  686::938     8e-51  45%  987 aa  UVRA_XANAC RecName: Full=UvrABC system protein A;       
  686::938     2e-50  44%  988 aa  UVRA_XANCP RecName: Full=UvrABC system protein A;       
  693::945     2e-50  46%  962 aa  UVRA_METTH RecName: Full=UvrABC system protein A;       
  661::912     3e-50  45%  916 aa  UVRA_THEMA RecName: Full=UvrABC system protein A;       
  713::965     7e-50  44%  970 aa  UVRA_SYNY3 RecName: Full=UvrABC system protein A;       
  685::936     5e-48  42%  945 aa  UVRA_PSEAE RecName: Full=UvrABC system protein A;       
  683::934     1e-47  42%  957 aa  UVRA_BACSU RecName: Full=UvrABC system protein A;       
  683::936     2e-47  42%  958 aa  UVRA_OCEIH RecName: Full=UvrABC system protein A;       
  682::933     2e-47  42%  948 aa  UVRA_LEPIN RecName: Full=UvrABC system protein A;       
  682::933     2e-47  42%  948 aa  UVRA_LEPIC RecName: Full=UvrABC system protein A;       
  684::935     2e-47  42%  939 aa  UVRA_CLOAB RecName: Full=UvrABC system protein A;       
  684::935     2e-47  41%  944 aa  UVRA_PSEPK RecName: Full=UvrABC system protein A;       
  697::952     1e-46  41%  953 aa  UVRA_RICBR RecName: Full=UvrABC system protein A;       
  699::954     3e-46  41%  955 aa  UVRA_RICCN RecName: Full=UvrABC system protein A;       
  699::954     3e-46  41%  955 aa  UVRA_RICFE RecName: Full=UvrABC system protein A;       
  685::936     4e-46  41%  942 aa  UVRA_STRP1 RecName: Full=UvrABC system protein A;       
  684::940     6e-46  43%  943 aa  UVRA_UREPA RecName: Full=UvrABC system protein A;       
  706::959     1e-45  42%  973 aa  UVRA_RHIME RecName: Full=UvrABC system protein A;       
  685::936     3e-45  41%  942 aa  UVRA_STRP6 RecName: Full=UvrABC system protein A;       
  697::952     3e-45  46%  953 aa  UVRA_RICTY RecName: Full=UvrABC system protein A;       
  685::936     4e-45  41%  942 aa  UVRA_STRP8 RecName: Full=UvrABC system protein A;       
  685::936     4e-45  41%  942 aa  UVRA_STRP3 RecName: Full=UvrABC system protein A;       
  693::944     6e-45  40%  948 aa  UVRA_NEIMA RecName: Full=UvrABC system protein A;       
  697::952     8e-45  45%  953 aa  UVRA_RICPR RecName: Full=UvrABC system protein A;       
  683::934     8e-45  41%  951 aa  UVRA_LACPL RecName: Full=UvrABC system protein A;       
  693::944     1e-44  40%  949 aa  UVRA_NEIMB RecName: Full=UvrABC system protein A;       
  683::934     1e-44  40%  940 aa  UVRA_LACLA RecName: Full=UvrABC system protein A;       
  689::936     2e-44  41%  948 aa  UVRA_STAAW RecName: Full=UvrABC system protein A;       
  689::936     2e-44  41%  948 aa  UVRA_STAAS RecName: Full=UvrABC system protein A;       
  689::936     2e-44  41%  948 aa  UVRA_STAAR RecName: Full=UvrABC system protein A;       
  689::936     2e-44  41%  948 aa  UVRA_STAAC RecName: Full=UvrABC system protein A;       
  693::944     2e-44  40%  950 aa  UVRA_NEIGO RecName: Full=UvrABC system protein A;       
  685::937     4e-44  43%  965 aa  UVRA_XYLFA RecName: Full=UvrABC system protein A;       
  706::959     4e-44  41%  973 aa  UVRA_RHILO RecName: Full=UvrABC system protein A;       
  685::937     5e-44  43%  965 aa  UVRA_XYLFT RecName: Full=UvrABC system protein A;       
  685::936     5e-44  40%  943 aa  UVRA_STRMU RecName: Full=UvrABC system protein A;       
  698::951     7e-44  44%  972 aa  UVRA_MYCTU RecName: Full=UvrABC system protein A;       
  698::951     7e-44  44%  972 aa  UVRA_MYCBO RecName: Full=UvrABC system protein A;       
  683::935     7e-44  41%  956 aa  UVRA_LISMO RecName: Full=UvrABC system protein A;       
  683::935     7e-44  41%  956 aa  UVRA_LISMF RecName: Full=UvrABC system protein A;       
  683::935     7e-44  41%  956 aa  UVRA_LISIN RecName: Full=UvrABC system protein A;       
  685::936     9e-44  40%  943 aa  UVRA_HAEIN RecName: Full=UvrABC system protein A;       
  684::935     2e-43  42%  940 aa  UVRA_VIBPA RecName: Full=UvrABC system protein A;       
  689::936     3e-43  41%  948 aa  UVRA_STAAN RecName: Full=UvrABC system protein A;       
  689::936     3e-43  41%  948 aa  UVRA_STAAM RecName: Full=UvrABC system protein A;       
  685::936     3e-43  40%  940 aa  UVRA_CLOTE RecName: Full=UvrABC system protein A;       
  695::946     4e-43  40%  950 aa  UVRA_BORBU RecName: Full=UvrABC system protein A;       
  684::935     5e-43  41%  942 aa  UVRA_HAEDU RecName: Full=UvrABC system protein A;       
  689::946     1e-42  40% 1014 aa  UVRA_STRCO RecName: Full=UvrABC system protein A;       
  685::936     1e-42  39%  941 aa  UVRA_SALTY RecName: Full=UvrABC system protein A;       
  685::936     1e-42  39%  941 aa  UVRA_SALTI RecName: Full=UvrABC system protein A;       
  706::959     1e-42  40%  973 aa  UVRA_AGRT5 RecName: Full=UvrABC system protein A;       
  692::936     1e-42  41%  952 aa  UVRA_MYCPE RecName: Full=UvrABC system protein A;       
  691::944     2e-42  42%  948 aa  UVRA_MYCPN RecName: Full=UvrABC system protein A;       
  736::989     2e-42  41%  992 aa  UVRA_MICLU RecName: Full=UvrABC system protein A;       
  689::946     3e-42  40% 1009 aa  UVRA_STRAW RecName: Full=UvrABC system protein A;       
  701::954     4e-42  39%  960 aa  UVRA_TREPA RecName: Full=UvrABC system protein A;       
  723::979     7e-42  38% 1016 aa  UVRA_DEIRA RecName: Full=UvrABC system protein A;       
  684::935     1e-41  40%  940 aa  UVRA_VIBVY RecName: Full=UvrABC system protein A;       
  684::935     1e-41  40%  940 aa  UVRA_VIBVU RecName: Full=UvrABC system protein A;       
  707::960     1e-41  39%  974 aa  UVRA_BRUSU RecName: Full=UvrABC system protein A;       
  707::960     1e-41  39%  974 aa  UVRA_BRUME RecName: Full=UvrABC system protein A;       
  707::960     1e-41  39%  974 aa  UVRA_BRUAB RecName: Full=UvrABC system protein A;       
  707::960     1e-41  39%  974 aa  UVRA_BRUA2 RecName: Full=UvrABC system protein A;       
  720::971     2e-41  43%  991 aa  UVRA_BRAJA RecName: Full=UvrABC system protein A;       
  685::936     3e-41  38%  940 aa  UVRA_ECOL6 RecName: Full=UvrABC system protein A;       
  685::936     4e-41  38%  940 aa  UVRA_SHIFL RecName: Full=UvrABC system protein A;       
  685::936     4e-41  38%  940 aa  UVRA_ECOLI RecName: Full=UvrABC system protein A;       
  685::936     4e-41  38%  940 aa  UVRA_ECO57 RecName: Full=UvrABC system protein A;       
  685::936     6e-41  40%  943 aa  UVRA_PASMU RecName: Full=UvrABC system protein A;       
  685::936     1e-40  40%  943 aa  UVRA_STRR6 RecName: Full=UvrABC system protein A;       
  685::936     1e-40  40%  943 aa  UVRA_STRPN RecName: Full=UvrABC system protein A;       
  689::902     1e-40  45%  944 aa  UVRA_STAEQ RecName: Full=UvrABC system protein A;       
  691::944     2e-40  40%  952 aa  UVRA_MYCGE RecName: Full=UvrABC system protein A;       
  685::936     1e-39  37%  947 aa  UVRA_YERPE RecName: Full=UvrABC system protein A;       
  684::935     2e-39  38%  940 aa  UVRA_VIBCH RecName: Full=UvrABC system protein A;       
  676::931     7e-39  39%  935 aa  UVRA_HELPY RecName: Full=UvrABC system protein A;       
  682::937     7e-39  39%  941 aa  UVRA_HELPJ RecName: Full=UvrABC system protein A;       
  688::907     1e-38  42%  946 aa  UVRA_ZYMMO RecName: Full=UvrABC system protein A;       
  689::940     4e-38  39%  944 aa  UVRA_MYCPU RecName: Full=UvrABC system protein A;       
  304::558     1e-36  37%  569 aa  UVRA_VITST RecName: Full=UvrABC system protein A;       
  664::901     8e-35  39% 1787 aa  UVRA_CHLMU RecName: Full=UvrABC system protein A;       
  689::902     3e-34  41%  944 aa  UVRA_STAES RecName: Full=UvrABC system protein A;       
  664::901     4e-34  40% 1786 aa  UVRA_CHLTR RecName: Full=UvrABC system protein A;       
 1568::1821    5e-28  29% 1826 aa  UVRA_CHLPN RecName: Full=UvrABC system protein A;         Short=UvrA
  596::688     7e-20  42%  689 aa  UVRA_PSELE RecName: Full=UvrABC system protein A;       
  480::573     1e-08  38%  589 aa  MSBA_POLSJ RecName: Full=Lipid A export ATP-binding/permease
  387::470     2e-08  31%  504 aa  RBSA3_RHIME RecName: Full=Ribose import ATP-binding protein rbsA 3;
  474::560     2e-08  40%  575 aa  CYDD_BACSU RecName: Full=ATP-binding/permease protein cydD;
  145::231     3e-08  34%  250 aa  Y035_METJA RecName: Full=Uncharacterized ABC transporter
  471::573     4e-08  33%  589 aa  MSBA_COXBU RecName: Full=Lipid A export ATP-binding/permease
  514::608     4e-08  34%  623 aa  MSBA_BORPE RecName: Full=Lipid A export ATP-binding/permease
  514::608     4e-08  34%  623 aa  MSBA_BORPA RecName: Full=Lipid A export ATP-binding/permease
  514::608     4e-08  34%  623 aa  MSBA_BORBR RecName: Full=Lipid A export ATP-binding/permease
  128::218     4e-08  32%  644 aa  MACB_ALCBS RecName: Full=Macrolide export ATP-binding/permease
  588::696     4e-08  34%  714 aa  ABCB8_DANRE RecName: Full=ATP-binding cassette sub-family B member
  468::570     5e-08  36%  602 aa  NDVA_RHOP2 RecName: Full=Beta-(1-->2)glucan export
  145::234     6e-08  38%  259 aa  PHNC_THIDA RecName: Full=Phosphonates import ATP-binding protein
  480::583     8e-08  33%  590 aa  MSBA_RALEJ RecName: Full=Lipid A export ATP-binding/permease
  126::224     8e-08  33%  647 aa  MACB2_AERHH RecName: Full=Macrolide export ATP-binding/permease
  483::586     1e-07  32%  594 aa  MSBA_RALME RecName: Full=Lipid A export ATP-binding/permease
  485::579     1e-07  34%  601 aa  MSBA_AZOSE RecName: Full=Lipid A export ATP-binding/permease
  126::239     1e-07  35%  650 aa  MACB_RHORT RecName: Full=Macrolide export ATP-binding/permease
  146::232     1e-07  38%  285 aa  CBIO2_LEUMM RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  125::219     1e-07  33%  649 aa  MACB2_YERPN RecName: Full=Macrolide export ATP-binding/permease
  125::219     1e-07  33%  649 aa  MACB1_YERPS RecName: Full=Macrolide export ATP-binding/permease
  125::219     1e-07  33%  649 aa  MACB1_YERPE RecName: Full=Macrolide export ATP-binding/permease
  125::219     1e-07  33%  649 aa  MACB1_YERPA RecName: Full=Macrolide export ATP-binding/permease
  575::661     1e-07  34%  688 aa  ABCB8_XENTR RecName: Full=ATP-binding cassette sub-family B member
  144::231     2e-07  38%  280 aa  Y373_PYRAB RecName: Full=Putative ABC transporter ATP-binding
  120::217     2e-07  32%  780 aa  Y043_BIFLO RecName: Full=Putative ABC transporter ATP-binding
   15::104     2e-07  29%  110 aa  UVRA_PARDE RecName: Full=UvrABC system protein A;       
  487::589     2e-07  31%  602 aa  MSBA_PSEPK RecName: Full=Lipid A export ATP-binding/permease
 1104::1218    2e-07  31% 1233 aa  AB2B_ARATH RecName: Full=ABC transporter B family member 2;       
  104::209     2e-07  38%  255 aa  ZNUC_ROSDO RecName: Full=Zinc import ATP-binding protein znuC;     
  118::240     2e-07  34%  260 aa  ZNUC_HALHL RecName: Full=Zinc import ATP-binding protein znuC;     
  143::240     2e-07  40%  564 aa  Y2240_PHOPR RecName: Full=Putative ABC transporter ATP-binding
  139::226     2e-07  34%  266 aa  Y222_THEMA RecName: Full=Putative ABC transporter ATP-binding
  466::576     2e-07  34%  601 aa  MSBA_SYNAS RecName: Full=Lipid A export ATP-binding/permease
  473::566     2e-07  36%  585 aa  MSBA_DECAR RecName: Full=Lipid A export ATP-binding/permease
  412::517     3e-07  32%  547 aa  YKOD_BACSU RecName: Full=Putative HMP/thiamine import ATP-binding
  138::232     3e-07  33%  563 aa  Y2324_STRCO RecName: Full=Putative ABC transporter ATP-binding
  475::571     3e-07  34%  581 aa  MSBA_RHOFD RecName: Full=Lipid A export ATP-binding/permease
  483::594     3e-07  33%  595 aa  MSBA_PSYA2 RecName: Full=Lipid A export ATP-binding/permease
  479::574     3e-07  32%  601 aa  MSBA_METCA RecName: Full=Lipid A export ATP-binding/permease
  489::588     3e-07  32%  593 aa  MSBA_BURS3 RecName: Full=Lipid A export ATP-binding/permease
  489::588     3e-07  32%  593 aa  MSBA_BURCA RecName: Full=Lipid A export ATP-binding/permease
  482::572     3e-07  34%  591 aa  MSBA_BORA1 RecName: Full=Lipid A export ATP-binding/permease
  147::236     3e-07  33%  656 aa  MACB_PSE14 RecName: Full=Macrolide export ATP-binding/permease
  556::696     3e-07  30%  712 aa  CYAB_BORPE RecName: Full=Cyclolysin secretion/processing
  581::692     4e-07  32%  707 aa  RTX1B_ACTPL RecName: Full=Toxin RTX-I translocation ATP-binding
  482::570     4e-07  36%  602 aa  NDVA_RHOPS RecName: Full=Beta-(1-->2)glucan export
  485::578     4e-07  31%  600 aa  MSBA_PSESM RecName: Full=Lipid A export ATP-binding/permease
  486::588     4e-07  29%  601 aa  MSBA_PSEF5 RecName: Full=Lipid A export ATP-binding/permease
  457::575     4e-07  34%  597 aa  MSBA_NITOC RecName: Full=Lipid A export ATP-binding/permease
  118::229     4e-07  40%  268 aa  HMUV_RHOPA RecName: Full=Hemin import ATP-binding protein hmuV;    
  499::591     5e-07  34%  614 aa  Y1051_HAEIN RecName: Full=Uncharacterized ABC transporter
  482::568     5e-07  37%  604 aa  NDVA_RHOPB RecName: Full=Beta-(1-->2)glucan export
  485::578     5e-07  31%  600 aa  MSBA_PSE14 RecName: Full=Lipid A export ATP-binding/permease
  147::236     5e-07  32%  656 aa  MACB1_PSESM RecName: Full=Macrolide export ATP-binding/permease
  142::271     5e-07  29%  667 aa  MACB1_PSEE4 RecName: Full=Macrolide export ATP-binding/permease
  121::224     5e-07  31%  274 aa  CBIO_METAC RecName: Full=Cobalt import ATP-binding protein cbiO;   
  146::245     5e-07  33%  289 aa  CBIO1_LACS1 RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  572::673     5e-07  33%  714 aa  ABCB8_RAT RecName: Full=ATP-binding cassette sub-family B member 8,
  573::674     5e-07  32%  718 aa  ABCB8_PONAB RecName: Full=ATP-binding cassette sub-family B member
  590::691     5e-07  32%  735 aa  ABCB8_HUMAN RecName: Full=ATP-binding cassette sub-family B member
  471::564     7e-07  30%  578 aa  Y2003_STAA8 RecName: Full=Putative multidrug export
  471::564     7e-07  30%  578 aa  Y1956_STAAR RecName: Full=Putative multidrug export
  471::564     7e-07  30%  578 aa  Y1924_STAAC RecName: Full=Putative multidrug export
  471::564     7e-07  30%  578 aa  Y1866_STAAM RecName: Full=Putative multidrug export
  471::564     7e-07  30%  578 aa  Y1847_STAA3 RecName: Full=Putative multidrug export
  471::564     7e-07  30%  578 aa  Y1806_STAAW RecName: Full=Putative multidrug export
  471::564     7e-07  30%  578 aa  Y1799_STAAB RecName: Full=Putative multidrug export
  471::564     7e-07  30%  578 aa  Y1788_STAAS RecName: Full=Putative multidrug export
  471::564     7e-07  30%  578 aa  Y1683_STAAN RecName: Full=Putative multidrug export
  482::585     7e-07  31%  592 aa  MSBA_RALSO RecName: Full=Lipid A export ATP-binding/permease
  485::578     7e-07  31%  600 aa  MSBA_PSEU2 RecName: Full=Lipid A export ATP-binding/permease
  454::571     7e-07  32%  579 aa  MSBA_CHRSD RecName: Full=Lipid A export ATP-binding/permease
  479::587     7e-07  29%  589 aa  MSBA_ALHEH RecName: Full=Lipid A export ATP-binding/permease
  146::235     7e-07  30%  656 aa  MACB_SHESA RecName: Full=Macrolide export ATP-binding/permease
  125::219     7e-07  32%  647 aa  MACB_RHIME RecName: Full=Macrolide export ATP-binding/permease
  128::218     7e-07  29%  644 aa  MACB_NEIMA RecName: Full=Macrolide export ATP-binding/permease
  126::246     7e-07  27%  648 aa  MACB_AGRT5 RecName: Full=Macrolide export ATP-binding/permease
  709::806     7e-07  35%  830 aa  HMT1_SCHPO RecName: Full=Heavy metal tolerance protein;Flags:
  123::237     7e-07  31%  288 aa  CBIO1_SYMTH RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  572::673     7e-07  33%  717 aa  ABCB8_MOUSE RecName: Full=ATP-binding cassette sub-family B member
  371::450     9e-07  39%  489 aa  Y282_TREDE RecName: Full=Putative ABC transporter ATP-binding
  474::567     9e-07  32%  582 aa  MSBA_VIBF1 RecName: Full=Lipid A export ATP-binding/permease
  141::219     9e-07  29%  648 aa  MACB_SALTY RecName: Full=Macrolide export ATP-binding/permease
  141::219     9e-07  29%  648 aa  MACB_SALTI RecName: Full=Macrolide export ATP-binding/permease
  141::219     9e-07  29%  648 aa  MACB_SALPA RecName: Full=Macrolide export ATP-binding/permease
  141::219     9e-07  29%  648 aa  MACB_SALCH RecName: Full=Macrolide export ATP-binding/permease
  146::220     9e-07  31%  655 aa  MACB_RHOPB RecName: Full=Macrolide export ATP-binding/permease
  128::218     9e-07  30%  644 aa  MACB_NEIGO RecName: Full=Macrolide export ATP-binding/permease
  128::218     9e-07  30%  644 aa  MACB_NEIG1 RecName: Full=Macrolide export ATP-binding/permease
  146::220     9e-07  29%  650 aa  MACB_ERWCT RecName: Full=Macrolide export ATP-binding/permease
  142::216     9e-07  32%  641 aa  MACB_CAMFF RecName: Full=Macrolide export ATP-binding/permease
  132::222     9e-07  29%  664 aa  MACB_ACIAD RecName: Full=Macrolide export ATP-binding/permease
  146::220     9e-07  32%  653 aa  MACB2_PSEU2 RecName: Full=Macrolide export ATP-binding/permease
  142::236     9e-07  33%  668 aa  MACB2_PSESM RecName: Full=Macrolide export ATP-binding/permease
  147::221     9e-07  33%  657 aa  MACB1_PSEPF RecName: Full=Macrolide export ATP-binding/permease
  581::697     9e-07  30%  707 aa  HLYB_PROVU RecName: Full=Alpha-hemolysin translocation ATP-binding
  129::235     9e-07  26%  258 aa  HISP_SALTY RecName: Full=Histidine transport ATP-binding protein
  136::239     9e-07  28%  257 aa  HISP_ECOLI RecName: Full=Histidine transport ATP-binding protein
  132::245     9e-07  29%  291 aa  CBIO1_LACSS RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  102::229     1e-06  32%  253 aa  ZNUC_YERPS RecName: Full=Zinc import ATP-binding protein znuC;     
  726::833     1e-06  35%  859 aa  Y1383_MYCBO RecName: Full=Uncharacterized ABC transporter
  726::833     1e-06  35%  859 aa  Y1348_MYCTU RecName: Full=Uncharacterized ABC transporter
  377::469     1e-06  28%  501 aa  RGMG1_RHIME RecName: Full=Putative ribose/galactose/methyl
  144::235     1e-06  32%  321 aa  NODI_RALSO RecName: Full=Nod factor export ATP-binding protein I;  
  482::570     1e-06  35%  602 aa  NDVA_RHOP5 RecName: Full=Beta-(1-->2)glucan export
  476::573     1e-06  38%  602 aa  NDVA_BRAJA RecName: Full=Beta-(1-->2)glucan export
  453::577     1e-06  31%  579 aa  MSBA_THIDA RecName: Full=Lipid A export ATP-binding/permease
  486::579     1e-06  31%  600 aa  MSBA_PSEPF RecName: Full=Lipid A export ATP-binding/permease
  128::225     1e-06  32%  659 aa  MACB_NITEU RecName: Full=Macrolide export ATP-binding/permease
  147::221     1e-06  32%  657 aa  MACB1_PSEU2 RecName: Full=Macrolide export ATP-binding/permease
  534::615     1e-06  29% 1290 aa  L259_DROME RecName: Full=Probable multidrug resistance-associated
  137::226     1e-06  36%  330 aa  DRRA_STRPE RecName: Full=Daunorubicin resistance ATP-binding
  146::229     1e-06  33%  280 aa  CBIO1_STRMU RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  102::229     2e-06  32%  253 aa  ZNUC_YERPN RecName: Full=Zinc import ATP-binding protein znuC;     
  102::229     2e-06  32%  253 aa  ZNUC_YERPE RecName: Full=Zinc import ATP-binding protein znuC;     
  102::229     2e-06  32%  253 aa  ZNUC_YERPA RecName: Full=Zinc import ATP-binding protein znuC;     
  132::236     2e-06  31%  274 aa  Y3946_ANASP RecName: Full=Putative ABC transporter ATP-binding
  488::581     2e-06  31%  603 aa  MSBA_PSEAE RecName: Full=Lipid A export ATP-binding/permease
  146::220     2e-06  31%  654 aa  MACB_RHOP2 RecName: Full=Macrolide export ATP-binding/permease
  128::218     2e-06  30%  644 aa  MACB_NEIMB RecName: Full=Macrolide export ATP-binding/permease
  127::220     2e-06  30%  657 aa  MACB_CHLCH RecName: Full=Macrolide export ATP-binding/permease
  147::254     2e-06  31%  646 aa  MACB_BRUA2 RecName: Full=Macrolide export ATP-binding/permease
  128::218     2e-06  30%  641 aa  MACB_AZOSE RecName: Full=Macrolide export ATP-binding/permease
  144::234     2e-06  32%  656 aa  MACB_AZOSB RecName: Full=Macrolide export ATP-binding/permease
  147::221     2e-06  33%  657 aa  MACB2_PSEF5 RecName: Full=Macrolide export ATP-binding/permease
  147::221     2e-06  32%  654 aa  MACB2_PSEE4 RecName: Full=Macrolide export ATP-binding/permease
  120::225     2e-06  33%  227 aa  LOLD_PSESM RecName: Full=Lipoprotein-releasing system ATP-binding
  124::230     2e-06  39%  255 aa  HMUV_PSEPF RecName: Full=Hemin import ATP-binding protein hmuV;    
  127::236     2e-06  29%  316 aa  NODI_RHIEC RecName: Full=Nod factor export ATP-binding protein I;  
  452::566     2e-06  35%  581 aa  MSBA_THICR RecName: Full=Lipid A export ATP-binding/permease
  492::577     2e-06  34%  596 aa  MSBA_BURTA RecName: Full=Lipid A export ATP-binding/permease
  492::577     2e-06  34%  596 aa  MSBA_BURPS RecName: Full=Lipid A export ATP-binding/permease
  492::577     2e-06  34%  596 aa  MSBA_BURP1 RecName: Full=Lipid A export ATP-binding/permease
  492::577     2e-06  34%  596 aa  MSBA_BURMA RecName: Full=Lipid A export ATP-binding/permease
  134::207     2e-06  32%  250 aa  MNTB_BACSU RecName: Full=Manganese transport system ATP-binding
 1114::1222    2e-06  33% 1245 aa  MDR_ORYSJ RecName: Full=Putative multidrug resistance
  145::219     2e-06  29%  648 aa  MACB_SHISS RecName: Full=Macrolide export ATP-binding/permease
  145::219     2e-06  29%  648 aa  MACB_SHIFL RecName: Full=Macrolide export ATP-binding/permease
  145::219     2e-06  29%  650 aa  MACB_SHIDS RecName: Full=Macrolide export ATP-binding/permease
  146::220     2e-06  29%  656 aa  MACB_SHEON RecName: Full=Macrolide export ATP-binding/permease
  152::249     2e-06  32%  663 aa  MACB_PSEAB RecName: Full=Macrolide export ATP-binding/permease
  126::220     2e-06  32%  654 aa  MACB_HAHCH RecName: Full=Macrolide export ATP-binding/permease
  145::219     2e-06  29%  648 aa  MACB_ECOUT RecName: Full=Macrolide export ATP-binding/permease
  145::219     2e-06  29%  648 aa  MACB_ECOLI RecName: Full=Macrolide export ATP-binding/permease
  145::219     2e-06  29%  648 aa  MACB_ECOL5 RecName: Full=Macrolide export ATP-binding/permease
  145::219     2e-06  29%  648 aa  MACB_ECO57 RecName: Full=Macrolide export ATP-binding/permease
  147::254     2e-06  31%  647 aa  MACB_BRUME RecName: Full=Macrolide export ATP-binding/permease
  150::224     2e-06  28%  660 aa  MACB_BARHE RecName: Full=Macrolide export ATP-binding/permease
  144::244     2e-06  30%  640 aa  MACB3_PARDP RecName: Full=Macrolide export ATP-binding/permease
  145::219     2e-06  29%  648 aa  MACB1_ECOK1 RecName: Full=Macrolide export ATP-binding/permease
  589::692     2e-06  32%  708 aa  LKTB_PASSP RecName: Full=Leukotoxin translocation ATP-binding
  455::550     2e-06  33%  599 aa  ABCE1_MOUSE RecName: Full=ATP-binding cassette sub-family E member
  455::550     2e-06  33%  599 aa  ABCE1_HUMAN RecName: Full=ATP-binding cassette sub-family E member
  391::466     3e-06  33%  498 aa  Y2387_METMA RecName: Full=Putative ABC transporter ATP-binding
  395::473     3e-06  36%  528 aa  Y1418_METAC RecName: Full=Putative ABC transporter ATP-binding
  585::701     3e-06  31%  711 aa  PAXB_PASAE RecName: Full=Exotoxin translocation ATP-binding protein
  177::267     3e-06  32%  347 aa  NODI_RHIGA RecName: Full=Nod factor export ATP-binding protein I;  
  112::224     3e-06  30%  304 aa  NODI_BURS3 RecName: Full=Nod factor export ATP-binding protein I;  
  474::576     3e-06  28%  585 aa  MSBA_HAHCH RecName: Full=Lipid A export ATP-binding/permease
  493::579     3e-06  33%  597 aa  MSBA_BURXL RecName: Full=Lipid A export ATP-binding/permease
  147::221     3e-06  31%  654 aa  MACB_PSEPK RecName: Full=Macrolide export ATP-binding/permease
  152::226     3e-06  33%  663 aa  MACB_PSEAE RecName: Full=Macrolide export ATP-binding/permease
  146::238     3e-06  28%  644 aa  MACB_CHRVO RecName: Full=Macrolide export ATP-binding/permease
  140::220     3e-06  30%  653 aa  MACB_BURTA RecName: Full=Macrolide export ATP-binding/permease
  146::220     3e-06  31%  653 aa  MACB_BURPS RecName: Full=Macrolide export ATP-binding/permease
  146::220     3e-06  31%  653 aa  MACB_BURP1 RecName: Full=Macrolide export ATP-binding/permease
  582::692     3e-06  32%  708 aa  LKTB_PASTR RecName: Full=Leukotoxin translocation ATP-binding
  582::692     3e-06  32%  708 aa  LKTB_MANGL RecName: Full=Leukotoxin translocation ATP-binding
  582::692     3e-06  32%  708 aa  LKTB7_PASHA RecName: Full=Leukotoxin translocation ATP-binding
  582::692     3e-06  32%  708 aa  LKB2B_PASHA RecName: Full=Leukotoxin translocation ATP-binding
  582::692     3e-06  32%  708 aa  LKB2A_PASHA RecName: Full=Leukotoxin translocation ATP-binding
  582::692     3e-06  32%  708 aa  LKB1B_PASHA RecName: Full=Leukotoxin translocation ATP-binding
  582::692     3e-06  32%  708 aa  LKB1A_PASHA RecName: Full=Leukotoxin translocation ATP-binding
  582::692     3e-06  32%  708 aa  LKB16_PASHA RecName: Full=Leukotoxin translocation ATP-binding
  582::692     3e-06  32%  708 aa  LKB14_PASHA RecName: Full=Leukotoxin translocation ATP-binding
  582::692     3e-06  32%  708 aa  LKB13_PASHA RecName: Full=Leukotoxin translocation ATP-binding
  146::244     3e-06  30%  288 aa  CBIO3_OENOB RecName: Full=Cobalt import ATP-binding protein cbiO 3;
 1114::1233    3e-06  30% 1240 aa  AB17B_ARATH RecName: Full=ABC transporter B family member 17;        
 1100::1212    3e-06  33% 1228 aa  AB16B_ARATH RecName: Full=ABC transporter B family member 16;        
  493::586     3e-06  28% 1227 aa  AB10B_ARATH RecName: Full=ABC transporter B family member 10;      
  101::228     3e-06  32%  252 aa  ZNUC_YERE8 RecName: Full=Zinc import ATP-binding protein znuC;     
  111::210     3e-06  32%  561 aa  Y5847_STRAW RecName: Full=Putative ABC transporter ATP-binding
  451::537     3e-06  35%  590 aa  Y3016_METMA RecName: Full=Putative ABC transporter ATP-binding
  144::231     3e-06  35%  284 aa  Y1815_PYRHO RecName: Full=Putative ABC transporter ATP-binding
  132::240     3e-06  32%  280 aa  Y133_METTH RecName: Full=Putative ABC transporter ATP-binding
  482::568     3e-06  36%  593 aa  NDVA_NITHX RecName: Full=Beta-(1-->2)glucan export
  472::564     3e-06  30%  588 aa  MSBA_LEGPH RecName: Full=Lipid A export ATP-binding/permease
  472::564     3e-06  30%  588 aa  MSBA_LEGPA RecName: Full=Lipid A export ATP-binding/permease
  478::587     3e-06  27%  593 aa  MSBA_FRANO RecName: Full=Lipid A export ATP-binding/permease
  523::615     3e-06  32% 1276 aa  MDR2_CRIGR RecName: Full=Multidrug resistance protein 2;       
  523::615     3e-06  32% 1277 aa  MDR1_RAT RecName: Full=Multidrug resistance protein 1;       
 1167::1262    3e-06  31% 1276 aa  MDR1_MOUSE RecName: Full=Multidrug resistance protein 1;       
  521::613     3e-06  32% 1276 aa  MDR1_CRIGR RecName: Full=Multidrug resistance protein 1;       
  145::219     3e-06  29%  648 aa  MACB_SHIBS RecName: Full=Macrolide export ATP-binding/permease
  147::221     3e-06  31%  649 aa  MACB_PASMU RecName: Full=Macrolide export ATP-binding/permease
  146::220     3e-06  28%  687 aa  MACB_BURS3 RecName: Full=Macrolide export ATP-binding/permease
  151::225     3e-06  28%  678 aa  MACB2_YERPS RecName: Full=Macrolide export ATP-binding/permease
  151::225     3e-06  28%  678 aa  MACB2_YERPE RecName: Full=Macrolide export ATP-binding/permease
  151::225     3e-06  28%  678 aa  MACB2_YERPA RecName: Full=Macrolide export ATP-binding/permease
  151::225     3e-06  28%  678 aa  MACB1_YERPN RecName: Full=Macrolide export ATP-binding/permease
  138::237     3e-06  34%  277 aa  CBIO_METMJ RecName: Full=Cobalt import ATP-binding protein cbiO;   
  120::226     3e-06  32%  398 aa  CBIO2_METHJ RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  117::222     4e-06  36%  298 aa  ZNUC_BRUAB RecName: Full=Zinc import ATP-binding protein znuC;     
  117::222     4e-06  36%  298 aa  ZNUC_BRUA2 RecName: Full=Zinc import ATP-binding protein znuC;     
  124::226     4e-06  29%  249 aa  YXEO_BACSU RecName: Full=Probable amino-acid import ATP-binding
  429::542     4e-06  29%  614 aa  Y1747_METAC RecName: Full=Putative ABC transporter ATP-binding
  135::210     4e-06  35%  260 aa  Y068_PYRFU RecName: Full=Putative ABC transporter ATP-binding
  404::510     4e-06  28%  518 aa  XYLG_PSEPF RecName: Full=Xylose import ATP-binding protein xylG;   
  375::468     4e-06  25%  506 aa  RBSA_MESSB RecName: Full=Ribose import ATP-binding protein rbsA;   
  133::237     4e-06  34%  376 aa  POTA_FUSNN RecName: Full=Spermidine/putrescine import ATP-binding
  134::240     4e-06  35%  278 aa  PHNC1_PSEAB RecName: Full=Phosphonates import ATP-binding protein
  172::263     4e-06  33%  343 aa  NODI_RHISN RecName: Full=Nod factor export ATP-binding protein I;  
  474::576     4e-06  28%  582 aa  MSBA_VIBPA RecName: Full=Lipid A export ATP-binding/permease
  474::561     4e-06  31%  582 aa  MSBA_VIBCH RecName: Full=Lipid A export ATP-binding/permease
  486::597     4e-06  31%  598 aa  MSBA_PSYCK RecName: Full=Lipid A export ATP-binding/permease
  472::564     4e-06  29%  588 aa  MSBA_LEGPL RecName: Full=Lipid A export ATP-binding/permease
  522::630     4e-06  31% 1302 aa  MDR65_DROME RecName: Full=Multidrug resistance protein homolog 65; 
  520::612     4e-06  32% 1276 aa  MDR3_MOUSE RecName: Full=Multidrug resistance protein 3;       
  526::618     4e-06  32% 1286 aa  MDR3_HUMAN RecName: Full=Multidrug resistance protein 3;       
  526::618     4e-06  32% 1281 aa  MDR3_CRIGR RecName: Full=Multidrug resistance protein 3;       
  530::615     4e-06  34% 1278 aa  MDR2_RAT RecName: Full=Multidrug resistance protein 2;       
  141::231     4e-06  27%  665 aa  MACB_PSYA2 RecName: Full=Macrolide export ATP-binding/permease
  145::219     4e-06  28%  647 aa  MACB_PHOLL RecName: Full=Macrolide export ATP-binding/permease
  146::220     4e-06  28%  681 aa  MACB_BURCH RecName: Full=Macrolide export ATP-binding/permease
  146::220     4e-06  28%  681 aa  MACB_BURCA RecName: Full=Macrolide export ATP-binding/permease
  150::224     4e-06  25%  660 aa  MACB_BARQU RecName: Full=Macrolide export ATP-binding/permease
  128::218     4e-06  29%  644 aa  MACB_ACTAC RecName: Full=Macrolide export ATP-binding/permease
  581::686     4e-06  30%  707 aa  HLYB_ECOL6 RecName: Full=Alpha-hemolysin translocation ATP-binding
  581::686     4e-06  30%  707 aa  HLYBP_ECOLX RecName: Full=Alpha-hemolysin translocation ATP-binding
  581::686     4e-06  30%  707 aa  HLYBC_ECOLX RecName: Full=Alpha-hemolysin translocation ATP-binding
  581::686     4e-06  30%  707 aa  HLYB3_ECOLX RecName: Full=Alpha-hemolysin translocation ATP-binding
  136::226     4e-06  31%  255 aa  FECE_ECOLI RecName: Full=Fe(3+) dicitrate transport ATP-binding
  420::558     6e-06  26%  595 aa  NDVA_BARHE RecName: Full=Beta-(1-->2)glucan export
  474::566     6e-06  31%  583 aa  MSBA_VIBVY RecName: Full=Lipid A export ATP-binding/permease
  501::599     6e-06  31%  622 aa  MSBA_NEIG1 RecName: Full=Lipid A export ATP-binding/permease
  596::692     6e-06  29% 1359 aa  MRP9_HUMAN RecName: Full=Multidrug resistance-associated protein
 1165::1260    6e-06  30% 1276 aa  MDR2_MOUSE RecName: Full=Multidrug resistance protein 2;       
 1169::1264    6e-06  31% 1280 aa  MDR1_HUMAN RecName: Full=Multidrug resistance protein 1;       
  141::231     6e-06  27%  665 aa  MACB_PSYCK RecName: Full=Macrolide export ATP-binding/permease
  146::220     6e-06  32%  696 aa  MACB_HAEDU RecName: Full=Macrolide export ATP-binding/permease
  139::220     6e-06  29%  652 aa  MACB1_PSEF5 RecName: Full=Macrolide export ATP-binding/permease
  140::243     6e-06  34%  249 aa  LOLD_BURTA RecName: Full=Lipoprotein-releasing system ATP-binding
  147::236     6e-06  33%  265 aa  FHUC_ECOLI RecName: Full=Iron(3+)-hydroxamate import ATP-binding
  822::930     6e-06  26% 1581 aa  ABCC8_HUMAN RecName: Full=ATP-binding cassette transporter
  823::931     6e-06  26% 1582 aa  ABCC8_CRICR RecName: Full=ATP-binding cassette transporter
  592::706     6e-06  28%  715 aa  ABCBA_MOUSE RecName: Full=ATP-binding cassette sub-family B member
  627::714     6e-06  30%  738 aa  ABCBA_HUMAN RecName: Full=ATP-binding cassette sub-family B member
  459::551     6e-06  34%  603 aa  AB1E_ARATH RecName: Full=ABC transporter E family member 1;        
  483::590     6e-06  33% 1252 aa  AB19B_ARATH RecName: Full=ABC transporter B family member 19;      
  104::209     8e-06  35%  249 aa  ZNUC_SILST RecName: Full=Zinc import ATP-binding protein znuC;     
  241::343     8e-06  33%  687 aa  WHITE_DROME RecName: Full=Protein white;
  134::236     8e-06  36%  278 aa  PHNC2_PSEAE RecName: Full=Phosphonates import ATP-binding protein
  134::226     8e-06  30%  304 aa  NODI_BURXL RecName: Full=Nod factor export ATP-binding protein I;  
  146::220     8e-06  29%  653 aa  MACB_SODGM RecName: Full=Macrolide export ATP-binding/permease
  125::221     8e-06  28%  664 aa  MACB_PELLD RecName: Full=Macrolide export ATP-binding/permease
  146::220     8e-06  28%  655 aa  MACB_BORA1 RecName: Full=Macrolide export ATP-binding/permease
  149::223     8e-06  25%  668 aa  MACB1_PARDP RecName: Full=Macrolide export ATP-binding/permease
  581::697     8e-06  29%  706 aa  HLYB_ECO57 RecName: Full=Alpha-hemolysin translocation ATP-binding
  135::228     8e-06  33%  269 aa  FHUC_BACSU RecName: Full=Iron(3+)-hydroxamate import ATP-binding
  116::217     8e-06  32%  217 aa  CCMA_ALCBS RecName: Full=Cytochrome c biogenesis ATP-binding export
  119::206     8e-06  28%  259 aa  CBIO_THEMA RecName: Full=Putative cobalt import ATP-binding protein
  148::256     8e-06  32%  305 aa  CBIO2_SPIKU RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  711::799     8e-06  31%  812 aa  ABCB5_HUMAN RecName: Full=ATP-binding cassette sub-family B member
  232::319     8e-06  36%  736 aa  AB16G_ARATH RecName: Full=ABC transporter G family member 16;      
   94::194     1e-05  37%  251 aa  ZNUC_SHISS RecName: Full=Zinc import ATP-binding protein znuC;     
   94::194     1e-05  37%  251 aa  ZNUC_SHIDS RecName: Full=Zinc import ATP-binding protein znuC;     
   94::194     1e-05  37%  251 aa  ZNUC_SHIBS RecName: Full=Zinc import ATP-binding protein znuC;     
   94::194     1e-05  37%  251 aa  ZNUC_ECOUT RecName: Full=Zinc import ATP-binding protein znuC;     
   94::194     1e-05  37%  251 aa  ZNUC_ECOLI RecName: Full=Zinc import ATP-binding protein znuC;     
   94::194     1e-05  37%  251 aa  ZNUC_ECOL6 RecName: Full=Zinc import ATP-binding protein znuC;     
   94::194     1e-05  37%  251 aa  ZNUC_ECOL5 RecName: Full=Zinc import ATP-binding protein znuC;     
   94::194     1e-05  37%  251 aa  ZNUC_ECOK1 RecName: Full=Zinc import ATP-binding protein znuC;     
   94::194     1e-05  37%  251 aa  ZNUC_ECO57 RecName: Full=Zinc import ATP-binding protein znuC;     
  147::236     1e-05  32%  560 aa  Y483_STRPN RecName: Full=Putative ABC transporter ATP-binding
  147::236     1e-05  32%  560 aa  Y430_STRR6 RecName: Full=Putative ABC transporter ATP-binding
  230::332     1e-05  33%  677 aa  WHITE_LUCCU RecName: Full=Protein white;
  585::690     1e-05  30%  711 aa  RTX3B_ACTPL RecName: Full=Toxin RTX-III translocation ATP-binding
  158::245     1e-05  31%  325 aa  NODI_RALEJ RecName: Full=Nod factor export ATP-binding protein I;  
  482::579     1e-05  35%  609 aa  NDVA_NITWN RecName: Full=Beta-(1-->2)glucan export
  465::557     1e-05  29%  595 aa  NDVA_BARQU RecName: Full=Beta-(1-->2)glucan export
  474::566     1e-05  30%  583 aa  MSBA_VIBVU RecName: Full=Lipid A export ATP-binding/permease
  466::572     1e-05  27%  574 aa  MSBA_ACIAD RecName: Full=Lipid A export ATP-binding/permease
  479::565     1e-05  32%  584 aa  MSBA2_COLP3 RecName: Full=Lipid A export ATP-binding/permease
  127::246     1e-05  31%  340 aa  METN_LEIXX RecName: Full=Methionine import ATP-binding protein
  530::622     1e-05  32% 1280 aa  MDR1_LEIEN RecName: Full=Multidrug resistance protein 1;       
  134::251     1e-05  29%  255 aa  HISP_PSEAE RecName: Full=Histidine transport ATP-binding protein
  125::240     1e-05  31%  289 aa  CBIO2_OCEIH RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  129::245     1e-05  31%  295 aa  CBIO2_LACPL RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  823::931     1e-05  26% 1582 aa  ABCC8_RAT RecName: Full=ATP-binding cassette transporter sub-family
  480::572     1e-05  30% 1229 aa  AB3B_ARATH RecName: Full=ABC transporter B family member 3;        
 1133::1231    1e-05  30% 1247 aa  AB14B_ARATH RecName: Full=ABC transporter B family member 14;        
  101::213     1e-05  31%  257 aa  ZNUC_PSEPK RecName: Full=Zinc import ATP-binding protein znuC;     
  565::662     1e-05  34%  673 aa  YHEH_BACSU RecName: Full=Probable multidrug resistance ABC
  141::238     1e-05  28%  297 aa  YCOBA_PROFR RecName: Full=Putative ABC transporter ATP-binding
  116::232     1e-05  32%  551 aa  Y3364_BACAN RecName: Full=Putative ABC transporter ATP-binding
  118::234     1e-05  31%  553 aa  Y3323_BACC1 RecName: Full=Putative ABC transporter ATP-binding
  116::232     1e-05  32%  551 aa  Y3105_BACHK RecName: Full=Putative ABC transporter ATP-binding
  232::320     1e-05  34%  679 aa  WHITE_CERCA RecName: Full=Protein white;
  388::490     1e-05  27%  501 aa  RBSA_ERWCT RecName: Full=Ribose import ATP-binding protein rbsA;   
  482::568     1e-05  34%  599 aa  NDVA_RHOPA RecName: Full=Beta-(1-->2)glucan export
  460::556     1e-05  32%  588 aa  NDVA_RHIRD RecName: Full=Beta-(1-->2)glucan export
  460::556     1e-05  32%  588 aa  NDVA_AGRT5 RecName: Full=Beta-(1-->2)glucan export
  476::569     1e-05  32%  583 aa  MSBA_METFK RecName: Full=Lipid A export ATP-binding/permease
  473::579     1e-05  25%  582 aa  MSBA_ALCBS RecName: Full=Lipid A export ATP-binding/permease
  146::220     1e-05  28%  643 aa  MACB_WOLSU RecName: Full=Macrolide export ATP-binding/permease
  145::219     1e-05  31%  646 aa  MACB_ECOLX RecName: Full=Macrolide export ATP-binding/permease
  145::219     1e-05  31%  646 aa  MACB2_ECOK1 RecName: Full=Macrolide export ATP-binding/permease
  134::217     1e-05  38%  255 aa  HMUV_PSEPK RecName: Full=Hemin import ATP-binding protein hmuV;    
  138::224     1e-05  33%  311 aa  CBIO_METTH RecName: Full=Putative cobalt import ATP-binding protein
  152::251     1e-05  30%  311 aa  CBIO2_MYCS5 RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  129::246     1e-05  27%  286 aa  CBIO1_STAAB RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  582::675     1e-05  32%  710 aa  ATM1_YARLI RecName: Full=Iron-sulfur clusters transporter ATM1,
  595::695     1e-05  35%  727 aa  ATM1_CANGA RecName: Full=Iron-sulfur clusters transporter ATM1,
  485::586     1e-05  30% 1286 aa  AB1B_ARATH RecName: Full=ABC transporter B family member 1;        
  116::211     2e-05  31%  254 aa  ZNUC_PARDP RecName: Full=Zinc import ATP-binding protein znuC;     
  304::374     2e-05  34%  437 aa  Y753_CLOTE RecName: Full=Putative ABC transporter ATP-binding
  143::234     2e-05  33%  574 aa  Y4347_VIBVY RecName: Full=Putative ABC transporter ATP-binding
  135::210     2e-05  35%  260 aa  Y132_PYRHO RecName: Full=Putative ABC transporter ATP-binding
  404::502     2e-05  29%  518 aa  XYLG_PSE14 RecName: Full=Xylose import ATP-binding protein xylG;   
  127::239     2e-05  31%  286 aa  PHNC_AGRT5 RecName: Full=Phosphonates import ATP-binding protein
  137::226     2e-05  33%  304 aa  NODI_BURPS RecName: Full=Nod factor export ATP-binding protein I;  
  137::226     2e-05  33%  304 aa  NODI_BURP1 RecName: Full=Nod factor export ATP-binding protein I;  
  137::226     2e-05  33%  304 aa  NODI_BURMA RecName: Full=Nod factor export ATP-binding protein I;  
  137::224     2e-05  33%  304 aa  NODI_BURCA RecName: Full=Nod factor export ATP-binding protein I;  
  465::557     2e-05  29%  595 aa  NDVA_BARBK RecName: Full=Beta-(1-->2)glucan export
  465::557     2e-05  29%  595 aa  NDVA_BARBA RecName: Full=Beta-(1-->2)glucan export
  492::592     2e-05  28%  600 aa  MSBA_SHEDO RecName: Full=Lipid A export ATP-binding/permease
  480::565     2e-05  29%  586 aa  MSBA_SACD2 RecName: Full=Lipid A export ATP-binding/permease
  120::222     2e-05  29%  227 aa  LOLD_PSEU2 RecName: Full=Lipoprotein-releasing system ATP-binding
  120::174     2e-05  46%  227 aa  LOLD_PSEF5 RecName: Full=Lipoprotein-releasing system ATP-binding
  120::222     2e-05  29%  227 aa  LOLD_PSE14 RecName: Full=Lipoprotein-releasing system ATP-binding
  148::243     2e-05  34%  249 aa  LOLD_BURPS RecName: Full=Lipoprotein-releasing system ATP-binding
  148::243     2e-05  34%  249 aa  LOLD_BURMA RecName: Full=Lipoprotein-releasing system ATP-binding
  128::226     2e-05  37%  255 aa  HMUV_PSEF5 RecName: Full=Hemin import ATP-binding protein hmuV;    
  128::226     2e-05  35%  255 aa  HMUV_PSEAE RecName: Full=Hemin import ATP-binding protein hmuV;    
  128::226     2e-05  35%  255 aa  HMUV_PSEAB RecName: Full=Hemin import ATP-binding protein hmuV;    
  146::232     2e-05  31%  279 aa  CBIO1_STRSV RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  165::260     2e-05  34%  303 aa  CBIO1_MYCMS RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  395::454     2e-05  33%  497 aa  ARAG_CHRSD RecName: Full=Arabinose import ATP-binding protein araG;
  423::502     2e-05  27%  525 aa  ARAG2_BURTA RecName: Full=Arabinose import ATP-binding protein araG
  801::891     2e-05  30% 1545 aa  ABCC9_RAT RecName: Full=ATP-binding cassette transporter sub-family
  802::892     2e-05  30% 1546 aa  ABCC9_MOUSE RecName: Full=ATP-binding cassette transporter
  117::194     2e-05  37%  238 aa  ZNUC_BUCBP RecName: Full=Zinc import ATP-binding protein znuC;     
  117::222     2e-05  33%  298 aa  ZNUC_BRUSU RecName: Full=Zinc import ATP-binding protein znuC;     
  117::222     2e-05  35%  298 aa  ZNUC_BRUME RecName: Full=Zinc import ATP-binding protein znuC;     
  119::192     2e-05  35%  260 aa  Y130_PYRAB RecName: Full=Putative ABC transporter ATP-binding
  404::483     2e-05  29%  518 aa  XYLG_PSEU2 RecName: Full=Xylose import ATP-binding protein xylG;   
  371::497     2e-05  25%  517 aa  RBSA2_STRCO RecName: Full=Ribose import ATP-binding protein rbsA 2;
  144::231     2e-05  32%  311 aa  NODI_RHIL3 RecName: Full=Nod factor export ATP-binding protein I;  
  165::255     2e-05  31%  335 aa  NODI2_RHIME RecName: Full=Nod factor export ATP-binding protein I; 
  501::606     2e-05  28%  621 aa  MSBA_NEIMB RecName: Full=Lipid A export ATP-binding/permease
  501::606     2e-05  28%  621 aa  MSBA_NEIMA RecName: Full=Lipid A export ATP-binding/permease
  134::204     2e-05  33%  240 aa  MNTB_LISMO RecName: Full=Manganese transport system ATP-binding
  134::204     2e-05  33%  240 aa  MNTB_LISIN RecName: Full=Manganese transport system ATP-binding
  146::220     2e-05  29%  651 aa  MACB2_PSEPF RecName: Full=Macrolide export ATP-binding/permease
  146::221     2e-05  28%  648 aa  MACB1_AERHH RecName: Full=Macrolide export ATP-binding/permease
  133::225     2e-05  30%  241 aa  LPTB_SHIFL RecName: Full=Lipopolysaccharide export system
  133::225     2e-05  30%  241 aa  LPTB_ECOLI RecName: Full=Lipopolysaccharide export system
  133::225     2e-05  30%  241 aa  LPTB_ECOL6 RecName: Full=Lipopolysaccharide export system
  133::225     2e-05  30%  241 aa  LPTB_ECO57 RecName: Full=Lipopolysaccharide export system
  140::227     2e-05  33%  277 aa  CBIO2_THETN RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  175::270     2e-05  33%  315 aa  CBIO2_MESFL RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  545::643     2e-05  26% 1323 aa  ABCCC_DICDI RecName: Full=ABC transporter C family member
  627::720     2e-05  29% 1382 aa  ABCCB_HUMAN RecName: Full=ATP-binding cassette transporter
  101::194     3e-05  35%  257 aa  ZNUC_PHOLL RecName: Full=Zinc import ATP-binding protein znuC;     
  417::503     3e-05  28%  530 aa  Y2030_SULSO RecName: Full=Putative ABC transporter ATP-binding
  124::169     3e-05  48%  249 aa  Y1281_GEOSL RecName: Full=Putative ABC transporter ATP-binding
  445::514     3e-05  27%  588 aa  Y020_ONYPE RecName: Full=Putative ABC transporter ATP-binding
  461::560     3e-05  36%  608 aa  RLI1_YEAST RecName: Full=Translation initiation factor
  146::250     3e-05  35%  271 aa  PHNC2_HALMA RecName: Full=Phosphonates import ATP-binding protein
  132::236     3e-05  35%  273 aa  PHNC1_HALMA RecName: Full=Phosphonates import ATP-binding protein
  144::231     3e-05  32%  311 aa  NODI_RHILV RecName: Full=Nod factor export ATP-binding protein I;  
  136::223     3e-05  32%  303 aa  NODI_RALME RecName: Full=Nod factor export ATP-binding protein I;  
  137::224     3e-05  33%  304 aa  NODI_BURTA RecName: Full=Nod factor export ATP-binding protein I;  
  501::594     3e-05  30%  609 aa  MSBA_FRATT RecName: Full=Lipid A export ATP-binding/permease
  501::594     3e-05  30%  609 aa  MSBA_FRAT1 RecName: Full=Lipid A export ATP-binding/permease
  543::659     3e-05  32% 1321 aa  MDR1_CAEEL RecName: Full=Multidrug resistance protein 1;       
  574::674     3e-05  30%  695 aa  MDL1_YEAST RecName: Full=ATP-dependent permease MDL1,
  127::222     3e-05  31%  227 aa  LOLD_PSEPK RecName: Full=Lipoprotein-releasing system ATP-binding
  133::221     3e-05  33%  225 aa  LOLD_DECAR RecName: Full=Lipoprotein-releasing system ATP-binding
  581::686     3e-05  29%  707 aa  LKTB_ACTAC RecName: Full=Leukotoxin translocation ATP-binding
  162::219     3e-05  36%  304 aa  CBIO2_MYCPU RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  418::497     3e-05  28%  520 aa  ARAG_AZOBR RecName: Full=Arabinose import ATP-binding protein araG;
  420::499     3e-05  28%  522 aa  ARAG2_BURS3 RecName: Full=Arabinose import ATP-binding protein araG
  417::496     3e-05  28%  519 aa  ARAG2_BURCM RecName: Full=Arabinose import ATP-binding protein araG
  485::577     3e-05  30% 1230 aa  AB5B_ARATH RecName: Full=ABC transporter B family member 5;        
   94::194     4e-05  37%  251 aa  ZNUC_SHIFL RecName: Full=Zinc import ATP-binding protein znuC;     
   94::194     4e-05  37%  251 aa  ZNUC_SHIF8 RecName: Full=Zinc import ATP-binding protein znuC;     
  101::194     4e-05  34%  251 aa  ZNUC_SALTY RecName: Full=Zinc import ATP-binding protein znuC;     
  101::194     4e-05  34%  251 aa  ZNUC_SALTI RecName: Full=Zinc import ATP-binding protein znuC;     
  101::194     4e-05  34%  251 aa  ZNUC_SALPA RecName: Full=Zinc import ATP-binding protein znuC;     
  101::194     4e-05  34%  251 aa  ZNUC_SALCH RecName: Full=Zinc import ATP-binding protein znuC;     
  465::556     4e-05  32%  587 aa  NDVA_RHIL3 RecName: Full=Beta-(1-->2)glucan export
  492::585     4e-05  30%  600 aa  MSBA_SHEFN RecName: Full=Lipid A export ATP-binding/permease
  472::559     4e-05  28%  584 aa  MSBA_CHRVO RecName: Full=Lipid A export ATP-binding/permease
  144::246     4e-05  28%  657 aa  MACB_CHLPD RecName: Full=Macrolide export ATP-binding/permease
  138::212     4e-05  24%  641 aa  MACB_CAMJR RecName: Full=Macrolide export ATP-binding/permease
  138::212     4e-05  24%  641 aa  MACB_CAMJE RecName: Full=Macrolide export ATP-binding/permease
  134::217     4e-05  37%  255 aa  HMUV_PSEE4 RecName: Full=Hemin import ATP-binding protein hmuV;    
  123::234     4e-05  29%  271 aa  FEPC_ECOLI RecName: Full=Ferric enterobactin transport ATP-binding
  146::244     4e-05  27%  280 aa  CBIO2_STRPM RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  146::244     4e-05  27%  280 aa  CBIO2_STRPF RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  146::244     4e-05  27%  280 aa  CBIO2_STRPD RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  146::244     4e-05  27%  280 aa  CBIO2_STRPC RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  146::244     4e-05  27%  280 aa  CBIO2_STRPB RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  129::237     4e-05  33%  280 aa  CBIO2_LACSS RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  145::231     4e-05  30%  288 aa  CBIO2_LACLS RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  146::244     4e-05  27%  280 aa  CBIO1_STRPG RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  146::244     4e-05  27%  280 aa  CBIO1_STRP8 RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  146::244     4e-05  27%  280 aa  CBIO1_STRP6 RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  146::244     4e-05  27%  280 aa  CBIO1_STRP3 RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  146::244     4e-05  27%  280 aa  CBIO1_STRP1 RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  129::245     4e-05  26%  286 aa  CBIO1_STAAW RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  129::245     4e-05  26%  286 aa  CBIO1_STAAS RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  129::245     4e-05  26%  286 aa  CBIO1_STAAR RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  129::245     4e-05  26%  286 aa  CBIO1_STAAN RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  129::245     4e-05  26%  286 aa  CBIO1_STAAM RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  129::245     4e-05  26%  286 aa  CBIO1_STAAC RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  129::245     4e-05  26%  286 aa  CBIO1_STAA8 RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  129::245     4e-05  26%  286 aa  CBIO1_STAA3 RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  151::246     4e-05  34%  289 aa  CBIO1_MYCCT RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  143::229     4e-05  36%  281 aa  CBIO1_BACLD RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  413::492     4e-05  27%  515 aa  ARAG2_BURCH RecName: Full=Arabinose import ATP-binding protein araG
  413::492     4e-05  27%  515 aa  ARAG2_BURCA RecName: Full=Arabinose import ATP-binding protein araG
  178::282     4e-05  32%  652 aa  ABCG5_MOUSE RecName: Full=ATP-binding cassette sub-family G member
  540::638     4e-05  25% 1334 aa  ABCCA_DICDI RecName: Full=ABC transporter C family member
  805::895     4e-05  29% 1549 aa  ABCC9_HUMAN RecName: Full=ATP-binding cassette transporter
  621::729     4e-05  31%  766 aa  ABCB9_HUMAN RecName: Full=ATP-binding cassette sub-family B member
  759::867     4e-05  29% 1516 aa  AB4C_ARATH RecName: Full=ABC transporter C family member 4;        
  535::627     4e-05  30% 1292 aa  AB21B_ARATH RecName: Full=ABC transporter B family member 21;      
  113::212     5e-05  35%  312 aa  ZNUC_RHIEC RecName: Full=Zinc import ATP-binding protein znuC;     
  133::224     5e-05  30%  252 aa  YCLP_BACSU RecName: Full=Uncharacterized ABC transporter
  433::530     5e-05  24%  573 aa  Y1704_LACJO RecName: Full=Putative ABC transporter ATP-binding
  463::557     5e-05  31%  579 aa  Y1384_MYCBO RecName: Full=Uncharacterized ABC transporter
  463::557     5e-05  31%  579 aa  Y1349_MYCTU RecName: Full=Uncharacterized ABC transporter
  404::483     5e-05  28%  528 aa  XYLG_PSESM RecName: Full=Xylose import ATP-binding protein xylG;   
  371::499     5e-05  26%  504 aa  RGMG_RHOFD RecName: Full=Putative ribose/galactose/methyl
  388::471     5e-05  28%  503 aa  RBSA1_RHIME RecName: Full=Ribose import ATP-binding protein rbsA 1;
  124::234     5e-05  29%  281 aa  PHNC_RHIEC RecName: Full=Phosphonates import ATP-binding protein
  114::211     5e-05  30%  233 aa  PHNC1_NATPD RecName: Full=Phosphonates import ATP-binding protein
  678::765     5e-05  27% 1436 aa  MRP5_RAT RecName: Full=Multidrug resistance-associated protein
  678::765     5e-05  27% 1436 aa  MRP5_MOUSE RecName: Full=Multidrug resistance-associated protein
  678::765     5e-05  27% 1437 aa  MRP5_HUMAN RecName: Full=Multidrug resistance-associated protein
  520::629     5e-05  28% 1302 aa  MDR49_DROME RecName: Full=Multidrug resistance protein homolog 49; 
  119::220     5e-05  30%  654 aa  MACB_VIBPA RecName: Full=Macrolide export ATP-binding/permease
  129::237     5e-05  32%  265 aa  HMUV_PASPI RecName: Full=Hemin import ATP-binding protein hmuV;    
  129::237     5e-05  33%  265 aa  HMUV_LISDA RecName: Full=Hemin import ATP-binding protein hmuV;    
  144::247     5e-05  29%  303 aa  CBIO2_MYCPN RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  121::232     5e-05  29%  280 aa  CBIO1_STRTD RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  121::232     5e-05  29%  280 aa  CBIO1_STRT2 RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  121::232     5e-05  29%  280 aa  CBIO1_STRT1 RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  128::232     5e-05  28%  279 aa  CBIO1_STRR6 RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  128::232     5e-05  28%  279 aa  CBIO1_STRPN RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  128::232     5e-05  28%  279 aa  CBIO1_STRP2 RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  172::258     5e-05  31%  318 aa  CBIO1_MYCGA RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  145::231     5e-05  29%  280 aa  CBIO1_CLONN RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  178::282     5e-05  32%  652 aa  ABCG5_RAT RecName: Full=ATP-binding cassette sub-family G member
  516::608     5e-05  30% 1286 aa  AB4B_ARATH RecName: Full=ABC transporter B family member 4;        
  113::216     6e-05  33%  303 aa  ZNUC_RHIL3 RecName: Full=Zinc import ATP-binding protein znuC;     
  103::213     6e-05  29%  269 aa  ZNUC_PSEAE RecName: Full=Zinc import ATP-binding protein znuC;     
  103::213     6e-05  29%  269 aa  ZNUC_PSEAB RecName: Full=Zinc import ATP-binding protein znuC;     
  113::209     6e-05  33%  243 aa  ZNUC_JANSC RecName: Full=Zinc import ATP-binding protein znuC;     
  430::534     6e-05  26%  566 aa  Y2655_BACCR RecName: Full=Putative ABC transporter ATP-binding
  621::724     6e-05  30%  748 aa  TAP1_GORGO RecName: Full=Antigen peptide transporter 1;       
  775::864     6e-05  33%  879 aa  RAD50_SULTO RecName: Full=DNA double-strand break repair rad50
  145::232     6e-05  31%  271 aa  PHNC2_ROSDO RecName: Full=Phosphonates import ATP-binding protein
  137::245     6e-05  34%  304 aa  NODI_RHIS3 RecName: Full=Nod factor export ATP-binding protein I;  
  465::558     6e-05  32%  584 aa  NDVA_AGRVI RecName: Full=Beta-(1-->2)glucan export
  447::547     6e-05  29%  581 aa  MDLA_BUCAP RecName: Full=Multidrug resistance-like ATP-binding
  120::174     6e-05  44%  227 aa  LOLD_PSEPF RecName: Full=Lipoprotein-releasing system ATP-binding
  132::245     6e-05  28%  288 aa  CBIO1_LACC3 RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  129::245     6e-05  29%  290 aa  CBIO1_LACBA RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  234::321     6e-05  34%  740 aa  AB1G_ARATH RecName: Full=ABC transporter G family member 1;        
 1585::1686    6e-05  35% 1882 aa  AB1A_ARATH RecName: Full=ABC transporter A family member 1;       
  757::865     6e-05  27% 1539 aa  AB14C_ARATH RecName: Full=ABC transporter C family member 14;      
  151::236     6e-05  35%  678 aa  AB13G_ARATH RecName: Full=ABC transporter G family member 13;      
  500::592     6e-05  28% 1273 aa  AB12B_ARATH RecName: Full=ABC transporter B family member 12;      
  106::209     8e-05  34%  256 aa  ZNUC_SILPO RecName: Full=Zinc import ATP-binding protein znuC;     
  101::195     8e-05  30%  262 aa  ZNUC_PSEU2 RecName: Full=Zinc import ATP-binding protein znuC;     
  101::150     8e-05  48%  252 aa  ZNUC_ERWCT RecName: Full=Zinc import ATP-binding protein znuC;     
  449::550     8e-05  35%  593 aa  YOX6_SCHPO RecName: Full=Uncharacterized ABC transporter
  472::564     8e-05  27%  580 aa  YGAD_BACSU RecName: Full=Putative multidrug export
  174::267     8e-05  30%  281 aa  Y3926_AZOC5 RecName: Full=Probable ABC transporter ATP-binding
  113::223     8e-05  31%  232 aa  Y2317_HALSA RecName: Full=Putative ABC transporter ATP-binding
  403::459     8e-05  32%  519 aa  RBSA2_RUBXD RecName: Full=Ribose import ATP-binding protein rbsA 2;
  114::189     8e-05  30%  239 aa  PSTB1_THETN RecName: Full=Phosphate import ATP-binding protein pstB
  135::253     8e-05  29%  426 aa  POTA_LACLS RecName: Full=Spermidine/putrescine import ATP-binding
  135::253     8e-05  29%  428 aa  POTA_LACLA RecName: Full=Spermidine/putrescine import ATP-binding
  127::233     8e-05  30%  256 aa  PHNC_LACPL RecName: Full=Phosphonates import ATP-binding protein
  130::256     8e-05  30%  277 aa  PHNC2_RHOFD RecName: Full=Phosphonates import ATP-binding protein
  134::251     8e-05  31%  277 aa  PHNC2_PSE14 RecName: Full=Phosphonates import ATP-binding protein
  165::255     8e-05  30%  335 aa  NODI1_RHIME RecName: Full=Nod factor export ATP-binding protein I; 
  465::556     8e-05  32%  587 aa  NDVA_RHIEC RecName: Full=Beta-(1-->2)glucan export
 1147::1256    8e-05  32% 1268 aa  MDR3_CAEEL RecName: Full=Multidrug resistance protein 3;       
  138::212     8e-05  24%  641 aa  MACB_CAMJJ RecName: Full=Macrolide export ATP-binding/permease
  137::225     8e-05  27%  242 aa  GLNQ_BACSU RecName: Full=Glutamine transport ATP-binding protein
  273::376     8e-05  31%  433 aa  CBIO1_UREPA RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  141::234     8e-05  32%  279 aa  CBIO1_OCEIH RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  142::234     8e-05  26%  274 aa  CBIO1_MYCGE RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  137::239     8e-05  23%  240 aa  ARTM_BACSU RecName: Full=Arginine transport ATP-binding protein
  720::807     8e-05  28%  842 aa  ABCB6_HUMAN RecName: Full=ATP-binding cassette sub-family B member
  461::563     8e-05  33%  605 aa  AB2E_ARATH RecName: Full=ABC transporter E family member 2;        
  529::628     8e-05  28%  644 aa  AB27B_ARATH RecName: Full=ABC transporter B family member 27;      
  503::589     8e-05  28% 1245 aa  AB13B_ARATH RecName: Full=ABC transporter B family member 13;      
  106::212     1e-04  34%  299 aa  ZNUC_AGRT5 RecName: Full=Zinc import ATP-binding protein znuC;     
  143::234     1e-04  31%  574 aa  Y5533_VIBVU RecName: Full=Putative ABC transporter ATP-binding
  143::234     1e-04  30%  579 aa  Y5482_VIBPA RecName: Full=Putative ABC transporter ATP-binding
  138::230     1e-04  39%  283 aa  Y4342_METAC RecName: Full=Putative ABC transporter ATP-binding
  147::205     1e-04  47%  276 aa  Y4021_METAC RecName: Full=Putative ABC transporter ATP-binding
  424::490     1e-04  27%  558 aa  Y1680_STRA3 RecName: Full=Putative ABC transporter ATP-binding
  391::476     1e-04  26%  503 aa  RBSA_RHOSR RecName: Full=Ribose import ATP-binding protein rbsA;   
  408::504     1e-04  30%  517 aa  RBSA_BURPS RecName: Full=Ribose import ATP-binding protein rbsA;   
  408::504     1e-04  30%  517 aa  RBSA2_BURP1 RecName: Full=Ribose import ATP-binding protein rbsA 2;
  383::501     1e-04  24%  522 aa  RBSA1_STRAW RecName: Full=Ribose import ATP-binding protein rbsA 1;
  408::515     1e-04  32%  517 aa  RBSA1_BURS3 RecName: Full=Ribose import ATP-binding protein rbsA 1;
  145::239     1e-04  31%  260 aa  PHNC2_TRIEI RecName: Full=Phosphonates import ATP-binding protein
  493::585     1e-04  31%  601 aa  MSBA_SHESR RecName: Full=Lipid A export ATP-binding/permease
  493::585     1e-04  31%  601 aa  MSBA_SHESM RecName: Full=Lipid A export ATP-binding/permease
  493::585     1e-04  31%  601 aa  MSBA_SHEON RecName: Full=Lipid A export ATP-binding/permease
  743::832     1e-04  29% 1523 aa  MRP3_MOUSE RecName: Full=Canalicular multispecific organic anion
  146::220     1e-04  27%  653 aa  MACB_BRAJA RecName: Full=Macrolide export ATP-binding/permease
  139::242     1e-04  29%  244 aa  LOLD_RALSO RecName: Full=Lipoprotein-releasing system ATP-binding
  125::173     1e-04  45%  232 aa  LOLD_PSEHT RecName: Full=Lipoprotein-releasing system ATP-binding
  146::221     1e-04  31%  228 aa  LOLD_HYPNA RecName: Full=Lipoprotein-releasing system ATP-binding
  607::704     1e-04  32%  715 aa  LCNCL_LACLA RecName: Full=Lactococcin transport/processing
  622::706     1e-04  29%  717 aa  COMA_STRR6 RecName: Full=Transport/processing ATP-binding protein
  622::706     1e-04  29%  717 aa  COMA_STRPN RecName: Full=Transport/processing ATP-binding protein
  132::230     1e-04  28%  271 aa  CBIO_SALTI RecName: Full=Cobalt import ATP-binding protein cbiO;   
  132::230     1e-04  28%  271 aa  CBIO_SALPA RecName: Full=Cobalt import ATP-binding protein cbiO;   
  122::224     1e-04  32%  276 aa  CBIO_MOOTA RecName: Full=Cobalt import ATP-binding protein cbiO;   
  135::238     1e-04  27%  279 aa  CBIO_METJA RecName: Full=Putative cobalt import ATP-binding protein
  116::237     1e-04  32%  277 aa  CBIO1_METHJ RecName: Full=Cobalt import ATP-binding protein cbiO 1;
 1290::1378    1e-04  35% 1407 aa  AB6B_ARATH RecName: Full=ABC transporter B family member 6;       
  513::605     1e-04  28% 1278 aa  AB11B_ARATH RecName: Full=ABC transporter B family member 11;      
  463::550     1e-04  28%  575 aa  YWJA_BACSU RecName: Full=Uncharacterized ABC transporter
  839::930     1e-04  27% 1294 aa  YO075_YEAST RecName: Full=Uncharacterized ABC transporter
  468::561     1e-04  28%  585 aa  YHEI_BACSU RecName: Full=Probable multidrug resistance ABC
  136::234     1e-04  29%  280 aa  YCOBB_RHOCA RecName: Full=Putative ABC transporter ATP-binding
  131::215     1e-04  30%  225 aa  YBBL_ECOLI RecName: Full=Uncharacterized ABC transporter
  430::534     1e-04  29%  566 aa  Y2641_BACAN RecName: Full=Putative ABC transporter ATP-binding
  430::534     1e-04  29%  566 aa  Y2424_BACHK RecName: Full=Putative ABC transporter ATP-binding
  141::248     1e-04  29%  530 aa  Y1893_SULSO RecName: Full=Putative ABC transporter ATP-binding
  398::499     1e-04  27%  524 aa  RBSA_CORGL RecName: Full=Ribose import ATP-binding protein rbsA;   
  144::234     1e-04  30%  257 aa  PSTB_SULSO RecName: Full=Phosphate import ATP-binding protein pstB;
  140::235     1e-04  31%  279 aa  PHNC_RHIME RecName: Full=Phosphonates import ATP-binding protein
  124::234     1e-04  30%  280 aa  PHNC_RHIL3 RecName: Full=Phosphonates import ATP-binding protein
  140::231     1e-04  29%  252 aa  PHNC1_TRIEI RecName: Full=Phosphonates import ATP-binding protein
  135::225     1e-04  30%  305 aa  NODI_BRASS RecName: Full=Nod factor export ATP-binding protein I;  
  501::594     1e-04  29%  609 aa  MSBA_FRATO RecName: Full=Lipid A export ATP-binding/permease
  501::594     1e-04  29%  609 aa  MSBA_FRATH RecName: Full=Lipid A export ATP-binding/permease
  742::831     1e-04  29% 1522 aa  MRP3_RAT RecName: Full=Canalicular multispecific organic anion
  744::833     1e-04  29% 1527 aa  MRP3_HUMAN RecName: Full=Canalicular multispecific organic anion
  123::221     1e-04  33%  372 aa  MALK_VIBPA RecName: Full=Maltose/maltodextrin import ATP-binding
  134::221     1e-04  33%  371 aa  MALK_SHISS RecName: Full=Maltose/maltodextrin import ATP-binding
  134::221     1e-04  33%  371 aa  MALK_SHIFL RecName: Full=Maltose/maltodextrin import ATP-binding
  134::221     1e-04  33%  371 aa  MALK_SHIF8 RecName: Full=Maltose/maltodextrin import ATP-binding
  134::221     1e-04  33%  371 aa  MALK_ECOUT RecName: Full=Maltose/maltodextrin import ATP-binding
  134::221     1e-04  33%  371 aa  MALK_ECOLI RecName: Full=Maltose/maltodextrin import ATP-binding
  134::221     1e-04  33%  371 aa  MALK_ECOL6 RecName: Full=Maltose/maltodextrin import ATP-binding
  134::221     1e-04  33%  371 aa  MALK_ECOL5 RecName: Full=Maltose/maltodextrin import ATP-binding
  134::221     1e-04  33%  371 aa  MALK_ECO57 RecName: Full=Maltose/maltodextrin import ATP-binding
  146::212     1e-04  27%  647 aa  MACB_SHESW RecName: Full=Macrolide export ATP-binding/permease
  122::215     1e-04  29%  651 aa  MACB_CHLTE RecName: Full=Macrolide export ATP-binding/permease
  140::214     1e-04  29%  650 aa  MACB_BDEBA RecName: Full=Macrolide export ATP-binding/permease
  393::515     1e-04  26%  527 aa  LSRA_YERE8 RecName: Full=Autoinducer 2 import ATP-binding protein
  381::433     1e-04  33%  511 aa  LSRA_PHOLL RecName: Full=Autoinducer 2 import ATP-binding protein
  126::224     1e-04  31%  233 aa  LOLD_SHEDO RecName: Full=Lipoprotein-releasing system ATP-binding
  140::231     1e-04  30%  237 aa  LOLD_CHRSD RecName: Full=Lipoprotein-releasing system ATP-binding
  124::217     1e-04  29%  222 aa  HRTA_STAS1 RecName: Full=Putative hemin import ATP-binding protein
  121::225     1e-04  32%  233 aa  CCMA_PSEAE RecName: Full=Cytochrome c biogenesis ATP-binding export
  146::232     1e-04  33%  281 aa  CBIO3_CLOP1 RecName: Full=Cobalt import ATP-binding protein cbiO 3;
  146::232     1e-04  33%  281 aa  CBIO2_CLOPS RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  146::232     1e-04  33%  281 aa  CBIO2_CLOPE RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  127::223     1e-04  31%  255 aa  BTUD_VIBPA RecName: Full=Vitamin B12 import ATP-binding protein
  120::209     1e-04  30%  249 aa  BTUD_CITK8 RecName: Full=Vitamin B12 import ATP-binding protein
  401::464     1e-04  30%  513 aa  ARAG_BACST RecName: Full=L-arabinose transport ATP-binding protein
 1910::1983    1e-04  31% 2146 aa  ABCA7_HUMAN RecName: Full=ATP-binding cassette sub-family A member
  609::658     1e-04  48% 1615 aa  ABCA4_DICDI RecName: Full=ABC transporter A family member
  534::609     1e-04  31%  634 aa  AB29B_ARATH RecName: Full=ABC transporter B family member 29;      
 1114::1226    1e-04  29% 1240 aa  AB15B_ARATH RecName: Full=ABC transporter B family member 15;        
  113::212     2e-04  34%  302 aa  ZNUC_RHIME RecName: Full=Zinc import ATP-binding protein znuC;     
  131::189     2e-04  31%  301 aa  YVFR_BACSU RecName: Full=Uncharacterized ABC transporter
  147::225     2e-04  29%  248 aa  Y986_MYCTU RecName: Full=Uncharacterized ABC transporter
  146::238     2e-04  31%  568 aa  Y1583_CLOPE RecName: Full=Putative ABC transporter ATP-binding
  142::216     2e-04  28%  224 aa  Y1508_METJA RecName: Full=Uncharacterized ABC transporter
  103::181     2e-04  33%  240 aa  Y124_THEMA RecName: Full=Probable metal transport system
  176::264     2e-04  35%  539 aa  Y1242_METJA RecName: Full=Uncharacterized ABC transporter
  388::489     2e-04  27%  501 aa  RBSA_SHISS RecName: Full=Ribose import ATP-binding protein rbsA;   
  388::489     2e-04  27%  501 aa  RBSA_SALTY RecName: Full=Ribose import ATP-binding protein rbsA;   
  388::489     2e-04  27%  501 aa  RBSA_SALTI RecName: Full=Ribose import ATP-binding protein rbsA;   
  388::489     2e-04  27%  501 aa  RBSA_SALPA RecName: Full=Ribose import ATP-binding protein rbsA;   
  388::489     2e-04  27%  501 aa  RBSA_SALCH RecName: Full=Ribose import ATP-binding protein rbsA;   
  390::490     2e-04  28%  496 aa  RBSA_OCEIH RecName: Full=Ribose import ATP-binding protein rbsA;   
  388::489     2e-04  27%  501 aa  RBSA_ECOUT RecName: Full=Ribose import ATP-binding protein rbsA;   
  388::489     2e-04  27%  501 aa  RBSA_ECOLI RecName: Full=Ribose import ATP-binding protein rbsA;   
  388::489     2e-04  27%  501 aa  RBSA_ECOL6 RecName: Full=Ribose import ATP-binding protein rbsA;   
  388::489     2e-04  27%  501 aa  RBSA_ECOL5 RecName: Full=Ribose import ATP-binding protein rbsA;   
  392::452     2e-04  28%  496 aa  RBSA_BACCR RecName: Full=Ribose import ATP-binding protein rbsA;   
  388::489     2e-04  27%  501 aa  RBSA1_ECO57 RecName: Full=Ribose import ATP-binding protein rbsA 1;
  408::515     2e-04  30%  517 aa  RBSA1_BURCM RecName: Full=Ribose import ATP-binding protein rbsA 1;
  408::515     2e-04  30%  517 aa  RBSA1_BURCH RecName: Full=Ribose import ATP-binding protein rbsA 1;
  408::515     2e-04  30%  517 aa  RBSA1_BURCA RecName: Full=Ribose import ATP-binding protein rbsA 1;
  146::233     2e-04  31%  275 aa  PHNC_WOLSU RecName: Full=Phosphonates import ATP-binding protein
  134::240     2e-04  33%  279 aa  PHNC2_RALME RecName: Full=Phosphonates import ATP-binding protein
  147::234     2e-04  31%  244 aa  PHNC2_BACHD RecName: Full=Phosphonates import ATP-binding protein
  143::237     2e-04  32%  244 aa  PHNC2_ANASP RecName: Full=Phosphonates import ATP-binding protein
  134::251     2e-04  30%  284 aa  PHNC1_RALME RecName: Full=Phosphonates import ATP-binding protein
  985::1074    2e-04  30% 1441 aa  PDR13_ORYSJ RecName: Full=Pleiotropic drug resistance protein 13;
  465::551     2e-04  29%  599 aa  NDVA_BRUSU RecName: Full=Beta-(1-->2)glucan export
  465::551     2e-04  29%  599 aa  NDVA_BRUME RecName: Full=Beta-(1-->2)glucan export
  465::551     2e-04  29%  599 aa  NDVA_BRUAB RecName: Full=Beta-(1-->2)glucan export
  465::551     2e-04  29%  599 aa  NDVA_BRUA2 RecName: Full=Beta-(1-->2)glucan export
   30::135     2e-04  26%  324 aa  NAP5_ARATH RecName: Full=Probable non-intrinsic ABC protein
  480::573     2e-04  31%  590 aa  LMRA_LACLA RecName: Full=Multidrug resistance ABC transporter
  607::690     2e-04  46%  703 aa  LAGD_LACLA RecName: Full=Lactococcin-G-processing and transport
  135::232     2e-04  34%  273 aa  HMUV_SALRD RecName: Full=Hemin import ATP-binding protein hmuV;    
  119::219     2e-04  37%  270 aa  HMUV_RHOP5 RecName: Full=Hemin import ATP-binding protein hmuV;    
  137::222     2e-04  28%  242 aa  GLNQ_BACST RecName: Full=Glutamine transport ATP-binding protein
  135::168     2e-04  47%  273 aa  CBRD_DICD3 RecName: Full=Achromobactin transport ATP-binding
  132::230     2e-04  28%  271 aa  CBIO_SALTY RecName: Full=Cobalt import ATP-binding protein cbiO;   
  145::231     2e-04  28%  288 aa  CBIO2_LACLM RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  132::233     2e-04  32%  289 aa  CBIO2_ENTFA RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  124::236     2e-04  28%  252 aa  BTUD_VIBSL RecName: Full=Vitamin B12 import ATP-binding protein
  146::232     2e-04  26%  730 aa  ABCGK_DICDI RecName: Full=ABC transporter G family member
 1211::1307    2e-04  30% 1321 aa  ABCBB_HUMAN RecName: Full=Bile salt export pump;AltName:
 1922::2008    2e-04  32% 2170 aa  ABCA7_RAT RecName: Full=ATP-binding cassette sub-family A member 7;
 1911::1997    2e-04  32% 2159 aa  ABCA7_MOUSE RecName: Full=ATP-binding cassette sub-family A member 7;
 1167::1255    2e-04  28% 1323 aa  AB9B_ARATH RecName: Full=ABC transporter B family member 9;       
  740::835     2e-04  27% 1514 aa  AB5C_ARATH RecName: Full=ABC transporter C family member 5;        
  965::1039    2e-04  31% 1426 aa  AB31G_ARATH RecName: Full=ABC transporter G family member 31;        
  287::380     2e-04  30%  751 aa  AB22G_ARATH RecName: Full=ABC transporter G family member 22;      
 1136::1248    2e-04  30% 1262 aa  AB22B_ARATH RecName: Full=ABC transporter B family member 22;        
  103::201     2e-04  32%  261 aa  ZNUC_SACD2 RecName: Full=Zinc import ATP-binding protein znuC;     
  119::225     2e-04  30%  243 aa  ZNUC_PSYCK RecName: Full=Zinc import ATP-binding protein znuC;     
  119::225     2e-04  30%  243 aa  ZNUC_PSYA2 RecName: Full=Zinc import ATP-binding protein znuC;     
  139::196     2e-04  31%  277 aa  YRIBC_METTM RecName: Full=Putative ABC transporter ATP-binding
  143::224     2e-04  30%  911 aa  YHIH_ECOLI RecName: Full=Uncharacterized ABC transporter
  134::205     2e-04  32%  296 aa  YFEB_YERPE RecName: Full=Chelated iron transport system membrane
  122::199     2e-04  29%  259 aa  Y348_CHLPN RecName: Full=Probable metal transport system
   53::234     2e-04  28%  558 aa  Y1934_STRMU RecName: Full=Putative ABC transporter ATP-binding
  424::490     2e-04  25%  558 aa  Y1633_STRA5 RecName: Full=Putative ABC transporter ATP-binding
  398::461     2e-04  30%  505 aa  XYLG_THEP3 RecName: Full=Xylose import ATP-binding protein xylG;   
  118::210     2e-04  36%  238 aa  THIQ_RHIME RecName: Full=Thiamine import ATP-binding protein thiQ; 
  106::195     2e-04  29%  229 aa  SRTF_STRPY RecName: Full=Lantibiotic transport ATP-binding protein
  106::195     2e-04  29%  229 aa  SRTF_STRP1 RecName: Full=Lantibiotic transport ATP-binding protein
  388::451     2e-04  28%  501 aa  RBSA_PHOLL RecName: Full=Ribose import ATP-binding protein rbsA;   
  390::450     2e-04  28%  494 aa  RBSA_BACHK RecName: Full=Ribose import ATP-binding protein rbsA;   
  390::450     2e-04  28%  494 aa  RBSA_BACCZ RecName: Full=Ribose import ATP-binding protein rbsA;   
  390::450     2e-04  28%  494 aa  RBSA_BACC1 RecName: Full=Ribose import ATP-binding protein rbsA;   
  390::450     2e-04  28%  494 aa  RBSA_BACAN RecName: Full=Ribose import ATP-binding protein rbsA;   
  392::455     2e-04  31%  506 aa  RBSA2_AGRT5 RecName: Full=Ribose import ATP-binding protein rbsA 2;
  407::466     2e-04  30%  510 aa  RBSA1_AGRT5 RecName: Full=Ribose import ATP-binding protein rbsA 1;
  779::864     2e-04  31%  879 aa  RAD50_PYRHO RecName: Full=DNA double-strand break repair rad50
  786::879     2e-04  32%  880 aa  RAD50_PYRAB RecName: Full=DNA double-strand break repair rad50
  133::243     2e-04  28%  275 aa  PTXA_PSEST RecName: Full=Phosphite import ATP-binding protein pxtA;
  151::238     2e-04  30%  249 aa  PHNC_MESFL RecName: Full=Phosphonates import ATP-binding protein
  134::221     2e-04  33%  369 aa  MALK_SALTY RecName: Full=Maltose/maltodextrin import ATP-binding
  134::221     2e-04  33%  369 aa  MALK_SALTI RecName: Full=Maltose/maltodextrin import ATP-binding
  134::221     2e-04  33%  369 aa  MALK_SALPA RecName: Full=Maltose/maltodextrin import ATP-binding
  134::221     2e-04  33%  369 aa  MALK_SALCH RecName: Full=Maltose/maltodextrin import ATP-binding
  381::433     2e-04  33%  511 aa  LSRA_PHOLU RecName: Full=Autoinducer 2 import ATP-binding protein
  140::234     2e-04  29%  244 aa  LOLD_XANC5 RecName: Full=Lipoprotein-releasing system ATP-binding
  134::222     2e-04  32%  227 aa  LOLD_PSEAE RecName: Full=Lipoprotein-releasing system ATP-binding
  137::228     2e-04  29%  234 aa  LOLD_BRAJA RecName: Full=Lipoprotein-releasing system ATP-binding
  480::573     2e-04  31%  590 aa  LMRA_LACLM RecName: Full=Multidrug resistance ABC transporter
  133::161     2e-04  59%  236 aa  LIVF_ARCFU RecName: Full=Probable branched-chain amino acid
  119::230     2e-04  36%  269 aa  HMUV_RHOPB RecName: Full=Hemin import ATP-binding protein hmuV;    
  135::238     2e-04  27%  278 aa  CBIO_METMP RecName: Full=Cobalt import ATP-binding protein cbiO;   
  146::232     2e-04  29%  281 aa  CBIO2_CLOTE RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  137::233     2e-04  30%  272 aa  CBIO1_LEUMM RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  120::209     2e-04  32%  250 aa  BTUD_ERWCT RecName: Full=Vitamin B12 import ATP-binding protein
  566::666     2e-04  31%  690 aa  ATM1_YEAST RecName: Full=Iron-sulfur clusters transporter ATM1,
  213::271     2e-04  34%  673 aa  ABCG8_HUMAN RecName: Full=ATP-binding cassette sub-family G member
  204::274     2e-04  31%  678 aa  ABCG1_HUMAN RecName: Full=ATP-binding cassette sub-family G member
  585::676     2e-04  29% 1359 aa  ABCC1_DICDI RecName: Full=ABC transporter C family member
  183::261     2e-04  29%  648 aa  AB14G_ARATH RecName: Full=ABC transporter G family member 14;      
  464::548     3e-04  32%  578 aa  YBHF_SHIFL RecName: Full=Uncharacterized ABC transporter
  464::548     3e-04  32%  578 aa  YBHF_ECOLI RecName: Full=Uncharacterized ABC transporter
  135::227     3e-04  30%  293 aa  Y731_ARCFU RecName: Full=Putative ABC transporter ATP-binding
  119::225     3e-04  26%  269 aa  Y528_PYRFU RecName: Full=Putative ABC transporter ATP-binding
  380::452     3e-04  29%  501 aa  RGMG_THETN RecName: Full=Putative ribose/galactose/methyl
  380::448     3e-04  29%  492 aa  RBSA_STRA5 RecName: Full=Ribose import ATP-binding protein rbsA;   
  380::448     3e-04  29%  492 aa  RBSA_STRA3 RecName: Full=Ribose import ATP-binding protein rbsA;   
  380::448     3e-04  29%  492 aa  RBSA_STRA1 RecName: Full=Ribose import ATP-binding protein rbsA;   
  399::482     3e-04  29%  511 aa  RBSA_RHOBA RecName: Full=Ribose import ATP-binding protein rbsA;   
  381::457     3e-04  27%  513 aa  RBSA3_RHIL3 RecName: Full=Ribose import ATP-binding protein rbsA 3;
  787::881     3e-04  29%  882 aa  RAD50_PYRFU RecName: Full=DNA double-strand break repair rad50
  144::233     3e-04  28%  268 aa  PSTB_GLUOX RecName: Full=Phosphate import ATP-binding protein pstB;
  472::581     3e-04  25%  582 aa  MSBA_IDILO RecName: Full=Lipid A export ATP-binding/permease
  122::216     3e-04  29%  367 aa  MODC_GRABC RecName: Full=Molybdenum import ATP-binding protein
  579::685     3e-04  31%  773 aa  MDL2_YEAST RecName: Full=ATP-dependent permease MDL2,
  135::229     3e-04  29%  239 aa  LOLD_XANCP RecName: Full=Lipoprotein-releasing system ATP-binding
  135::229     3e-04  29%  239 aa  LOLD_XANC8 RecName: Full=Lipoprotein-releasing system ATP-binding
  129::212     3e-04  31%  228 aa  LOLD_VIBCH RecName: Full=Lipoprotein-releasing system ATP-binding
  148::247     3e-04  31%  249 aa  LOLD_RALME RecName: Full=Lipoprotein-releasing system ATP-binding
  607::704     3e-04  32%  715 aa  LCNC_LACLA RecName: Full=Lactococcin-A transport/processing
  131::229     3e-04  36%  261 aa  HMUV_RHOPS RecName: Full=Hemin import ATP-binding protein hmuV;    
  119::200     3e-04  39%  262 aa  HMUV_RHOP2 RecName: Full=Hemin import ATP-binding protein hmuV;    
  111::184     3e-04  31%  200 aa  CCMA_RHOPB RecName: Full=Cytochrome c biogenesis ATP-binding export
  146::246     3e-04  27%  287 aa  CBIO2_STAHJ RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  144::231     3e-04  30%  286 aa  CBIO1_THETN RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  143::235     3e-04  26%  274 aa  CBIO1_MYCPN RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  135::211     3e-04  33%  234 aa  ADCC_STRR6 RecName: Full=Zinc transport system ATP-binding protein
  135::211     3e-04  33%  234 aa  ADCC_STRPN RecName: Full=Zinc transport system ATP-binding protein
  588::679     3e-04  28% 1350 aa  ABCCD_DICDI RecName: Full=ABC transporter C family member
  617::750     3e-04  30%  762 aa  ABCB9_MOUSE RecName: Full=ATP-binding cassette sub-family B member
  233::320     3e-04  30%  727 aa  AB6G_ARATH RecName: Full=ABC transporter G family member 6;        
 1099::1200    3e-04  30% 1225 aa  AB18B_ARATH RecName: Full=ABC transporter B family member 18;        
  656::737     3e-04  24% 1389 aa  AB10C_ARATH RecName: Full=ABC transporter C family member 10;      
  109::159     4e-04  45%  260 aa  ZNUC_MAGSM RecName: Full=Zinc import ATP-binding protein znuC;     
  114::156     4e-04  47%  264 aa  ZNUC_HAES1 RecName: Full=Zinc import ATP-binding protein znuC;     
  440::472     4e-04  52%  642 aa  YDIF_BACSU RecName: Full=Uncharacterized ABC transporter
  410::511     4e-04  27%  527 aa  Y804_OCEIH RecName: Full=Putative ABC transporter ATP-binding
  467::559     4e-04  34%  575 aa  Y492_RICBR RecName: Full=Putative export ATP-binding/permease
  141::230     4e-04  26%  247 aa  TCYC_BACSU RecName: Full=L-cystine import ATP-binding protein tcyC;
  703::784     4e-04  31%  808 aa  TAP1_HUMAN RecName: Full=Antigen peptide transporter 1;       
  103::211     4e-04  32%  242 aa  SSUB1_PARDP RecName: Full=Aliphatic sulfonates import ATP-binding
  416::479     4e-04  33%  525 aa  RGMG_PSEU2 RecName: Full=Putative ribose/galactose/methyl
  416::479     4e-04  33%  525 aa  RGMG_PSESM RecName: Full=Putative ribose/galactose/methyl
  408::471     4e-04  34%  515 aa  RGMG_PSEF5 RecName: Full=Putative ribose/galactose/methyl
  391::474     4e-04  28%  522 aa  RGMG_BACHD RecName: Full=Putative ribose/galactose/methyl
  401::464     4e-04  30%  513 aa  RGMG3_BURCM RecName: Full=Putative ribose/galactose/methyl
  390::450     4e-04  28%  499 aa  RBSA_BACSK RecName: Full=Ribose import ATP-binding protein rbsA;   
  408::508     4e-04  31%  517 aa  RBSA2_BURTA RecName: Full=Ribose import ATP-binding protein rbsA 2;
  387::479     4e-04  28%  499 aa  RBSA1_RUBXD RecName: Full=Ribose import ATP-binding protein rbsA 1;
  122::233     4e-04  32%  258 aa  PHNC3_BACHD RecName: Full=Phosphonates import ATP-binding protein
  117::232     4e-04  29%  262 aa  PHNC3_ANASP RecName: Full=Phosphonates import ATP-binding protein
  145::232     4e-04  33%  274 aa  PHNC2_RHOP2 RecName: Full=Phosphonates import ATP-binding protein
  985::1060    4e-04  25% 1447 aa  PDR3_TOBAC RecName: Full=Pleiotropic drug resistance protein
  138::240     4e-04  25%  257 aa  NOCP_AGRT5 RecName: Full=Nopaline permease ATP-binding protein P;
  494::597     4e-04  27%  602 aa  MSBA1_COLP3 RecName: Full=Lipid A export ATP-binding/permease
  137::194     4e-04  45%  250 aa  MNTB_BACHD RecName: Full=Manganese transport system ATP-binding
  146::206     4e-04  30%  260 aa  MNTA_SYNY3 RecName: Full=Manganese transport system ATP-binding
  389::453     4e-04  26%  497 aa  MGLA_TREDE RecName: Full=Galactose/methyl galactoside import
  140::263     4e-04  31%  365 aa  METN_PROAC RecName: Full=Methionine import ATP-binding protein
  146::207     4e-04  29%  645 aa  MACB_NITWN RecName: Full=Macrolide export ATP-binding/permease
  151::226     4e-04  29%  232 aa  LOLD_ZYMMO RecName: Full=Lipoprotein-releasing system ATP-binding
  140::234     4e-04  29%  244 aa  LOLD_XANAC RecName: Full=Lipoprotein-releasing system ATP-binding
  122::221     4e-04  28%  238 aa  LOLD_VIBF1 RecName: Full=Lipoprotein-releasing system ATP-binding
  130::221     4e-04  29%  229 aa  LOLD_MESSB RecName: Full=Lipoprotein-releasing system ATP-binding
  138::233     4e-04  31%  259 aa  HMUV_VIBF1 RecName: Full=Hemin import ATP-binding protein hmuV;    
  136::232     4e-04  32%  259 aa  HMUV_VIBCH RecName: Full=Hemin import ATP-binding protein hmuV;    
  468::562     4e-04  31%  576 aa  CYDC_HAEIN RecName: Full=ATP-binding/permease protein cydC;
  140::190     4e-04  45%  258 aa  CCMA_GRABC RecName: Full=Cytochrome c biogenesis ATP-binding export
  149::237     4e-04  32%  287 aa  CBIO2_SYMTH RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  145::231     4e-04  26%  288 aa  CBIO2_LACLA RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  150::222     4e-04  29%  308 aa  CBIO1_MYCMO RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  141::228     4e-04  30%  280 aa  CBIO1_BACHK RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  128::224     4e-04  28%  278 aa  CBIO1_BACHD RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  141::228     4e-04  30%  280 aa  CBIO1_BACC1 RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  141::228     4e-04  30%  280 aa  CBIO1_BACAN RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  141::228     4e-04  30%  280 aa  CBIO1_BACAH RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  107::209     4e-04  32%  249 aa  BTUD_SALTY RecName: Full=Vitamin B12 import ATP-binding protein
  107::209     4e-04  32%  249 aa  BTUD_SALTI RecName: Full=Vitamin B12 import ATP-binding protein
  107::209     4e-04  32%  249 aa  BTUD_SALPK RecName: Full=Vitamin B12 import ATP-binding protein
  107::209     4e-04  32%  249 aa  BTUD_SALPA RecName: Full=Vitamin B12 import ATP-binding protein
  107::209     4e-04  32%  249 aa  BTUD_SALHS RecName: Full=Vitamin B12 import ATP-binding protein
  107::209     4e-04  32%  249 aa  BTUD_SALEP RecName: Full=Vitamin B12 import ATP-binding protein
  107::209     4e-04  32%  249 aa  BTUD_SALDC RecName: Full=Vitamin B12 import ATP-binding protein
  107::209     4e-04  32%  249 aa  BTUD_SALCH RecName: Full=Vitamin B12 import ATP-binding protein
  120::229     4e-04  32%  249 aa  BTUD_ECOUT RecName: Full=Vitamin B12 import ATP-binding protein
  120::229     4e-04  32%  249 aa  BTUD_ECOL6 RecName: Full=Vitamin B12 import ATP-binding protein
  120::229     4e-04  32%  249 aa  BTUD_ECOL5 RecName: Full=Vitamin B12 import ATP-binding protein
  120::229     4e-04  32%  249 aa  BTUD_ECOK1 RecName: Full=Vitamin B12 import ATP-binding protein
  120::229     4e-04  32%  249 aa  BTUD_ECO81 RecName: Full=Vitamin B12 import ATP-binding protein
  120::229     4e-04  32%  249 aa  BTUD_ECO45 RecName: Full=Vitamin B12 import ATP-binding protein
  120::229     4e-04  32%  249 aa  BTUD_ECO27 RecName: Full=Vitamin B12 import ATP-binding protein
  169::286     4e-04  29%  657 aa  ABCG2_MOUSE RecName: Full=ATP-binding cassette sub-family G member
  805::895     4e-04  27% 1549 aa  ABCC9_RABIT RecName: Full=ATP-binding cassette transporter
  620::711     4e-04  28% 1384 aa  ABCC2_DICDI RecName: Full=ABC transporter C family member
  617::725     4e-04  30%  762 aa  ABCB9_RAT RecName: Full=ATP-binding cassette sub-family B member
  720::807     4e-04  28%  842 aa  ABCB6_MOUSE RecName: Full=ATP-binding cassette sub-family B member
  748::854     4e-04  26% 1490 aa  AB9C_ARATH RecName: Full=ABC transporter C family member 9;        
  138::232     4e-04  28%  577 aa  AB4G_ARATH RecName: Full=ABC transporter G family member 4;        
  573::683     4e-04  32%  700 aa  AB26B_ARATH RecName: Full=ABC transporter B family member 26,
  137::227     5e-04  31%  266 aa  YFMF_BACSU RecName: Full=Fe(3+)-citrate import ATP-binding protein
  126::233     5e-04  29%  453 aa  Y3551_METAC RecName: Full=Putative ABC transporter ATP-binding
  434::549     5e-04  28%  570 aa  Y2766_STAAR RecName: Full=Putative ABC transporter ATP-binding
  434::549     5e-04  28%  570 aa  Y2708_STAAC RecName: Full=Putative ABC transporter ATP-binding
  434::549     5e-04  28%  570 aa  Y2684_STAAM RecName: Full=Putative ABC transporter ATP-binding
  430::534     5e-04  27%  566 aa  Y2668_BACC1 RecName: Full=Putative ABC transporter ATP-binding
  434::549     5e-04  28%  570 aa  Y2603_STAAW RecName: Full=Putative ABC transporter ATP-binding
  434::549     5e-04  28%  570 aa  Y2569_STAAS RecName: Full=Putative ABC transporter ATP-binding
  434::549     5e-04  28%  570 aa  Y2476_STAAN RecName: Full=Putative ABC transporter ATP-binding
  146::247     5e-04  30%  568 aa  Y2153_ENTFA RecName: Full=Putative ABC transporter ATP-binding
 1659::1745    5e-04  32% 1906 aa  TAGB_DICDI RecName: Full=Prestalk-specific protein tagB;       
  416::479     5e-04  33%  525 aa  RGMG_PSE14 RecName: Full=Putative ribose/galactose/methyl
  404::467     5e-04  28%  511 aa  RBSA3_RHIEC RecName: Full=Ribose import ATP-binding protein rbsA 3;
  395::510     5e-04  22%  512 aa  RBSA1_RHIL3 RecName: Full=Ribose import ATP-binding protein rbsA 1;
  150::224     5e-04  28%  260 aa  PSTB1_CHRSD RecName: Full=Phosphate import ATP-binding protein pstB
  138::253     5e-04  27%  384 aa  POTA_STRA5 RecName: Full=Spermidine/putrescine import ATP-binding
  138::253     5e-04  27%  384 aa  POTA_STRA3 RecName: Full=Spermidine/putrescine import ATP-binding
  138::253     5e-04  27%  384 aa  POTA_STRA1 RecName: Full=Spermidine/putrescine import ATP-binding
  143::237     5e-04  31%  244 aa  PHNC_ANAVT RecName: Full=Phosphonates import ATP-binding protein
  134::240     5e-04  28%  284 aa  PHNC2_RALEH RecName: Full=Phosphonates import ATP-binding protein
  134::240     5e-04  30%  277 aa  PHNC2_PSESM RecName: Full=Phosphonates import ATP-binding protein
  135::229     5e-04  30%  242 aa  PEB1C_CAMJJ RecName: Full=Probable ABC transporter ATP-binding
  135::229     5e-04  30%  242 aa  PEB1C_CAMJE RecName: Full=Probable ABC transporter ATP-binding
  136::226     5e-04  30%  306 aa  NODI_BRAJA RecName: Full=Nod factor export ATP-binding protein I;  
  465::551     5e-04  29%  585 aa  NDVA_RHIME RecName: Full=Beta-(1-->2)glucan export
  472::556     5e-04  33%  590 aa  NDVA_RHILO RecName: Full=Beta-(1-->2)glucan export
  472::565     5e-04  28%  585 aa  MSBA_PSEA6 RecName: Full=Lipid A export ATP-binding/permease
  750::839     5e-04  31% 1541 aa  MRP2_RAT RecName: Full=Canalicular multispecific organic anion
  752::841     5e-04  31% 1543 aa  MRP2_MOUSE RecName: Full=Canalicular multispecific organic anion
  123::221     5e-04  32%  369 aa  MALK_VIBF1 RecName: Full=Maltose/maltodextrin import ATP-binding
  123::221     5e-04  32%  369 aa  MALK_PHOPR RecName: Full=Maltose/maltodextrin import ATP-binding
  144::210     5e-04  27%  643 aa  MACB_MANSM RecName: Full=Macrolide export ATP-binding/permease
  146::220     5e-04  44%  645 aa  MACB_HYPNA RecName: Full=Macrolide export ATP-binding/permease
  390::433     5e-04  32%  520 aa  LSRA_PHOTE RecName: Full=Autoinducer 2 import ATP-binding protein
  140::234     5e-04  29%  244 aa  LOLD_XANOR RecName: Full=Lipoprotein-releasing system ATP-binding
  140::234     5e-04  29%  244 aa  LOLD_XANOM RecName: Full=Lipoprotein-releasing system ATP-binding
  132::220     5e-04  30%  227 aa  LOLD_VIBVY RecName: Full=Lipoprotein-releasing system ATP-binding
  132::220     5e-04  30%  227 aa  LOLD_VIBVU RecName: Full=Lipoprotein-releasing system ATP-binding
  142::242     5e-04  31%  244 aa  LOLD_RALEJ RecName: Full=Lipoprotein-releasing system ATP-binding
  136::230     5e-04  36%  260 aa  HMUV_SODGM RecName: Full=Hemin import ATP-binding protein hmuV;    
  136::223     5e-04  30%  350 aa  FBPC_PSEPF RecName: Full=Fe(3+) ions import ATP-binding protein
  522::571     5e-04  36% 1045 aa  EF3_CANGA RecName: Full=Elongation factor 3;         Short=EF-3;
  134::235     5e-04  33%  270 aa  CBIO_CARHZ RecName: Full=Cobalt import ATP-binding protein cbiO;   
  145::247     5e-04  26%  300 aa  CBIO2_MYCHJ RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  145::247     5e-04  26%  300 aa  CBIO2_MYCH7 RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  145::247     5e-04  26%  300 aa  CBIO1_MYCH2 RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  565::665     5e-04  30%  691 aa  ATM1_ASHGO RecName: Full=Iron-sulfur clusters transporter ATM1,
  134::207     5e-04  26%  254 aa  AOTP_PSEAE RecName: Full=Arginine/ornithine transport ATP-binding
  173::281     5e-04  30%  651 aa  ABCG5_HUMAN RecName: Full=ATP-binding cassette sub-family G member
  170::243     5e-04  32%  656 aa  ABCG2_PIG RecName: Full=ATP-binding cassette sub-family G member
  169::242     5e-04  32%  655 aa  ABCG2_BOVIN RecName: Full=ATP-binding cassette sub-family G member
  720::807     5e-04  27%  836 aa  ABCB6_RAT RecName: Full=ATP-binding cassette sub-family B member 6,
  216::292     5e-04  32%  725 aa  AB7G_ARATH RecName: Full=ABC transporter G family member 7;        
  742::849     5e-04  26% 1493 aa  AB7C_ARATH RecName: Full=ABC transporter C family member 7;        
  116::143     5e-04  54%  181 aa  AB3E_ARATH RecName: Full=ABC transporter E family member 3;        
  758::846     5e-04  25% 1514 aa  AB3C_ARATH RecName: Full=ABC transporter C family member 3;        
  332::425     5e-04  26% 1037 aa  AB15C_ARATH RecName: Full=Putative ABC transporter C family member
  117::203     7e-04  33%  243 aa  ZNUC_RHOS4 RecName: Full=Zinc import ATP-binding protein znuC;     
  115::195     7e-04  30%  264 aa  ZNUC_PSESM RecName: Full=Zinc import ATP-binding protein znuC;     
  113::216     7e-04  31%  283 aa  ZNUC_MESSB RecName: Full=Zinc import ATP-binding protein znuC;     
  112::161     7e-04  42%  268 aa  ZNUC_HAEIN RecName: Full=Zinc import ATP-binding protein znuC;     
  451::552     7e-04  27%  585 aa  YKNU_BACSU RecName: Full=Uncharacterized ABC transporter
   51::205     7e-04  23%  491 aa  Y906_TREDE RecName: Full=Putative ABC transporter ATP-binding
  217::289     7e-04  33%  600 aa  Y719_METJA RecName: Full=Uncharacterized ABC transporter
  476::549     7e-04  31%  552 aa  Y664_HAEIN RecName: Full=Probable ABC transporter ATP-binding
  476::569     7e-04  28%  586 aa  Y4GM_RHISN RecName: Full=Uncharacterized ABC transporter
  138::234     7e-04  29%  289 aa  Y391_CHLTE RecName: Full=Putative ABC transporter ATP-binding
  443::492     7e-04  36%  569 aa  Y1589_THETN RecName: Full=Putative ABC transporter ATP-binding
  145::220     7e-04  29%  257 aa  Y1078_HAEIN RecName: Full=Probable amino-acid ABC transporter
  404::516     7e-04  25%  519 aa  XYLG_BURCM RecName: Full=Xylose import ATP-binding protein xylG;   
  210::300     7e-04  35%  666 aa  SCRT_DROME RecName: Full=Protein scarlet;
  393::456     7e-04  28%  511 aa  RBSA_SILST RecName: Full=Ribose import ATP-binding protein rbsA;   
  392::452     7e-04  28%  502 aa  RBSA_RHOS4 RecName: Full=Ribose import ATP-binding protein rbsA;   
  397::480     7e-04  25%  516 aa  RBSA_JANSC RecName: Full=Ribose import ATP-binding protein rbsA;   
  385::421     7e-04  41%  498 aa  RBSA_DEIGD RecName: Full=Ribose import ATP-binding protein rbsA;   
  390::450     7e-04  28%  499 aa  RBSA_BACHD RecName: Full=Ribose import ATP-binding protein rbsA;   
  381::454     7e-04  27%  512 aa  RBSA2_RHIME RecName: Full=Ribose import ATP-binding protein rbsA 2;
  405::468     7e-04  27%  512 aa  RBSA2_RHIL3 RecName: Full=Ribose import ATP-binding protein rbsA 2;
  404::467     7e-04  31%  520 aa  RBSA1_THEMA RecName: Full=Ribose import ATP-binding protein rbsA 1;
  394::479     7e-04  25%  505 aa  RBSA1_STRCO RecName: Full=Ribose import ATP-binding protein rbsA 1;
  822::903     7e-04  35%  919 aa  RAD50_AERPE RecName: Full=DNA double-strand break repair rad50
  146::251     7e-04  28%  251 aa  PSTB_THEMA RecName: Full=Phosphate import ATP-binding protein pstB;
  560::653     7e-04  28% 1362 aa  PMD1_SCHPO RecName: Full=Leptomycin B resistance protein pmd1;
  131::244     7e-04  29%  261 aa  PHNC_HYPNA RecName: Full=Phosphonates import ATP-binding protein
  120::222     7e-04  29%  358 aa  MODC_AGRT5 RecName: Full=Molybdenum import ATP-binding protein
  393::455     7e-04  32%  497 aa  MGLA1_PHOPR RecName: Full=Galactose/methyl galactoside import
  118::226     7e-04  29%  344 aa  METN_RALEH RecName: Full=Methionine import ATP-binding protein
  467::565     7e-04  30%  593 aa  MDLB_ECOLI RecName: Full=Multidrug resistance-like ATP-binding
  467::565     7e-04  30%  593 aa  MDLB_ECOL6 RecName: Full=Multidrug resistance-like ATP-binding
  467::565     7e-04  30%  593 aa  MDLB_ECO57 RecName: Full=Multidrug resistance-like ATP-binding
  128::219     7e-04  29%  684 aa  MACB_RHOBA RecName: Full=Macrolide export ATP-binding/permease
  146::221     7e-04  28%  225 aa  LOLD_SPHAL RecName: Full=Lipoprotein-releasing system ATP-binding
  151::218     7e-04  31%  231 aa  LOLD_BORPE RecName: Full=Lipoprotein-releasing system ATP-binding
  151::218     7e-04  31%  231 aa  LOLD_BORPA RecName: Full=Lipoprotein-releasing system ATP-binding
  151::218     7e-04  31%  231 aa  LOLD_BORBR RecName: Full=Lipoprotein-releasing system ATP-binding
  125::200     7e-04  28%  224 aa  LOLD_AQUAE RecName: Full=Lipoprotein-releasing system ATP-binding
  148::236     7e-04  30%  240 aa  LOLD2_PELLD RecName: Full=Lipoprotein-releasing system ATP-binding
  108::230     7e-04  32%  269 aa  HMUV_NITWN RecName: Full=Hemin import ATP-binding protein hmuV;    
  133::216     7e-04  32%  381 aa  CYSA_ANTFO RecName: Full=Probable sulfate/thiosulfate import
  113::207     7e-04  34%  211 aa  CCMA_PSEF5 RecName: Full=Cytochrome c biogenesis ATP-binding export
  111::155     7e-04  47%  200 aa  CCMA_BRAJA RecName: Full=Cytochrome c biogenesis ATP-binding export
  142::227     7e-04  26%  279 aa  CBIO2_MYCGA RecName: Full=Cobalt import ATP-binding protein cbiO 2;
  270::367     7e-04  30%  406 aa  CBIO1_MESFL RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  123::226     7e-04  31%  253 aa  BTUD_YERE8 RecName: Full=Vitamin B12 import ATP-binding protein
  403::510     7e-04  29%  517 aa  ARAG_BACHD RecName: Full=L-arabinose transport ATP-binding protein
  136::219     7e-04  25%  589 aa  AB8G_ARATH RecName: Full=ABC transporter G family member 8;        
 1137::1225    7e-04  27% 1248 aa  AB7B_ARATH RecName: Full=ABC transporter B family member 7;       
  195::265     7e-04  30%  624 aa  AB23G_ARATH RecName: Full=ABC transporter G family member 23;      
 1341::1385    7e-04  44% 1408 aa  AB20B_ARATH RecName: Full=ABC transporter B family member 20;        
  124::156     0.001  55%  263 aa  ZNUC_PASMU RecName: Full=Zinc import ATP-binding protein znuC;     
  482::599     0.001  26%  604 aa  YKNV_BACSU RecName: Full=Uncharacterized ABC transporter
  138::218     0.001  42%  284 aa  Y2439_THEEB RecName: Full=Putative ABC transporter ATP-binding
  155::219     0.001  33%  612 aa  Y1312_MYCBO RecName: Full=Uncharacterized ABC transporter
  155::219     0.001  33%  612 aa  Y1281_MYCTU RecName: Full=Uncharacterized ABC transporter
  142::199     0.001  29%  259 aa  Y068_CHLTR RecName: Full=Probable metal transport system
  122::164     0.001  49%  251 aa  SSUB_MYCPA RecName: Full=Aliphatic sulfonates import ATP-binding
  122::164     0.001  49%  251 aa  SSUB_MYCA1 RecName: Full=Aliphatic sulfonates import ATP-binding
  398::477     0.001  27%  516 aa  RBSA_BURXL RecName: Full=Ribose import ATP-binding protein rbsA;   
  388::479     0.001  23%  505 aa  RBSA2_STRAW RecName: Full=Ribose import ATP-binding protein rbsA 2;
  160::225     0.001  27%  519 aa  RBSA2_PASMU RecName: Full=Ribose import ATP-binding protein rbsA 2;
  152::262     0.001  25%  262 aa  PSTB_WOLSU RecName: Full=Phosphate import ATP-binding protein pstB;
  138::253     0.001  27%  385 aa  POTA_STRSV RecName: Full=Spermidine/putrescine import ATP-binding
  136::238     0.001  32%  350 aa  POTA_SPICI RecName: Full=Spermidine/putrescine import ATP-binding
  146::232     0.001  31%  266 aa  PHNC_BACSK RecName: Full=Phosphonates import ATP-binding protein
  134::251     0.001  29%  277 aa  PHNC2_PSEU2 RecName: Full=Phosphonates import ATP-binding protein
  146::229     0.001  29%  267 aa  PHNC2_NATPD RecName: Full=Phosphonates import ATP-binding protein
 1048::1134    0.001  28% 1500 aa  PDR12_ORYSJ RecName: Full=Pleiotropic drug resistance protein 12;
  136::233     0.001  30%  377 aa  MSMK_STRMU RecName: Full=Multiple sugar-binding transport
  471::557     0.001  28%  581 aa  MSBA_PSEHT RecName: Full=Lipid A export ATP-binding/permease
  121::218     0.001  30%  360 aa  MODC_PSEF5 RecName: Full=Molybdenum import ATP-binding protein
  170::282     0.001  34%  371 aa  METN_RHOP5 RecName: Full=Methionine import ATP-binding protein
  126::231     0.001  31%  338 aa  METN2_ERWCT RecName: Full=Methionine import ATP-binding protein
  393::436     0.001  36%  527 aa  LSRA_YERPY RecName: Full=Autoinducer 2 import ATP-binding protein
  393::436     0.001  36%  527 aa  LSRA_YERPS RecName: Full=Autoinducer 2 import ATP-binding protein
  393::436     0.001  36%  527 aa  LSRA_YERPP RecName: Full=Autoinducer 2 import ATP-binding protein
  393::436     0.001  36%  527 aa  LSRA_YERPN RecName: Full=Autoinducer 2 import ATP-binding protein
  393::436     0.001  36%  527 aa  LSRA_YERPG RecName: Full=Autoinducer 2 import ATP-binding protein
  393::436     0.001  36%  527 aa  LSRA_YERPE RecName: Full=Autoinducer 2 import ATP-binding protein
  393::436     0.001  36%  527 aa  LSRA_YERPB RecName: Full=Autoinducer 2 import ATP-binding protein
  393::436     0.001  36%  527 aa  LSRA_YERPA RecName: Full=Autoinducer 2 import ATP-binding protein
  393::436     0.001  36%  527 aa  LSRA_YERP3 RecName: Full=Autoinducer 2 import ATP-binding protein
  131::174     0.001  45%  234 aa  LOLD_YERPS RecName: Full=Lipoprotein-releasing system ATP-binding
  121::208     0.001  26%  227 aa  LOLD_PSEA6 RecName: Full=Lipoprotein-releasing system ATP-binding
  138::170     0.001  45%  224 aa  LOLD_NEOSM RecName: Full=Lipoprotein-releasing system ATP-binding
  111::155     0.001  42%  200 aa  CCMA_NITWN RecName: Full=Cytochrome c biogenesis ATP-binding export
  115::159     0.001  42%  204 aa  CCMA_NITHX RecName: Full=Cytochrome c biogenesis ATP-binding export
  141::230     0.001  31%  279 aa  CBIO_ENTFC RecName: Full=Cobalt import ATP-binding protein cbiO;   
  129::175     0.001  45%  292 aa  CBIO1_OENOB RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  143::229     0.001  33%  281 aa  CBIO1_BACSU RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  141::228     0.001  30%  280 aa  CBIO1_BACCR RecName: Full=Cobalt import ATP-binding protein cbiO 1;
  107::215     0.001  29%  254 aa  BTUD_VIBVU RecName: Full=Vitamin B12 import ATP-binding protein
  120::221     0.001  28%  249 aa  BTUD_SHISS RecName: Full=Vitamin B12 import ATP-binding protein
  120::221     0.001  28%  249 aa  BTUD_SHIFL RecName: Full=Vitamin B12 import ATP-binding protein
  120::221     0.001  28%  249 aa  BTUD_SHIF8 RecName: Full=Vitamin B12 import ATP-binding protein
  120::221     0.001  28%  249 aa  BTUD_SHIDS RecName: Full=Vitamin B12 import ATP-binding protein
  120::221     0.001  28%  249 aa  BTUD_SHIB3 RecName: Full=Vitamin B12 import ATP-binding protein
  124::225     0.001  28%  253 aa  BTUD_PHOPR RecName: Full=Vitamin B12 import ATP-binding protein
  120::221     0.001  28%  249 aa  BTUD_ECOSM RecName: Full=Vitamin B12 import ATP-binding protein
  120::221     0.001  28%  249 aa  BTUD_ECOSE RecName: Full=Vitamin B12 import ATP-binding protein
  120::221     0.001  28%  249 aa  BTUD_ECOLU RecName: Full=Vitamin B12 import ATP-binding protein
  120::221     0.001  28%  249 aa  BTUD_ECOLI RecName: Full=Vitamin B12 import ATP-binding protein
  120::221     0.001  28%  249 aa  BTUD_ECOLC RecName: Full=Vitamin B12 import ATP-binding protein
  120::221     0.001  28%  249 aa  BTUD_ECOHS RecName: Full=Vitamin B12 import ATP-binding protein
  120::221     0.001  28%  249 aa  BTUD_ECODH RecName: Full=Vitamin B12 import ATP-binding protein
  120::221     0.001  28%  249 aa  BTUD_ECOBW RecName: Full=Vitamin B12 import ATP-binding protein
  120::221     0.001  28%  249 aa  BTUD_ECO8A RecName: Full=Vitamin B12 import ATP-binding protein
  120::221     0.001  28%  249 aa  BTUD_ECO7I RecName: Full=Vitamin B12 import ATP-binding protein
  120::221     0.001  28%  249 aa  BTUD_ECO55 RecName: Full=Vitamin B12 import ATP-binding protein
  120::221     0.001  28%  249 aa  BTUD_ECO24 RecName: Full=Vitamin B12 import ATP-binding protein
  124::198     0.001  27%  508 aa  ARAG_RHIME RecName: Full=Arabinose import ATP-binding protein araG;
  402::484     0.001  32%  514 aa  ARAG_PSEPF RecName: Full=Arabinose import ATP-binding protein araG;
  188::258     0.001  29%  646 aa  ABCG4_HUMAN RecName: Full=ATP-binding cassette sub-family G member
  170::287     0.001  29%  654 aa  ABCG2_MACMU RecName: Full=ATP-binding cassette sub-family G member
  170::287     0.001  29%  655 aa  ABCG2_HUMAN RecName: Full=ATP-binding cassette sub-family G member
  557::665     0.001  28% 1328 aa  ABCC7_DICDI RecName: Full=ABC transporter C family member
  719::826     0.001  26% 1466 aa  AB6C_ARATH RecName: Full=ABC transporter C family member 6;        
  946::1010    0.001  26% 1397 aa  AB41G_ARATH RecName: Full=ABC transporter G family member 41;        
 1002::1085    0.001  27% 1450 aa  AB37G_ARATH RecName: Full=ABC transporter G family member 37;        
    1::253

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVSIDQSAIRGSRRSNPATYTGLLDPIRKAFAKANGVKPSLFSANSEGACPACNGAGVIYTDLAMMAGVA
UVRA_AQUAE      VINIDQSPIGRTPRSNPATYTKVFDLIRNLFAKARGYKPGRFSFNVKGGCEACQGEGVIKVEMHFLPPVY
UVRA_THET8      VIEIDQSPIGRTPRSNPATYTGVFDEIRDLFAKTRGYGPGRFSFNVKGGCEACGGDGTVKIEMLFLPDLY
UVRA_BACHD      VIDIDQSPIGRTPRSNPATYTGVFDDIRDVFAMTNGYKKGRFSFNVKGGCEACRGDGIIKIEMHFLPDVY
UVRA_CLOPE      IIDIDQSPIGRTPRSNPATYTGTFDIIRELFAKMRGYKPGRFSFNVKGGCEACSGDGIIKIEMQFLSDVY
UVRA_MYCLE      LVRVDQSPIGRTPRSNPATYTGVFDKIRILFAKVRGYQPGRFSFNVKGGCEACTGDGTIKIEMNFLPDVY
UVRA_XANAC      VVDIDQSPIGRTPRSNPATYTGMFTPLRELFARARGYSPGRFSFNVRGGCEACQGDGMIKVEMHFLPDVY
UVRA_XANCP      VVDIDQSPIGRTPRSNPATYTGMFTPLRELFARARGYSPGRFSFNVRGGCEACQGDGMIKVEMHFLPDVY
UVRA_METTH      VVMIDQSPIGRTPRSNPATYTGVFTHIRELFAQTRGYRPGRFSFNVKGGCEACGGDGIIKIEMHFLADVY
UVRA_THEMA      MIAIDQSPIGRTPRSNPATYTKVFDEIRSLFAKARGYNKSRFSFNLKGGCEACQGQGYVKIEMLFLPDVY
UVRA_SYNY3      VIVIDQSPIGRTPRSNPATYTGIFDSIREIFAKARGYKPGQFSFNVKGGCEACAGQGVNVIEMNFLPDVY
UVRA_PSEAE      VVDIDQSPIGRTPRSNPATYTGLFTPIRELFARSRGYGPGRFSFNVKGGCEACQGDGVIKVEMHFLPDIY
UVRA_BACSU      VIDIDQAPIGRTPRSNPATYTGVFDDIRDVFAQTNGYKKGRFSFNVKGGCEACRGDGIIKIEMHFLPDVY
UVRA_OCEIH      VIDIDQSPIGRTPRSNPATYTGVFDDIRDVFAQTNGYKKGRFSFNVKGGCEACRGDGILKIEMHFLPDVY
UVRA_LEPIN      IINIDQSPIGRTPRSNPATYTGLFTPIREMFAKLRGYGPGRFSFNSGGRCETCEGDGILKIEMHFLPDVY
UVRA_LEPIC      IINIDQSPIGRTPRSNPATYTGLFTPIREMFAKLRGYGPGRFSFNSGGRCETCEGDGILKIEMHFLPDVY
UVRA_CLOAB      IIDINQSPIGRTPRSNPATYTGVFDIIRELYAKLRGYKAGRFSFNVKGGCEACKGDGIVRIEMQFLSDVY
UVRA_PSEPK      VVDIDQSPIGRTPRSNPATYTGIFTPIRELFSRSRGYGPGRFSFNVKGGCEACQGDGLIKVEMHFLPDIY
UVRA_RICBR      IIDINQSPIGRTPRSNPATYTGAFTHIRDWFSKARGYKVGRFSFNVKGGCEACQGDGLIKIEMHFLPDVY
UVRA_RICCN      IIDINQSPIGRTPRSNPATYTGAFTHIRDWFSKARGYKVGRFSFNVKGGCEACQGDGLIKIEMHFLPDVY
UVRA_RICFE      IIDINQSPIGRTPRSNPATYTGAFTHIRDWFSKARGYKVGRFSFNVKGGCEACQGDGLIKIEMHFLPDVY
UVRA_STRP1      LIDIDQSPIGRTPRSNPATYTGVFDDIRDLFAQTNGYKKGRFSFNVKGGCEACSGDGIIKIEMHFLPDVY
UVRA_UREPA      IVVVNQDAIGRTTRSNPATYVGVFDDIRTVFAKARGYSKSRFSFNIKGGCERCWGDGTIRIEMHFLPDVY
UVRA_RHIME      VIDIDQSPIGRTPRSNPATYTGAFTPIRDWFAKARGYQPGRFSFNVKGGCEACQGDGVIKIEMHFLPDVY
UVRA_STRP6      LIDIDQSPIGRTPRSNPATYTGVFDDIRDLFARTNGYKKGRFSFNVKGGCEACSGDGIIKIEMHFLPDVY
UVRA_RICTY      IIDINQSPIGRTPRSNPATYTGAFTHIRDWFSKARGYKVGRFSFNVKGGCEACQGDGLIKIEMHFLPDVY
UVRA_STRP8      LIDIDQSPIGRTPRSNPATYTGVFDDIRDLFAQTNGYKKGRFSFNVKGGCEACSGDGIIKIEMHFLPDVY
UVRA_STRP3      LIDIDQSPIGRTPRSNPATYTGVFDDIRDLFAQTNGYKKGRFSFNVKGGCEACSGDGIIKIEMHFLPDVY
UVRA_NEIMA      VINVDQSPIGRTPRSNPATYTGLFTPIRELFARERGYNVGRFSFNVKGGCEACQGDGVIKVEMHFLPDVY
UVRA_RICPR      IIDINQSPIGRTPRSNPATYTGAFTHIRDWFSKARGYKVGRFSFNVKGGCEACQGDGLIKIEMHFLPDVY
UVRA_LACPL      LVNIDQSPIGRTPRSNPATYTGVFDNIRDLFAQTNGYKKGRFSFNTKGGCEACHGDGILKIEMNFLPDVF
UVRA_NEIMB      VINVDQSPIGRTPRSNPATYTGLFTPIRELFARERGYNVGRFSFNVKGGCEACQGDGVIKVEMHFLPDVY
UVRA_LACLA      LIDIDQSPIGRTPRSNPATYTSVFDDIRDLFANTNGYKKGRFSFNVKGGCEACSGDGIIKIEMHFLPDVY
UVRA_STAAW      ------SPIGRTPRSNPATYTGVFDDIRDVFAQTNGYQKGRFSFNVKGGCEACKGDGIIKIEMHFLPDVY
UVRA_STAAS      ------SPIGRTPRSNPATYTGVFDDIRDVFAQTNGYQKGRFSFNVKGGCEACKGDGIIKIEMHFLPDVY
UVRA_STAAR      ------SPIGRTPRSNPATYTGVFDDIRDVFAQTNGYQKGRFSFNVKGGCEACKGDGIIKIEMHFLPDVY
UVRA_STAAC      ------SPIGRTPRSNPATYTGVFDDIRDVFAQTNGYQKGRFSFNVKGGCEACKGDGIIKIEMHFLPDVY
UVRA_NEIGO      VINVDQSPIGRTPRSNPATYTGLFTPIRELFARERGYNVGRFSFNVKGGCEACQGDGVIKVEMHFLPDVY
UVRA_XYLFA      VVDIDQSPIGRTPRSNPATYTGMFTPLRELFARARGYSPGRFSFNVRGGCEACEGDGLIKVEMHFLPDVY
UVRA_RHILO      VIDIDQSPIGRTPRSNPATYTGAFTPIRDWFAKARGYQPGRFSFNVKGGCEACQGDGVIKIEMHFLPDVY
UVRA_XYLFT      VVDIDQSPIGRTPRSNPATYTGMFTPLRELFARARGYSPGRFSFNVRGGCEACEGDGLIKVEMHFLPDVY
UVRA_STRMU      LIDIDQSPIGRTPRSNPATYTGVFDDIRDLFAQTNGYKKGRFSFNVKGGCEACSGDGIIKIEMHFLPDVY
UVRA_MYCTU      LVRVDQSPIGRTPRSNPATYTGVFDKIRTLFAKVRGYQPGRFSFNVKGGCEACTGDGTIKIEMNFLPDVY
UVRA_MYCBO      LVRVDQSPIGRTPRSNPATYTGVFDKIRTLFAKVRGYQPGRFSFNVKGGCEACTGDGTIKIEMNFLPDVY
UVRA_LISMO      IINIDQSPIGRTPRSNPATYTGAFDDIRDLFASTNGYKKGRFSFNVKGGCEACKGDGIIKIEMHFLPDVY
UVRA_LISMF      IINIDQSPIGRTPRSNPATYTGAFDDIRDLFASTNGYKKGRFSFNVKGGCEACKGDGIIKIEMHFLPDVY
UVRA_LISIN      IINIDQSPIGRTPRSNPATYTGAFDDIRDLFASTNGYKKGRFSFNVKGGCEACKGDGIIKIEMHFLPDVY
UVRA_HAEIN      VIDINQSPIGRTPRSNPATYTGLFTPIRELFARARGYNPGRFSFNVRGGCEACQGDGVLKVEMHFLPDVY
UVRA_VIBPA      VIDIDQSPIGRTPRSNPATYTGIFTPIRELFARSRGYKPGRFSFNVRGGCEACQGDGVIKVEMHFLPDVY
UVRA_STAAN      ------SPIGRTPRSNPATYTGVFDDIRDVFAQTNGYQKGRFSFNVKGGCEACKGDGIIKIEMHFLPDVY
UVRA_STAAM      ------SPIGRTPRSNPATYTGVFDDIRDVFAQTNGYQKGRFSFNVKGGCEACKGDGIIKIEMHFLPDVY
UVRA_CLOTE      IINIDQSPIGRTPRSNPATYTGVFDGIREVFSKMRGYKPGRFSFNVKGGCEACKGDGIIKIEMQFLSDVY
UVRA_BORBU      IIQINQKPIGRTSRSNPATYVGFFTEIRELFAKSRGFKAGRFSFNVKGGCEKCQGDGYLNIQMHFLPDVF
UVRA_HAEDU      VIDIDQSPIGRTPRSNPATYTGLFTPIRELFARARGYNVGRFSFNVRGGCEACQGDGVIKVEMHFLPDVY
UVRA_STRCO      VVHVDQSPIGRTPRSNPATYTGVFDHIRKLFAKVRGYLPGRFSFNVKGGCENCAGDGTIKIEMNFLPDVY
UVRA_SALTY      VIDIDQSPIGRTPRSNPATYTGVFTPVRELFARSRGYTPGRFSFNVRGGCEACQGDGVIKVEMHFLPDIY
UVRA_SALTI      VIDIDQSPIGRTPRSNPATYTGVFTPVRELFARSRGYTPGRFSFNVRGGCEACQGDGVIKVEMHFLPDIY
UVRA_AGRT5      VIDIDQSPIGRTPRSNPATYTGAFTPIRDWFAKARGYAPGRFSFNVKGGCEACQGDGVIKIEMHFLPDVY
UVRA_MYCPE      IIKVSQDPIGRTPRSNPATYVSVFDDIRDLFAKARGFQKGRFSFNSGGRCENCSGDGLIKIEMHFLPDVF
UVRA_MYCPN      VVVVSQDPIGRTPRSNPATYVSVFDDIRELFAKARGYTNSRFSFNAGGRCDKCFGDGVIRIEMHFLPDVY
UVRA_MICLU      VVHVDQSPIGRTPRSNPATYTGVFDAIRKLFAKVRGYQQGRFSFNIKGGCEACAGDGTLKIEMNFLPDVY
UVRA_STRAW      VVHVDQSPIGRTPRSNPATYTGVFDHVRKLFAKVRGYLPGRFSFNVKGGCENCSGDGTIKIEMNFLPDVY
UVRA_TREPA      VIYVDQSPIGRTPRSNPATYVGVFTDIRMLFAKMRGYKPGRFSFNVPGGCEHCKGDGVITIEMNFLPDVY
UVRA_DEIRA      VIEIDQSPIGRTPRSNPATYTGVFTEIRDLFARRRGYQAGRFSFNVKGGCEHCKGDGVMKIEMNFLPDIY
UVRA_VIBVY      VIDIDQSPIGRTPRSNPATYTGIFTPIRELFSRSRGYKPGRFSFNVRGGCEACQGDGVIKVEMHFLPDVY
UVRA_VIBVU      VIDIDQSPIGRTPRSNPATYTGIFTPIRELFSRSRGYKPGRFSFNVRGGCEACQGDGVIKVEMHFLPDVY
UVRA_BRUSU      VIDIDQSPIGRTPRSNPATYTGAFTPIRDWFAKARGYQPGRFSFNVKGGCEACQGDGVIKIEMHFLPDVY
UVRA_BRUME      VIDIDQSPIGRTPRSNPATYTGAFTPIRDWFAKARGYQPGRFSFNIKGGCEACQGDGVIKIEMHFLPDVY
UVRA_BRUAB      VIDIDQSPIGRTPRSNPATYTGAFTPIRDWFAKARGYQPGRFSFNVKGGCEACQGDGVIKIEMHFLPDVY
UVRA_BRUA2      VIDIDQSPIGRTPRSNPATYTGAFTPIRDWFAKARGYQPGRFSFNVKGGCEACQGDGVIKIEMHFLPDVY
UVRA_BRAJA      IIDIDQSPIGRTPRSNPATYTGAFTPIREWFAKARGYEPGRFSFNVKGGCEACQGDGVIKIEMHFLPDVY
UVRA_ECOL6      VIDIDQSPIGRTPRSNPATYTGVFTPVRELFARARGYTPGRFSFNVRGGCEACQGDGVIKVEMHFLPDIY
UVRA_SHIFL      VIDIDQSPIGRTPRSNPATYTGVFTPVRELFARARGYTPGRFSFNVRGGCEACQGDGVIKVEMHFLPDIY
UVRA_ECOLI      VIDIDQSPIGRTPRSNPATYTGVFTPVRELFARARGYTPGRFSFNVRGGCEACQGDGVIKVEMHFLPDIY
UVRA_ECO57      VIDIDQSPIGRTPRSNPATYTGVFTPVRELFARARGYTPGRFSFNVRGGCEACQGDGVIKVEMHFLPDIY
UVRA_PASMU      VIDIDQSPIGRTPRSNPATYTGLFTPIRELFARARGYNPGRFSFNVRGGCEACQGDGVIKVEMHFLPDVY
UVRA_STRR6      LIDIDQSPIGRTPRSNPATYTGVFDDIRDLFAQTNGYKKGRFSFNVKGGCEACSGDGIIKIEMHFLPDVY
UVRA_STRPN      LIDIDQSPIGRTPRSNPATYTGVFDDIRDLFAQTNGYKKGRFSFNVKGGCEACSGDGIIKIEMHFLPDVY
UVRA_STAEQ      ------SPIGRTPRSNPATYTGVFDDIRDVFAQTNGYQKGRFSFNVKGGCEACKGDGIIKIEMHFLPDVY
UVRA_MYCGE      IIVVSQDPIGRTPRSNPATYISVFDDIRDLFAKARGYTNSRFSFNVPGGCDKCFGDGVIRIEMHFLPDVY
UVRA_YERPE      VIDIDQSPIGRTPRSNPATYTGIFTPIRELFARTRGYTPGRFSFNVKGGCEACQGDGVIKVEMHFLPDIY
UVRA_VIBCH      VIDIDQSPIGRTPRSNPATYTGIFTPIRELFARSRGYQPGRFSFNVRGGCEACQGDGVIKVEMHFLPDVY
UVRA_HELPY      VIYLDQAPIGKTPRSNPATYTGVMDEIRILFAKILGYSASRFSFNVKGGCEKCQGDGDIKIEMHFLPDVL
UVRA_HELPJ      VIYLDQAPIGKTPRSNPATYTGVMDEIRILFAKILGYSTSRFSFNVKGGCEKCQGDGDIKIEMHFLPDVL
UVRA_ZYMMO      VIDIDQSPIGRTPRSNPATYTGAFTAIREWFAKARGYKAGRFSFNVKGGCEACQGDGVKKIEMHFLPDVY
UVRA_MYCPU      LIKISQSPIGRTPRSNPATYSSLFDDIREIFAKARGYQKGRFSFNVPGGCEKCSGDGSIKIEMFFLPNVY
UVRA_VITST      VINVDQSPIGRTPRSNPATYTGVFTPIRELFARERGYNVGRFSFNVKGGCEACQGDGVLKVEMHFLPDVY
UVRA_CHLMU      LVHINRDLPGRSQRSISLTYIKAFDELRQLFAEQPRCKPSHFSFNTPGACSECGGLGSI---TAMDNQDS
UVRA_STAES      ------SPIGRTPRSNPATYTGVFDDIRDVFAQTNGYQKGRFSFNVKGGCEACKGDGIIKIEMHFLPDVY
UVRA_CHLTR      LVHINRDLPGRSQRSIPLTYIKAFDEVRQLFAKTLGLTKSHFSFNTPGACAECGGLGSITTTDNRDS---
UVRA_CHLPN      LVVIDSHPIASSQRSDISTYFDIAPSLRAFYAKALNISSTMFSTNTQGQCSDCQGLGYQWIDRAFYALEK
UVRA_PSELE      LVTVDQKPIGRTPRSNLATYTGLFDHVRKLFASTRAAKARHYDAGAKGRCGNCEGEGFVMVELLFLPSVY
MSBA_POLSJ      ----------------------------------------------------------------------
RBSA3_RHIME     ----------------------------------------------------------------------
CYDD_BACSU      ----------------------------------------------------------------------
Y035_METJA      ----------------------------------------------------------------------
MSBA_COXBU      ----------------------------------------------------------------------
MSBA_BORPE      ----------------------------------------------------------------------
MSBA_BORPA      ----------------------------------------------------------------------
MSBA_BORBR      ----------------------------------------------------------------------
MACB_ALCBS      ----------------------------------------------------------------------
ABCB8_DANRE     ----------------------------------------------------------------------
NDVA_RHOP2      ----------------------------------------------------------------------
PHNC_THIDA      ----------------------------------------------------------------------
MSBA_RALEJ      ----------------------------------------------------------------------
MACB2_AERHH     ----------------------------------------------------------------------
MSBA_RALME      ----------------------------------------------------------------------
MSBA_AZOSE      ----------------------------------------------------------------------
MACB_RHORT      ----------------------------------------------------------------------
CBIO2_LEUMM     ----------------------------------------------------------------------
MACB2_YERPN     ----------------------------------------------------------------------
MACB1_YERPS     ----------------------------------------------------------------------
MACB1_YERPE     ----------------------------------------------------------------------
MACB1_YERPA     ----------------------------------------------------------------------
ABCB8_XENTR     ----------------------------------------------------------------------
Y373_PYRAB      ----------------------------------------------------------------------
Y043_BIFLO      ----------------------------------------------------------------------
UVRA_PARDE      ----------------------------------------------------------------------
MSBA_PSEPK      ----------------------------------------------------------------------
AB2B_ARATH      ----------------------------------------------------------------------
ZNUC_ROSDO      ----------------------------------------------------------------------
ZNUC_HALHL      ----------------------------------------------------------------------
Y2240_PHOPR     ----------------------------------------------------------------------
Y222_THEMA      ----------------------------------------------------------------------
MSBA_SYNAS      ----------------------------------------------------------------------
MSBA_DECAR      ----------------------------------------------------------------------
YKOD_BACSU      ----------------------------------------------------------------------
Y2324_STRCO     ----------------------------------------------------------------------
MSBA_RHOFD      ----------------------------------------------------------------------
MSBA_PSYA2      ----------------------------------------------------------------------
MSBA_METCA      ----------------------------------------------------------------------
MSBA_BURS3      ----------------------------------------------------------------------
MSBA_BURCA      ----------------------------------------------------------------------
MSBA_BORA1      ----------------------------------------------------------------------
MACB_PSE14      ----------------------------------------------------------------------
CYAB_BORPE      ----------------------------------------------------------------------
RTX1B_ACTPL     ----------------------------------------------------------------------
NDVA_RHOPS      ----------------------------------------------------------------------
MSBA_PSESM      ----------------------------------------------------------------------
MSBA_PSEF5      ----------------------------------------------------------------------
MSBA_NITOC      ----------------------------------------------------------------------
HMUV_RHOPA      ----------------------------------------------------------------------
Y1051_HAEIN     ----------------------------------------------------------------------
NDVA_RHOPB      ----------------------------------------------------------------------
MSBA_PSE14      ----------------------------------------------------------------------
MACB1_PSESM     ----------------------------------------------------------------------
MACB1_PSEE4     ----------------------------------------------------------------------
CBIO_METAC      ----------------------------------------------------------------------
CBIO1_LACS1     ----------------------------------------------------------------------
ABCB8_RAT       ----------------------------------------------------------------------
ABCB8_PONAB     ----------------------------------------------------------------------
ABCB8_HUMAN     ----------------------------------------------------------------------
Y2003_STAA8     ----------------------------------------------------------------------
Y1956_STAAR     ----------------------------------------------------------------------
Y1924_STAAC     ----------------------------------------------------------------------
Y1866_STAAM     ----------------------------------------------------------------------
Y1847_STAA3     ----------------------------------------------------------------------
Y1806_STAAW     ----------------------------------------------------------------------
Y1799_STAAB     ----------------------------------------------------------------------
Y1788_STAAS     ----------------------------------------------------------------------
Y1683_STAAN     ----------------------------------------------------------------------
MSBA_RALSO      ----------------------------------------------------------------------
MSBA_PSEU2      ----------------------------------------------------------------------
MSBA_CHRSD      ----------------------------------------------------------------------
MSBA_ALHEH      ----------------------------------------------------------------------
MACB_SHESA      ----------------------------------------------------------------------
MACB_RHIME      ----------------------------------------------------------------------
MACB_NEIMA      ----------------------------------------------------------------------
MACB_AGRT5      ----------------------------------------------------------------------
HMT1_SCHPO      ----------------------------------------------------------------------
CBIO1_SYMTH     ----------------------------------------------------------------------
ABCB8_MOUSE     ----------------------------------------------------------------------
Y282_TREDE      ----------------------------------------------------------------------
MSBA_VIBF1      ----------------------------------------------------------------------
MACB_SALTY      ----------------------------------------------------------------------
MACB_SALTI      ----------------------------------------------------------------------
MACB_SALPA      ----------------------------------------------------------------------
MACB_SALCH      ----------------------------------------------------------------------
MACB_RHOPB      ----------------------------------------------------------------------
MACB_NEIGO      ----------------------------------------------------------------------
MACB_NEIG1      ----------------------------------------------------------------------
MACB_ERWCT      ----------------------------------------------------------------------
MACB_CAMFF      ----------------------------------------------------------------------
MACB_ACIAD      ----------------------------------------------------------------------
MACB2_PSEU2     ----------------------------------------------------------------------
MACB2_PSESM     ----------------------------------------------------------------------
MACB1_PSEPF     ----------------------------------------------------------------------
HLYB_PROVU      ----------------------------------------------------------------------
HISP_SALTY      ----------------------------------------------------------------------
HISP_ECOLI      ----------------------------------------------------------------------
CBIO1_LACSS     ----------------------------------------------------------------------
ZNUC_YERPS      ----------------------------------------------------------------------
Y1383_MYCBO     ----------------------------------------------------------------------
Y1348_MYCTU     ----------------------------------------------------------------------
RGMG1_RHIME     ----------------------------------------------------------------------
NODI_RALSO      ----------------------------------------------------------------------
NDVA_RHOP5      ----------------------------------------------------------------------
NDVA_BRAJA      ----------------------------------------------------------------------
MSBA_THIDA      ----------------------------------------------------------------------
MSBA_PSEPF      ----------------------------------------------------------------------
MACB_NITEU      ----------------------------------------------------------------------
MACB1_PSEU2     ----------------------------------------------------------------------
L259_DROME      ----------------------------------------------------------------------
DRRA_STRPE      ----------------------------------------------------------------------
CBIO1_STRMU     ----------------------------------------------------------------------
ZNUC_YERPN      ----------------------------------------------------------------------
ZNUC_YERPE      ----------------------------------------------------------------------
ZNUC_YERPA      ----------------------------------------------------------------------
Y3946_ANASP     ----------------------------------------------------------------------
MSBA_PSEAE      ----------------------------------------------------------------------
MACB_RHOP2      ----------------------------------------------------------------------
MACB_NEIMB      ----------------------------------------------------------------------
MACB_CHLCH      ----------------------------------------------------------------------
MACB_BRUA2      ----------------------------------------------------------------------
MACB_AZOSE      ----------------------------------------------------------------------
MACB_AZOSB      ----------------------------------------------------------------------
MACB2_PSEF5     ----------------------------------------------------------------------
MACB2_PSEE4     ----------------------------------------------------------------------
LOLD_PSESM      ----------------------------------------------------------------------
HMUV_PSEPF      ----------------------------------------------------------------------
NODI_RHIEC      ----------------------------------------------------------------------
MSBA_THICR      ----------------------------------------------------------------------
MSBA_BURTA      ----------------------------------------------------------------------
MSBA_BURPS      ----------------------------------------------------------------------
MSBA_BURP1      ----------------------------------------------------------------------
MSBA_BURMA      ----------------------------------------------------------------------
MNTB_BACSU      ----------------------------------------------------------------------
MDR_ORYSJ       ----------------------------------------------------------------------
MACB_SHISS      ----------------------------------------------------------------------
MACB_SHIFL      ----------------------------------------------------------------------
MACB_SHIDS      ----------------------------------------------------------------------
MACB_SHEON      ----------------------------------------------------------------------
MACB_PSEAB      ----------------------------------------------------------------------
MACB_HAHCH      ----------------------------------------------------------------------
MACB_ECOUT      ----------------------------------------------------------------------
MACB_ECOLI      ----------------------------------------------------------------------
MACB_ECOL5      ----------------------------------------------------------------------
MACB_ECO57      ----------------------------------------------------------------------
MACB_BRUME      ----------------------------------------------------------------------
MACB_BARHE      ----------------------------------------------------------------------
MACB3_PARDP     ----------------------------------------------------------------------
MACB1_ECOK1     ----------------------------------------------------------------------
LKTB_PASSP      ----------------------------------------------------------------------
ABCE1_MOUSE     ----------------------------------------------------------------------
ABCE1_HUMAN     ----------------------------------------------------------------------
Y2387_METMA     ----------------------------------------------------------------------
Y1418_METAC     ----------------------------------------------------------------------
PAXB_PASAE      ----------------------------------------------------------------------
NODI_RHIGA      ----------------------------------------------------------------------
NODI_BURS3      ----------------------------------------------------------------------
MSBA_HAHCH      ----------------------------------------------------------------------
MSBA_BURXL      ----------------------------------------------------------------------
MACB_PSEPK      ----------------------------------------------------------------------
MACB_PSEAE      ----------------------------------------------------------------------
MACB_CHRVO      ----------------------------------------------------------------------
MACB_BURTA      ----------------------------------------------------------------------
MACB_BURPS      ----------------------------------------------------------------------
MACB_BURP1      ----------------------------------------------------------------------
LKTB_PASTR      ----------------------------------------------------------------------
LKTB_MANGL      ----------------------------------------------------------------------
LKTB7_PASHA     ----------------------------------------------------------------------
LKB2B_PASHA     ----------------------------------------------------------------------
LKB2A_PASHA     ----------------------------------------------------------------------
LKB1B_PASHA     ----------------------------------------------------------------------
LKB1A_PASHA     ----------------------------------------------------------------------
LKB16_PASHA     ----------------------------------------------------------------------
LKB14_PASHA     ----------------------------------------------------------------------
LKB13_PASHA     ----------------------------------------------------------------------
CBIO3_OENOB     ----------------------------------------------------------------------
AB17B_ARATH     ----------------------------------------------------------------------
AB16B_ARATH     ----------------------------------------------------------------------
AB10B_ARATH     ----------------------------------------------------------------------
ZNUC_YERE8      ----------------------------------------------------------------------
Y5847_STRAW     ----------------------------------------------------------------------
Y3016_METMA     ----------------------------------------------------------------------
Y1815_PYRHO     ----------------------------------------------------------------------
Y133_METTH      ----------------------------------------------------------------------
NDVA_NITHX      ----------------------------------------------------------------------
MSBA_LEGPH      ----------------------------------------------------------------------
MSBA_LEGPA      ----------------------------------------------------------------------
MSBA_FRANO      ----------------------------------------------------------------------
MDR2_CRIGR      ----------------------------------------------------------------------
MDR1_RAT        ----------------------------------------------------------------------
MDR1_MOUSE      ----------------------------------------------------------------------
MDR1_CRIGR      ----------------------------------------------------------------------
MACB_SHIBS      ----------------------------------------------------------------------
MACB_PASMU      ----------------------------------------------------------------------
MACB_BURS3      ----------------------------------------------------------------------
MACB2_YERPS     ----------------------------------------------------------------------
MACB2_YERPE     ----------------------------------------------------------------------
MACB2_YERPA     ----------------------------------------------------------------------
MACB1_YERPN     ----------------------------------------------------------------------
CBIO_METMJ      ----------------------------------------------------------------------
CBIO2_METHJ     ----------------------------------------------------------------------
ZNUC_BRUAB      ----------------------------------------------------------------------
ZNUC_BRUA2      ----------------------------------------------------------------------
YXEO_BACSU      ----------------------------------------------------------------------
Y1747_METAC     ----------------------------------------------------------------------
Y068_PYRFU      ----------------------------------------------------------------------
XYLG_PSEPF      ----------------------------------------------------------------------
RBSA_MESSB      ----------------------------------------------------------------------
POTA_FUSNN      ----------------------------------------------------------------------
PHNC1_PSEAB     ----------------------------------------------------------------------
NODI_RHISN      ----------------------------------------------------------------------
MSBA_VIBPA      ----------------------------------------------------------------------
MSBA_VIBCH      ----------------------------------------------------------------------
MSBA_PSYCK      ----------------------------------------------------------------------
MSBA_LEGPL      ----------------------------------------------------------------------
MDR65_DROME     ----------------------------------------------------------------------
MDR3_MOUSE      ----------------------------------------------------------------------
MDR3_HUMAN      ----------------------------------------------------------------------
MDR3_CRIGR      ----------------------------------------------------------------------
MDR2_RAT        ----------------------------------------------------------------------
MACB_PSYA2      ----------------------------------------------------------------------
MACB_PHOLL      ----------------------------------------------------------------------
MACB_BURCH      ----------------------------------------------------------------------
MACB_BURCA      ----------------------------------------------------------------------
MACB_BARQU      ----------------------------------------------------------------------
MACB_ACTAC      ----------------------------------------------------------------------
HLYB_ECOL6      ----------------------------------------------------------------------
HLYBP_ECOLX     ----------------------------------------------------------------------
HLYBC_ECOLX     ----------------------------------------------------------------------
HLYB3_ECOLX     ----------------------------------------------------------------------
FECE_ECOLI      ----------------------------------------------------------------------
NDVA_BARHE      ----------------------------------------------------------------------
MSBA_VIBVY      ----------------------------------------------------------------------
MSBA_NEIG1      ----------------------------------------------------------------------
MRP9_HUMAN      ----------------------------------------------------------------------
MDR2_MOUSE      ----------------------------------------------------------------------
MDR1_HUMAN      ----------------------------------------------------------------------
MACB_PSYCK      ----------------------------------------------------------------------
MACB_HAEDU      ----------------------------------------------------------------------
MACB1_PSEF5     ----------------------------------------------------------------------
LOLD_BURTA      ----------------------------------------------------------------------
FHUC_ECOLI      ----------------------------------------------------------------------
ABCC8_HUMAN     ----------------------------------------------------------------------
ABCC8_CRICR     ----------------------------------------------------------------------
ABCBA_MOUSE     ----------------------------------------------------------------------
ABCBA_HUMAN     ----------------------------------------------------------------------
AB1E_ARATH      ----------------------------------------------------------------------
AB19B_ARATH     ----------------------------------------------------------------------
ZNUC_SILST      ----------------------------------------------------------------------
WHITE_DROME     ----------------------------------------------------------------------
PHNC2_PSEAE     ----------------------------------------------------------------------
NODI_BURXL      ----------------------------------------------------------------------
MACB_SODGM      ----------------------------------------------------------------------
MACB_PELLD      ----------------------------------------------------------------------
MACB_BORA1      ----------------------------------------------------------------------
MACB1_PARDP     ----------------------------------------------------------------------
HLYB_ECO57      ----------------------------------------------------------------------
FHUC_BACSU      ----------------------------------------------------------------------
CCMA_ALCBS      ----------------------------------------------------------------------
CBIO_THEMA      ----------------------------------------------------------------------
CBIO2_SPIKU     ----------------------------------------------------------------------
ABCB5_HUMAN     ----------------------------------------------------------------------
AB16G_ARATH     ----------------------------------------------------------------------
ZNUC_SHISS      ----------------------------------------------------------------------
ZNUC_SHIDS      ----------------------------------------------------------------------
ZNUC_SHIBS      ----------------------------------------------------------------------
ZNUC_ECOUT      ----------------------------------------------------------------------
ZNUC_ECOLI      ----------------------------------------------------------------------
ZNUC_ECOL6      ----------------------------------------------------------------------
ZNUC_ECOL5      ----------------------------------------------------------------------
ZNUC_ECOK1      ----------------------------------------------------------------------
ZNUC_ECO57      ----------------------------------------------------------------------
Y483_STRPN      ----------------------------------------------------------------------
Y430_STRR6      ----------------------------------------------------------------------
WHITE_LUCCU     ----------------------------------------------------------------------
RTX3B_ACTPL     ----------------------------------------------------------------------
NODI_RALEJ      ----------------------------------------------------------------------
NDVA_NITWN      ----------------------------------------------------------------------
NDVA_BARQU      ----------------------------------------------------------------------
MSBA_VIBVU      ----------------------------------------------------------------------
MSBA_ACIAD      ----------------------------------------------------------------------
MSBA2_COLP3     ----------------------------------------------------------------------
METN_LEIXX      ----------------------------------------------------------------------
MDR1_LEIEN      ----------------------------------------------------------------------
HISP_PSEAE      ----------------------------------------------------------------------
CBIO2_OCEIH     ----------------------------------------------------------------------
CBIO2_LACPL     ----------------------------------------------------------------------
ABCC8_RAT       ----------------------------------------------------------------------
AB3B_ARATH      ----------------------------------------------------------------------
AB14B_ARATH     ----------------------------------------------------------------------
ZNUC_PSEPK      ----------------------------------------------------------------------
YHEH_BACSU      ----------------------------------------------------------------------
YCOBA_PROFR     ----------------------------------------------------------------------
Y3364_BACAN     ----------------------------------------------------------------------
Y3323_BACC1     ----------------------------------------------------------------------
Y3105_BACHK     ----------------------------------------------------------------------
WHITE_CERCA     ----------------------------------------------------------------------
RBSA_ERWCT      ----------------------------------------------------------------------
NDVA_RHOPA      ----------------------------------------------------------------------
NDVA_RHIRD      ----------------------------------------------------------------------
NDVA_AGRT5      ----------------------------------------------------------------------
MSBA_METFK      ----------------------------------------------------------------------
MSBA_ALCBS      ----------------------------------------------------------------------
MACB_WOLSU      ----------------------------------------------------------------------
MACB_ECOLX      ----------------------------------------------------------------------
MACB2_ECOK1     ----------------------------------------------------------------------
HMUV_PSEPK      ----------------------------------------------------------------------
CBIO_METTH      ----------------------------------------------------------------------
CBIO2_MYCS5     ----------------------------------------------------------------------
CBIO1_STAAB     ----------------------------------------------------------------------
ATM1_YARLI      ----------------------------------------------------------------------
ATM1_CANGA      ----------------------------------------------------------------------
AB1B_ARATH      ----------------------------------------------------------------------
ZNUC_PARDP      ----------------------------------------------------------------------
Y753_CLOTE      ----------------------------------------------------------------------
Y4347_VIBVY     ----------------------------------------------------------------------
Y132_PYRHO      ----------------------------------------------------------------------
XYLG_PSE14      ----------------------------------------------------------------------
PHNC_AGRT5      ----------------------------------------------------------------------
NODI_BURPS      ----------------------------------------------------------------------
NODI_BURP1      ----------------------------------------------------------------------
NODI_BURMA      ----------------------------------------------------------------------
NODI_BURCA      ----------------------------------------------------------------------
NDVA_BARBK      ----------------------------------------------------------------------
NDVA_BARBA      ----------------------------------------------------------------------
MSBA_SHEDO      ----------------------------------------------------------------------
MSBA_SACD2      ----------------------------------------------------------------------
LOLD_PSEU2      ----------------------------------------------------------------------
LOLD_PSEF5      ----------------------------------------------------------------------
LOLD_PSE14      ----------------------------------------------------------------------
LOLD_BURPS      ----------------------------------------------------------------------
LOLD_BURMA      ----------------------------------------------------------------------
HMUV_PSEF5      ----------------------------------------------------------------------
HMUV_PSEAE      ----------------------------------------------------------------------
HMUV_PSEAB      ----------------------------------------------------------------------
CBIO1_STRSV     ----------------------------------------------------------------------
CBIO1_MYCMS     ----------------------------------------------------------------------
ARAG_CHRSD      ----------------------------------------------------------------------
ARAG2_BURTA     ----------------------------------------------------------------------
ABCC9_RAT       ----------------------------------------------------------------------
ABCC9_MOUSE     ----------------------------------------------------------------------
ZNUC_BUCBP      ----------------------------------------------------------------------
ZNUC_BRUSU      ----------------------------------------------------------------------
ZNUC_BRUME      ----------------------------------------------------------------------
Y130_PYRAB      ----------------------------------------------------------------------
XYLG_PSEU2      ----------------------------------------------------------------------
RBSA2_STRCO     ----------------------------------------------------------------------
NODI_RHIL3      ----------------------------------------------------------------------
NODI2_RHIME     ----------------------------------------------------------------------
MSBA_NEIMB      ----------------------------------------------------------------------
MSBA_NEIMA      ----------------------------------------------------------------------
MNTB_LISMO      ----------------------------------------------------------------------
MNTB_LISIN      ----------------------------------------------------------------------
MACB2_PSEPF     ----------------------------------------------------------------------
MACB1_AERHH     ----------------------------------------------------------------------
LPTB_SHIFL      ----------------------------------------------------------------------
LPTB_ECOLI      ----------------------------------------------------------------------
LPTB_ECOL6      ----------------------------------------------------------------------
LPTB_ECO57      ----------------------------------------------------------------------
CBIO2_THETN     ----------------------------------------------------------------------
CBIO2_MESFL     ----------------------------------------------------------------------
ABCCC_DICDI     ----------------------------------------------------------------------
ABCCB_HUMAN     ----------------------------------------------------------------------
ZNUC_PHOLL      ----------------------------------------------------------------------
Y2030_SULSO     ----------------------------------------------------------------------
Y1281_GEOSL     ----------------------------------------------------------------------
Y020_ONYPE      ----------------------------------------------------------------------
RLI1_YEAST      ----------------------------------------------------------------------
PHNC2_HALMA     ----------------------------------------------------------------------
PHNC1_HALMA     ----------------------------------------------------------------------
NODI_RHILV      ----------------------------------------------------------------------
NODI_RALME      ----------------------------------------------------------------------
NODI_BURTA      ----------------------------------------------------------------------
MSBA_FRATT      ----------------------------------------------------------------------
MSBA_FRAT1      ----------------------------------------------------------------------
MDR1_CAEEL      ----------------------------------------------------------------------
MDL1_YEAST      ----------------------------------------------------------------------
LOLD_PSEPK      ----------------------------------------------------------------------
LOLD_DECAR      ----------------------------------------------------------------------
LKTB_ACTAC      ----------------------------------------------------------------------
CBIO2_MYCPU     ----------------------------------------------------------------------
ARAG_AZOBR      ----------------------------------------------------------------------
ARAG2_BURS3     ----------------------------------------------------------------------
ARAG2_BURCM     ----------------------------------------------------------------------
AB5B_ARATH      ----------------------------------------------------------------------
ZNUC_SHIFL      ----------------------------------------------------------------------
ZNUC_SHIF8      ----------------------------------------------------------------------
ZNUC_SALTY      ----------------------------------------------------------------------
ZNUC_SALTI      ----------------------------------------------------------------------
ZNUC_SALPA      ----------------------------------------------------------------------
ZNUC_SALCH      ----------------------------------------------------------------------
NDVA_RHIL3      ----------------------------------------------------------------------
MSBA_SHEFN      ----------------------------------------------------------------------
MSBA_CHRVO      ----------------------------------------------------------------------
MACB_CHLPD      ----------------------------------------------------------------------
MACB_CAMJR      ----------------------------------------------------------------------
MACB_CAMJE      ----------------------------------------------------------------------
HMUV_PSEE4      ----------------------------------------------------------------------
FEPC_ECOLI      ----------------------------------------------------------------------
CBIO2_STRPM     ----------------------------------------------------------------------
CBIO2_STRPF     ----------------------------------------------------------------------
CBIO2_STRPD     ----------------------------------------------------------------------
CBIO2_STRPC     ----------------------------------------------------------------------
CBIO2_STRPB     ----------------------------------------------------------------------
CBIO2_LACSS     ----------------------------------------------------------------------
CBIO2_LACLS     ----------------------------------------------------------------------
CBIO1_STRPG     ----------------------------------------------------------------------
CBIO1_STRP8     ----------------------------------------------------------------------
CBIO1_STRP6     ----------------------------------------------------------------------
CBIO1_STRP3     ----------------------------------------------------------------------
CBIO1_STRP1     ----------------------------------------------------------------------
CBIO1_STAAW     ----------------------------------------------------------------------
CBIO1_STAAS     ----------------------------------------------------------------------
CBIO1_STAAR     ----------------------------------------------------------------------
CBIO1_STAAN     ----------------------------------------------------------------------
CBIO1_STAAM     ----------------------------------------------------------------------
CBIO1_STAAC     ----------------------------------------------------------------------
CBIO1_STAA8     ----------------------------------------------------------------------
CBIO1_STAA3     ----------------------------------------------------------------------
CBIO1_MYCCT     ----------------------------------------------------------------------
CBIO1_BACLD     ----------------------------------------------------------------------
ARAG2_BURCH     ----------------------------------------------------------------------
ARAG2_BURCA     ----------------------------------------------------------------------
ABCG5_MOUSE     ----------------------------------------------------------------------
ABCCA_DICDI     ----------------------------------------------------------------------
ABCC9_HUMAN     ----------------------------------------------------------------------
ABCB9_HUMAN     ----------------------------------------------------------------------
AB4C_ARATH      ----------------------------------------------------------------------
AB21B_ARATH     ----------------------------------------------------------------------
ZNUC_RHIEC      ----------------------------------------------------------------------
YCLP_BACSU      ----------------------------------------------------------------------
Y1704_LACJO     ----------------------------------------------------------------------
Y1384_MYCBO     ----------------------------------------------------------------------
Y1349_MYCTU     ----------------------------------------------------------------------
XYLG_PSESM      ----------------------------------------------------------------------
RGMG_RHOFD      ----------------------------------------------------------------------
RBSA1_RHIME     ----------------------------------------------------------------------
PHNC_RHIEC      ----------------------------------------------------------------------
PHNC1_NATPD     ----------------------------------------------------------------------
MRP5_RAT        ----------------------------------------------------------------------
MRP5_MOUSE      ----------------------------------------------------------------------
MRP5_HUMAN      ----------------------------------------------------------------------
MDR49_DROME     ----------------------------------------------------------------------
MACB_VIBPA      ----------------------------------------------------------------------
HMUV_PASPI      ----------------------------------------------------------------------
HMUV_LISDA      ----------------------------------------------------------------------
CBIO2_MYCPN     ----------------------------------------------------------------------
CBIO1_STRTD     ----------------------------------------------------------------------
CBIO1_STRT2     ----------------------------------------------------------------------
CBIO1_STRT1     ----------------------------------------------------------------------
CBIO1_STRR6     ----------------------------------------------------------------------
CBIO1_STRPN     ----------------------------------------------------------------------
CBIO1_STRP2     ----------------------------------------------------------------------
CBIO1_MYCGA     ----------------------------------------------------------------------
CBIO1_CLONN     ----------------------------------------------------------------------
ABCG5_RAT       ----------------------------------------------------------------------
AB4B_ARATH      ----------------------------------------------------------------------
ZNUC_RHIL3      ----------------------------------------------------------------------
ZNUC_PSEAE      ----------------------------------------------------------------------
ZNUC_PSEAB      ----------------------------------------------------------------------
ZNUC_JANSC      ----------------------------------------------------------------------
Y2655_BACCR     ----------------------------------------------------------------------
TAP1_GORGO      ----------------------------------------------------------------------
RAD50_SULTO     ----------------------------------------------------------------------
PHNC2_ROSDO     ----------------------------------------------------------------------
NODI_RHIS3      ----------------------------------------------------------------------
NDVA_AGRVI      ----------------------------------------------------------------------
MDLA_BUCAP      ----------------------------------------------------------------------
LOLD_PSEPF      ----------------------------------------------------------------------
CBIO1_LACC3     ----------------------------------------------------------------------
CBIO1_LACBA     ----------------------------------------------------------------------
AB1G_ARATH      ----------------------------------------------------------------------
AB1A_ARATH      ----------------------------------------------------------------------
AB14C_ARATH     ----------------------------------------------------------------------
AB13G_ARATH     ----------------------------------------------------------------------
AB12B_ARATH     ----------------------------------------------------------------------
ZNUC_SILPO      ----------------------------------------------------------------------
ZNUC_PSEU2      ----------------------------------------------------------------------
ZNUC_ERWCT      ----------------------------------------------------------------------
YOX6_SCHPO      ----------------------------------------------------------------------
YGAD_BACSU      ----------------------------------------------------------------------
Y3926_AZOC5     ----------------------------------------------------------------------
Y2317_HALSA     ----------------------------------------------------------------------
RBSA2_RUBXD     ----------------------------------------------------------------------
PSTB1_THETN     ----------------------------------------------------------------------
POTA_LACLS      ----------------------------------------------------------------------
POTA_LACLA      ----------------------------------------------------------------------
PHNC_LACPL      ----------------------------------------------------------------------
PHNC2_RHOFD     ----------------------------------------------------------------------
PHNC2_PSE14     ----------------------------------------------------------------------
NODI1_RHIME     ----------------------------------------------------------------------
NDVA_RHIEC      ----------------------------------------------------------------------
MDR3_CAEEL      ----------------------------------------------------------------------
MACB_CAMJJ      ----------------------------------------------------------------------
GLNQ_BACSU      ----------------------------------------------------------------------
CBIO1_UREPA     ----------------------------------------------------------------------
CBIO1_OCEIH     ----------------------------------------------------------------------
CBIO1_MYCGE     ----------------------------------------------------------------------
ARTM_BACSU      ----------------------------------------------------------------------
ABCB6_HUMAN     ----------------------------------------------------------------------
AB2E_ARATH      ----------------------------------------------------------------------
AB27B_ARATH     ----------------------------------------------------------------------
AB13B_ARATH     ----------------------------------------------------------------------
ZNUC_AGRT5      ----------------------------------------------------------------------
Y5533_VIBVU     ----------------------------------------------------------------------
Y5482_VIBPA     ----------------------------------------------------------------------
Y4342_METAC     ----------------------------------------------------------------------
Y4021_METAC     ----------------------------------------------------------------------
Y1680_STRA3     ----------------------------------------------------------------------
RBSA_RHOSR      ----------------------------------------------------------------------
RBSA_BURPS      ----------------------------------------------------------------------
RBSA2_BURP1     ----------------------------------------------------------------------
RBSA1_STRAW     ----------------------------------------------------------------------
RBSA1_BURS3     ----------------------------------------------------------------------
PHNC2_TRIEI     ----------------------------------------------------------------------
MSBA_SHESR      ----------------------------------------------------------------------
MSBA_SHESM      ----------------------------------------------------------------------
MSBA_SHEON      ----------------------------------------------------------------------
MRP3_MOUSE      ----------------------------------------------------------------------
MACB_BRAJA      ----------------------------------------------------------------------
LOLD_RALSO      ----------------------------------------------------------------------
LOLD_PSEHT      ----------------------------------------------------------------------
LOLD_HYPNA      ----------------------------------------------------------------------
LCNCL_LACLA     ----------------------------------------------------------------------
COMA_STRR6      ----------------------------------------------------------------------
COMA_STRPN      ----------------------------------------------------------------------
CBIO_SALTI      ----------------------------------------------------------------------
CBIO_SALPA      ----------------------------------------------------------------------
CBIO_MOOTA      ----------------------------------------------------------------------
CBIO_METJA      ----------------------------------------------------------------------
CBIO1_METHJ     ----------------------------------------------------------------------
AB6B_ARATH      ----------------------------------------------------------------------
AB11B_ARATH     ----------------------------------------------------------------------
YWJA_BACSU      ----------------------------------------------------------------------
YO075_YEAST     ----------------------------------------------------------------------
YHEI_BACSU      ----------------------------------------------------------------------
YCOBB_RHOCA     ----------------------------------------------------------------------
YBBL_ECOLI      ----------------------------------------------------------------------
Y2641_BACAN     ----------------------------------------------------------------------
Y2424_BACHK     ----------------------------------------------------------------------
Y1893_SULSO     ----------------------------------------------------------------------
RBSA_CORGL      ----------------------------------------------------------------------
PSTB_SULSO      ----------------------------------------------------------------------
PHNC_RHIME      ----------------------------------------------------------------------
PHNC_RHIL3      ----------------------------------------------------------------------
PHNC1_TRIEI     ----------------------------------------------------------------------
NODI_BRASS      ----------------------------------------------------------------------
MSBA_FRATO      ----------------------------------------------------------------------
MSBA_FRATH      ----------------------------------------------------------------------
MRP3_RAT        ----------------------------------------------------------------------
MRP3_HUMAN      ----------------------------------------------------------------------
MALK_VIBPA      ----------------------------------------------------------------------
MALK_SHISS      ----------------------------------------------------------------------
MALK_SHIFL      ----------------------------------------------------------------------
MALK_SHIF8      ----------------------------------------------------------------------
MALK_ECOUT      ----------------------------------------------------------------------
MALK_ECOLI      ----------------------------------------------------------------------
MALK_ECOL6      ----------------------------------------------------------------------
MALK_ECOL5      ----------------------------------------------------------------------
MALK_ECO57      ----------------------------------------------------------------------
MACB_SHESW      ----------------------------------------------------------------------
MACB_CHLTE      ----------------------------------------------------------------------
MACB_BDEBA      ----------------------------------------------------------------------
LSRA_YERE8      ----------------------------------------------------------------------
LSRA_PHOLL      ----------------------------------------------------------------------
LOLD_SHEDO      ----------------------------------------------------------------------
LOLD_CHRSD      ----------------------------------------------------------------------
HRTA_STAS1      ----------------------------------------------------------------------
CCMA_PSEAE      ----------------------------------------------------------------------
CBIO3_CLOP1     ----------------------------------------------------------------------
CBIO2_CLOPS     ----------------------------------------------------------------------
CBIO2_CLOPE     ----------------------------------------------------------------------
BTUD_VIBPA      ----------------------------------------------------------------------
BTUD_CITK8      ----------------------------------------------------------------------
ARAG_BACST      ----------------------------------------------------------------------
ABCA7_HUMAN     ----------------------------------------------------------------------
ABCA4_DICDI     ----------------------------------------------------------------------
AB29B_ARATH     ----------------------------------------------------------------------
AB15B_ARATH     ----------------------------------------------------------------------
ZNUC_RHIME      ----------------------------------------------------------------------
YVFR_BACSU      ----------------------------------------------------------------------
Y986_MYCTU      ----------------------------------------------------------------------
Y1583_CLOPE     ----------------------------------------------------------------------
Y1508_METJA     ----------------------------------------------------------------------
Y124_THEMA      ----------------------------------------------------------------------
Y1242_METJA     ----------------------------------------------------------------------
RBSA_SHISS      ----------------------------------------------------------------------
RBSA_SALTY      ----------------------------------------------------------------------
RBSA_SALTI      ----------------------------------------------------------------------
RBSA_SALPA      ----------------------------------------------------------------------
RBSA_SALCH      ----------------------------------------------------------------------
RBSA_OCEIH      ----------------------------------------------------------------------
RBSA_ECOUT      ----------------------------------------------------------------------
RBSA_ECOLI      ----------------------------------------------------------------------
RBSA_ECOL6      ----------------------------------------------------------------------
RBSA_ECOL5      ----------------------------------------------------------------------
RBSA_BACCR      ----------------------------------------------------------------------
RBSA1_ECO57     ----------------------------------------------------------------------
RBSA1_BURCM     ----------------------------------------------------------------------
RBSA1_BURCH     ----------------------------------------------------------------------
RBSA1_BURCA     ----------------------------------------------------------------------
PHNC_WOLSU      ----------------------------------------------------------------------
PHNC2_RALME     ----------------------------------------------------------------------
PHNC2_BACHD     ----------------------------------------------------------------------
PHNC2_ANASP     ----------------------------------------------------------------------
PHNC1_RALME     ----------------------------------------------------------------------
PDR13_ORYSJ     ----------------------------------------------------------------------
NDVA_BRUSU      ----------------------------------------------------------------------
NDVA_BRUME      ----------------------------------------------------------------------
NDVA_BRUAB      ----------------------------------------------------------------------
NDVA_BRUA2      ----------------------------------------------------------------------
NAP5_ARATH      ----------------------------------------------------------------------
LMRA_LACLA      ----------------------------------------------------------------------
LAGD_LACLA      ----------------------------------------------------------------------
HMUV_SALRD      ----------------------------------------------------------------------
HMUV_RHOP5      ----------------------------------------------------------------------
GLNQ_BACST      ----------------------------------------------------------------------
CBRD_DICD3      ----------------------------------------------------------------------
CBIO_SALTY      ----------------------------------------------------------------------
CBIO2_LACLM     ----------------------------------------------------------------------
CBIO2_ENTFA     ----------------------------------------------------------------------
BTUD_VIBSL      ----------------------------------------------------------------------
ABCGK_DICDI     ----------------------------------------------------------------------
ABCBB_HUMAN     ----------------------------------------------------------------------
ABCA7_RAT       ----------------------------------------------------------------------
ABCA7_MOUSE     ----------------------------------------------------------------------
AB9B_ARATH      ----------------------------------------------------------------------
AB5C_ARATH      ----------------------------------------------------------------------
AB31G_ARATH     ----------------------------------------------------------------------
AB22G_ARATH     ----------------------------------------------------------------------
AB22B_ARATH     ----------------------------------------------------------------------
ZNUC_SACD2      ----------------------------------------------------------------------
ZNUC_PSYCK      ----------------------------------------------------------------------
ZNUC_PSYA2      ----------------------------------------------------------------------
YRIBC_METTM     ----------------------------------------------------------------------
YHIH_ECOLI      ----------------------------------------------------------------------
YFEB_YERPE      ----------------------------------------------------------------------
Y348_CHLPN      ----------------------------------------------------------------------
Y1934_STRMU     ----------------------------------NGIIPNIYKGQAEGSL-TIDGKDVF--DLSIYEKVS
Y1633_STRA5     ----------------------------------------------------------------------
XYLG_THEP3      ----------------------------------------------------------------------
THIQ_RHIME      ----------------------------------------------------------------------
SRTF_STRPY      ----------------------------------------------------------------------
SRTF_STRP1      ----------------------------------------------------------------------
RBSA_PHOLL      ----------------------------------------------------------------------
RBSA_BACHK      ----------------------------------------------------------------------
RBSA_BACCZ      ----------------------------------------------------------------------
RBSA_BACC1      ----------------------------------------------------------------------
RBSA_BACAN      ----------------------------------------------------------------------
RBSA2_AGRT5     ----------------------------------------------------------------------
RBSA1_AGRT5     ----------------------------------------------------------------------
RAD50_PYRHO     ----------------------------------------------------------------------
RAD50_PYRAB     ----------------------------------------------------------------------
PTXA_PSEST      ----------------------------------------------------------------------
PHNC_MESFL      ----------------------------------------------------------------------
MALK_SALTY      ----------------------------------------------------------------------
MALK_SALTI      ----------------------------------------------------------------------
MALK_SALPA      ----------------------------------------------------------------------
MALK_SALCH      ----------------------------------------------------------------------
LSRA_PHOLU      ----------------------------------------------------------------------
LOLD_XANC5      ----------------------------------------------------------------------
LOLD_PSEAE      ----------------------------------------------------------------------
LOLD_BRAJA      ----------------------------------------------------------------------
LMRA_LACLM      ----------------------------------------------------------------------
LIVF_ARCFU      ----------------------------------------------------------------------
HMUV_RHOPB      ----------------------------------------------------------------------
CBIO_METMP      ----------------------------------------------------------------------
CBIO2_CLOTE     ----------------------------------------------------------------------
CBIO1_LEUMM     ----------------------------------------------------------------------
BTUD_ERWCT      ----------------------------------------------------------------------
ATM1_YEAST      ----------------------------------------------------------------------
ABCG8_HUMAN     ----------------------------------------------------------------------
ABCG1_HUMAN     ----------------------------------------------------------------------
ABCC1_DICDI     ----------------------------------------------------------------------
AB14G_ARATH     ----------------------------------------------------------------------
YBHF_SHIFL      ----------------------------------------------------------------------
YBHF_ECOLI      ----------------------------------------------------------------------
Y731_ARCFU      ----------------------------------------------------------------------
Y528_PYRFU      ----------------------------------------------------------------------
RGMG_THETN      ----------------------------------------------------------------------
RBSA_STRA5      ----------------------------------------------------------------------
RBSA_STRA3      ----------------------------------------------------------------------
RBSA_STRA1      ----------------------------------------------------------------------
RBSA_RHOBA      ----------------------------------------------------------------------
RBSA3_RHIL3     ----------------------------------------------------------------------
RAD50_PYRFU     ----------------------------------------------------------------------
PSTB_GLUOX      ----------------------------------------------------------------------
MSBA_IDILO      ----------------------------------------------------------------------
MODC_GRABC      ----------------------------------------------------------------------
MDL2_YEAST      ----------------------------------------------------------------------
LOLD_XANCP      ----------------------------------------------------------------------
LOLD_XANC8      ----------------------------------------------------------------------
LOLD_VIBCH      ----------------------------------------------------------------------
LOLD_RALME      ----------------------------------------------------------------------
LCNC_LACLA      ----------------------------------------------------------------------
HMUV_RHOPS      ----------------------------------------------------------------------
HMUV_RHOP2      ----------------------------------------------------------------------
CCMA_RHOPB      ----------------------------------------------------------------------
CBIO2_STAHJ     ----------------------------------------------------------------------
CBIO1_THETN     ----------------------------------------------------------------------
CBIO1_MYCPN     ----------------------------------------------------------------------
ADCC_STRR6      ----------------------------------------------------------------------
ADCC_STRPN      ----------------------------------------------------------------------
ABCCD_DICDI     ----------------------------------------------------------------------
ABCB9_MOUSE     ----------------------------------------------------------------------
AB6G_ARATH      ----------------------------------------------------------------------
AB18B_ARATH     ----------------------------------------------------------------------
AB10C_ARATH     ----------------------------------------------------------------------
ZNUC_MAGSM      ----------------------------------------------------------------------
ZNUC_HAES1      ----------------------------------------------------------------------
YDIF_BACSU      ----------------------------------------------------------------------
Y804_OCEIH      ----------------------------------------------------------------------
Y492_RICBR      ----------------------------------------------------------------------
TCYC_BACSU      ----------------------------------------------------------------------
TAP1_HUMAN      ----------------------------------------------------------------------
SSUB1_PARDP     ----------------------------------------------------------------------
RGMG_PSEU2      ----------------------------------------------------------------------
RGMG_PSESM      ----------------------------------------------------------------------
RGMG_PSEF5      ----------------------------------------------------------------------
RGMG_BACHD      ----------------------------------------------------------------------
RGMG3_BURCM     ----------------------------------------------------------------------
RBSA_BACSK      ----------------------------------------------------------------------
RBSA2_BURTA     ----------------------------------------------------------------------
RBSA1_RUBXD     ----------------------------------------------------------------------
PHNC3_BACHD     ----------------------------------------------------------------------
PHNC3_ANASP     ----------------------------------------------------------------------
PHNC2_RHOP2     ----------------------------------------------------------------------
PDR3_TOBAC      ----------------------------------------------------------------------
NOCP_AGRT5      ----------------------------------------------------------------------
MSBA1_COLP3     ----------------------------------------------------------------------
MNTB_BACHD      ----------------------------------------------------------------------
MNTA_SYNY3      ----------------------------------------------------------------------
MGLA_TREDE      ----------------------------------------------------------------------
METN_PROAC      ----------------------------------------------------------------------
MACB_NITWN      ----------------------------------------------------------------------
LOLD_ZYMMO      ----------------------------------------------------------------------
LOLD_XANAC      ----------------------------------------------------------------------
LOLD_VIBF1      ----------------------------------------------------------------------
LOLD_MESSB      ----------------------------------------------------------------------
HMUV_VIBF1      ----------------------------------------------------------------------
HMUV_VIBCH      ----------------------------------------------------------------------
CYDC_HAEIN      ----------------------------------------------------------------------
CCMA_GRABC      ----------------------------------------------------------------------
CBIO2_SYMTH     ----------------------------------------------------------------------
CBIO2_LACLA     ----------------------------------------------------------------------
CBIO1_MYCMO     ----------------------------------------------------------------------
CBIO1_BACHK     ----------------------------------------------------------------------
CBIO1_BACHD     ----------------------------------------------------------------------
CBIO1_BACC1     ----------------------------------------------------------------------
CBIO1_BACAN     ----------------------------------------------------------------------
CBIO1_BACAH     ----------------------------------------------------------------------
BTUD_SALTY      ----------------------------------------------------------------------
BTUD_SALTI      ----------------------------------------------------------------------
BTUD_SALPK      ----------------------------------------------------------------------
BTUD_SALPA      ----------------------------------------------------------------------
BTUD_SALHS      ----------------------------------------------------------------------
BTUD_SALEP      ----------------------------------------------------------------------
BTUD_SALDC      ----------------------------------------------------------------------
BTUD_SALCH      ----------------------------------------------------------------------
BTUD_ECOUT      ----------------------------------------------------------------------
BTUD_ECOL6      ----------------------------------------------------------------------
BTUD_ECOL5      ----------------------------------------------------------------------
BTUD_ECOK1      ----------------------------------------------------------------------
BTUD_ECO81      ----------------------------------------------------------------------
BTUD_ECO45      ----------------------------------------------------------------------
BTUD_ECO27      ----------------------------------------------------------------------
ABCG2_MOUSE     ----------------------------------------------------------------------
ABCC9_RABIT     ----------------------------------------------------------------------
ABCC2_DICDI     ----------------------------------------------------------------------
ABCB9_RAT       ----------------------------------------------------------------------
ABCB6_MOUSE     ----------------------------------------------------------------------
AB9C_ARATH      ----------------------------------------------------------------------
AB4G_ARATH      ----------------------------------------------------------------------
AB26B_ARATH     ----------------------------------------------------------------------
YFMF_BACSU      ----------------------------------------------------------------------
Y3551_METAC     ----------------------------------------------------------------------
Y2766_STAAR     ----------------------------------------------------------------------
Y2708_STAAC     ----------------------------------------------------------------------
Y2684_STAAM     ----------------------------------------------------------------------
Y2668_BACC1     ----------------------------------------------------------------------
Y2603_STAAW     ----------------------------------------------------------------------
Y2569_STAAS     ----------------------------------------------------------------------
Y2476_STAAN     ----------------------------------------------------------------------
Y2153_ENTFA     ----------------------------------------------------------------------
TAGB_DICDI      ----------------------------------------------------------------------
RGMG_PSE14      ----------------------------------------------------------------------
RBSA3_RHIEC     ----------------------------------------------------------------------
RBSA1_RHIL3     ----------------------------------------------------------------------
PSTB1_CHRSD     ----------------------------------------------------------------------
POTA_STRA5      ----------------------------------------------------------------------
POTA_STRA3      ----------------------------------------------------------------------
POTA_STRA1      ----------------------------------------------------------------------
PHNC_ANAVT      ----------------------------------------------------------------------
PHNC2_RALEH     ----------------------------------------------------------------------
PHNC2_PSESM     ----------------------------------------------------------------------
PEB1C_CAMJJ     ----------------------------------------------------------------------
PEB1C_CAMJE     ----------------------------------------------------------------------
NODI_BRAJA      ----------------------------------------------------------------------
NDVA_RHIME      ----------------------------------------------------------------------
NDVA_RHILO      ----------------------------------------------------------------------
MSBA_PSEA6      ----------------------------------------------------------------------
MRP2_RAT        ----------------------------------------------------------------------
MRP2_MOUSE      ----------------------------------------------------------------------
MALK_VIBF1      ----------------------------------------------------------------------
MALK_PHOPR      ----------------------------------------------------------------------
MACB_MANSM      ----------------------------------------------------------------------
MACB_HYPNA      ----------------------------------------------------------------------
LSRA_PHOTE      ----------------------------------------------------------------------
LOLD_XANOR      ----------------------------------------------------------------------
LOLD_XANOM      ----------------------------------------------------------------------
LOLD_VIBVY      ----------------------------------------------------------------------
LOLD_VIBVU      ----------------------------------------------------------------------
LOLD_RALEJ      ----------------------------------------------------------------------
HMUV_SODGM      ----------------------------------------------------------------------
FBPC_PSEPF      ----------------------------------------------------------------------
EF3_CANGA       ----------------------------------------------------------------------
CBIO_CARHZ      ----------------------------------------------------------------------
CBIO2_MYCHJ     ----------------------------------------------------------------------
CBIO2_MYCH7     ----------------------------------------------------------------------
CBIO1_MYCH2     ----------------------------------------------------------------------
ATM1_ASHGO      ----------------------------------------------------------------------
AOTP_PSEAE      ----------------------------------------------------------------------
ABCG5_HUMAN     ----------------------------------------------------------------------
ABCG2_PIG       ----------------------------------------------------------------------
ABCG2_BOVIN     ----------------------------------------------------------------------
ABCB6_RAT       ----------------------------------------------------------------------
AB7G_ARATH      ----------------------------------------------------------------------
AB7C_ARATH      ----------------------------------------------------------------------
AB3E_ARATH      ----------------------------------------------------------------------
AB3C_ARATH      ----------------------------------------------------------------------
AB15C_ARATH     ----------------------------------------------------------------------
ZNUC_RHOS4      ----------------------------------------------------------------------
ZNUC_PSESM      ----------------------------------------------------------------------
ZNUC_MESSB      ----------------------------------------------------------------------
ZNUC_HAEIN      ----------------------------------------------------------------------
YKNU_BACSU      ----------------------------------------------------------------------
Y906_TREDE      -----------------------------------------------GLCPRFY-EGEITGSLTLNGKVL
Y719_METJA      ----------------------------------------------------------------------
Y664_HAEIN      ----------------------------------------------------------------------
Y4GM_RHISN      ----------------------------------------------------------------------
Y391_CHLTE      ----------------------------------------------------------------------
Y1589_THETN     ----------------------------------------------------------------------
Y1078_HAEIN     ----------------------------------------------------------------------
XYLG_BURCM      ----------------------------------------------------------------------
SCRT_DROME      ----------------------------------------------------------------------
RBSA_SILST      ----------------------------------------------------------------------
RBSA_RHOS4      ----------------------------------------------------------------------
RBSA_JANSC      ----------------------------------------------------------------------
RBSA_DEIGD      ----------------------------------------------------------------------
RBSA_BACHD      ----------------------------------------------------------------------
RBSA2_RHIME     ----------------------------------------------------------------------
RBSA2_RHIL3     ----------------------------------------------------------------------
RBSA1_THEMA     ----------------------------------------------------------------------
RBSA1_STRCO     ----------------------------------------------------------------------
RAD50_AERPE     ----------------------------------------------------------------------
PSTB_THEMA      ----------------------------------------------------------------------
PMD1_SCHPO      ----------------------------------------------------------------------
PHNC_HYPNA      ----------------------------------------------------------------------
MODC_AGRT5      ----------------------------------------------------------------------
MGLA1_PHOPR     ----------------------------------------------------------------------
METN_RALEH      ----------------------------------------------------------------------
MDLB_ECOLI      ----------------------------------------------------------------------
MDLB_ECOL6      ----------------------------------------------------------------------
MDLB_ECO57      ----------------------------------------------------------------------
MACB_RHOBA      ----------------------------------------------------------------------
LOLD_SPHAL      ----------------------------------------------------------------------
LOLD_BORPE      ----------------------------------------------------------------------
LOLD_BORPA      ----------------------------------------------------------------------
LOLD_BORBR      ----------------------------------------------------------------------
LOLD_AQUAE      ----------------------------------------------------------------------
LOLD2_PELLD     ----------------------------------------------------------------------
HMUV_NITWN      ----------------------------------------------------------------------
CYSA_ANTFO      ----------------------------------------------------------------------
CCMA_PSEF5      ----------------------------------------------------------------------
CCMA_BRAJA      ----------------------------------------------------------------------
CBIO2_MYCGA     ----------------------------------------------------------------------
CBIO1_MESFL     ----------------------------------------------------------------------
BTUD_YERE8      ----------------------------------------------------------------------
ARAG_BACHD      ----------------------------------------------------------------------
AB8G_ARATH      ----------------------------------------------------------------------
AB7B_ARATH      ----------------------------------------------------------------------
AB23G_ARATH     ----------------------------------------------------------------------
AB20B_ARATH     ----------------------------------------------------------------------
ZNUC_PASMU      ----------------------------------------------------------------------
YKNV_BACSU      ----------------------------------------------------------------------
Y2439_THEEB     ----------------------------------------------------------------------
Y1312_MYCBO     ----------------------------------------------------------------------
Y1281_MYCTU     ----------------------------------------------------------------------
Y068_CHLTR      ----------------------------------------------------------------------
SSUB_MYCPA      ----------------------------------------------------------------------
SSUB_MYCA1      ----------------------------------------------------------------------
RBSA_BURXL      ----------------------------------------------------------------------
RBSA2_STRAW     ----------------------------------------------------------------------
RBSA2_PASMU     ----------------------------------------------------------------------
PSTB_WOLSU      ----------------------------------------------------------------------
POTA_STRSV      ----------------------------------------------------------------------
POTA_SPICI      ----------------------------------------------------------------------
PHNC_BACSK      ----------------------------------------------------------------------
PHNC2_PSEU2     ----------------------------------------------------------------------
PHNC2_NATPD     ----------------------------------------------------------------------
PDR12_ORYSJ     ----------------------------------------------------------------------
MSMK_STRMU      ----------------------------------------------------------------------
MSBA_PSEHT      ----------------------------------------------------------------------
MODC_PSEF5      ----------------------------------------------------------------------
METN_RHOP5      ----------------------------------------------------------------------
METN2_ERWCT     ----------------------------------------------------------------------
LSRA_YERPY      ----------------------------------------------------------------------
LSRA_YERPS      ----------------------------------------------------------------------
LSRA_YERPP      ----------------------------------------------------------------------
LSRA_YERPN      ----------------------------------------------------------------------
LSRA_YERPG      ----------------------------------------------------------------------
LSRA_YERPE      ----------------------------------------------------------------------
LSRA_YERPB      ----------------------------------------------------------------------
LSRA_YERPA      ----------------------------------------------------------------------
LSRA_YERP3      ----------------------------------------------------------------------
LOLD_YERPS      ----------------------------------------------------------------------
LOLD_PSEA6      ----------------------------------------------------------------------
LOLD_NEOSM      ----------------------------------------------------------------------
CCMA_NITWN      ----------------------------------------------------------------------
CCMA_NITHX      ----------------------------------------------------------------------
CBIO_ENTFC      ----------------------------------------------------------------------
CBIO1_OENOB     ----------------------------------------------------------------------
CBIO1_BACSU     ----------------------------------------------------------------------
CBIO1_BACCR     ----------------------------------------------------------------------
BTUD_VIBVU      ----------------------------------------------------------------------
BTUD_SHISS      ----------------------------------------------------------------------
BTUD_SHIFL      ----------------------------------------------------------------------
BTUD_SHIF8      ----------------------------------------------------------------------
BTUD_SHIDS      ----------------------------------------------------------------------
BTUD_SHIB3      ----------------------------------------------------------------------
BTUD_PHOPR      ----------------------------------------------------------------------
BTUD_ECOSM      ----------------------------------------------------------------------
BTUD_ECOSE      ----------------------------------------------------------------------
BTUD_ECOLU      ----------------------------------------------------------------------
BTUD_ECOLI      ----------------------------------------------------------------------
BTUD_ECOLC      ----------------------------------------------------------------------
BTUD_ECOHS      ----------------------------------------------------------------------
BTUD_ECODH      ----------------------------------------------------------------------
BTUD_ECOBW      ----------------------------------------------------------------------
BTUD_ECO8A      ----------------------------------------------------------------------
BTUD_ECO7I      ----------------------------------------------------------------------
BTUD_ECO55      ----------------------------------------------------------------------
BTUD_ECO24      ----------------------------------------------------------------------
ARAG_RHIME      ----------------------------------------------------------------------
ARAG_PSEPF      ----------------------------------------------------------------------
ABCG4_HUMAN     ----------------------------------------------------------------------
ABCG2_MACMU     ----------------------------------------------------------------------
ABCG2_HUMAN     ----------------------------------------------------------------------
ABCC7_DICDI     ----------------------------------------------------------------------
AB6C_ARATH      ----------------------------------------------------------------------
AB41G_ARATH     ----------------------------------------------------------------------
AB37G_ARATH     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TVCETCEGKRFQASVLKYTLGGRTISDVLEMSVXXXXXXXXXXXXXLPAAHAILTRLADVGLGYLSLGQP
UVRA_AQUAE      VTCEVCKGKRYNRETLEITYKGKNIADVLEMTVDEAYDFFENH----PAIRRKLQILKDVGLGYIKLGQP
UVRA_THET8      VPCEVCKGKRYNKETLEVKLRGKSIADVLDMTVEEALDFFQN----VPSIARKLQLMVDVGLGYMKLGQP
UVRA_BACHD      VPCEVCHGKRYNRETLDITYKGKTIADVLDMTVEEALEFFTN----IPRIKRKIQTLVDVGLGYIKLGQP
UVRA_CLOPE      VPCEVCKGKRYNRETLEVKYKGKNIADVLNMTVEEALEFFEN----IPRIKNKLQTLMDVGLGYIRLGQP
UVRA_MYCLE      VPCEVCQGARYNRETLEVHYKGKAISEVLDMSIXXXXXXXXP----IIGINRYLRTLVDVGLGYVRLGQP
UVRA_XANAC      VPCDVCHGKRYNRETLEIRYKGFNISDVLQMTVEDALRLFEP----VPSIARKLETLVDVGLSYIKLGQS
UVRA_XANCP      VPCDVCHGKRYNRETLEIRYKGFNISDVLQMTVEDALRLFEP----VPSIARKLETLVDVGLSYIKLGQS
UVRA_METTH      VPCEVCRGRRYNEETLEIRYRGRNIAEVLDMTVEEALEFFEN----IPQVRRKLQTLYDVGLGYIKLGQP
UVRA_THEMA      VECDVCKGKRYNRETLEITYKGKNISDILDMTVDEALEFFKN----IPSIKRTLQVLHDVGLGYVKLGQP
UVRA_SYNY3      VQCDVCKGARYNRETLQVKYKGHSIADVLAMTTEEALTVFEN----IPRAVNRLQTLVDVGLGYIKLGQP
UVRA_PSEAE      VPCDVCKGKRYNRETLEIRYKGKSIHEVLEMTIEEAREFFDA----VPALARKLQTLMDVGLSYIKLGQS
UVRA_BACSU      VPCEVCHGKRYNRETLEVTYKGKSISDVLDMTVEDALSFFEN----IPKIKRKLQTLYDVGLGYITLGQP
UVRA_OCEIH      VPCEVCHGARYNRETLEVKYKGKNISEVLELRIEEALEFFSA----IPKIKRKLQTVYDVGLGYIRLGQP
UVRA_LEPIN      VTCEVCKGKRYNQETLEVRYKGKNIFDVLEMTVEDANQFFEN----IPIVKRKLETLLEVGLGYIRLGQP
UVRA_LEPIC      VTCEVCKGKRYNQETLEVRYKGKNIFDVLEMTVEDANQFFEN----IPIVKRKLETLLEVGLGYIRLGQP
UVRA_CLOAB      VPCDVCKGKRYNRETLEIKYKDKNIDDLLNMTVEDALKFFEN----LPRIKNKLQTLADVGLGYVRLGQP
UVRA_PSEPK      VPCDVCKSKRYNRETLEIKYKGKNIHEVLEMTIEDAREFFDA----VPALARKLQTLMDVGLSYIKLGQS
UVRA_RICBR      VKCDICNGHRYNRETLEIKYKGKSIADILMMTVEDAMQFFEK----IPLIYEKLITLNEVGLGYIKIGQS
UVRA_RICCN      VKCDICNGHRYNRETLEIKYKGKSIADILMMTVEDAMQFFEK----IPLIYEKLITLNEVGLGYIKIGQS
UVRA_RICFE      VKCDICNGHRYNRETLEIKYKGKSIADILMMTVEDAMQFFEK----IPLIYEKLITLNEVGLGYIKIGQS
UVRA_STRP1      VPCEVCHGRRYNSETLEVHYKGKNIAEVLDMTVDDALVFFSA----IPKIARKIQTIKDVGLGYVTLGQP
UVRA_UREPA      ISCEECHGKRYNDETLQVKFKGKSIYDVLKMPIDEALVFFENY----PGIHRKLQLLVDVGLGYLELGAS
UVRA_RHIME      VTCDVCHGKRYNRETLDVHFKGKSIADVLDMTVEEGVEFFAA----VPAVRDKLVTLNQVGLGYIKIGQQ
UVRA_STRP6      VPCEVCHGRRYNSETLEVHYKEKNIAEVLDMTVDDALVFFSA----IPKIARKIQTIKDVGLGYVTLGQP
UVRA_RICTY      VKCDICNGHRYNRETLEIKYKGKSIADILMMTVEDAMQFFDK----IPLIYEKLITLNEVGLGYIKIGQS
UVRA_STRP8      VPCEVCHGRRYNSETLEVHYKEKNIAEVLDMTVDDALVFFSA----IPKIARKIQTIKDVGLGYVTLGQP
UVRA_STRP3      VPCEVCHGRRYNSETLEVHYKEKNIAEVLDMTVDDALVFFSA----IPKIARKIQTIKDVGLGYVTLGQP
UVRA_NEIMA      VPCEVCHGKRYNRETLEIQYKGKNISQVLDMTVEEACEFFDA----VPTVSRKLQTLMDVGLGYIRLGQS
UVRA_RICPR      VKCDICNGHRYNRETLEIKYKGKSIADILMMTVEDAMQFFDK----IPLIYEKLITLNEVGLGYIKIGQS
UVRA_LACPL      VPCEVCHGKQYNSETLEVEYKGKNIADVLQMTASEAVKFFEP----IPKIRRKLQTLVDVGLGYVKLGQP
UVRA_NEIMB      VPCEVCHGKRYNRETLEIQYKGKNISQVLDMTVEEAREFFDA----VPTVSRKLQTLMDVGLGYIRLGQS
UVRA_LACLA      VPCEVCHGRRYNSETLEVHYKGKNISEVLDMRVSDGLEFFRH----IPKIERKLQTIVDVGLGYVTLGQS
UVRA_STAAW      VPCEVCDGKRYNRETLEVTYKGKNIADILEMTVEEATQFFEN----IPKIKRKLQTLVDVGLGYVTLGQQ
UVRA_STAAS      VPCEVCDGKRYNRETLEVTYKGKNIADILEMTVEEATQFFEN----IPKIKRKLQTLVDVGLGYVTLGQQ
UVRA_STAAR      VPCEVCDGKRYNRETLEVTYKGKNIADILEMTVEEATQFFEN----IPKIKRKLQTLVDVGLGYVTLGQQ
UVRA_STAAC      VPCEVCDGKRYNRETLEVTYKGKNIADILEMTVEEATQFFEN----IPKIKRKLQTLVDVGLGYVTLGQQ
UVRA_NEIGO      VPCEVCHGKRYNRETLEIQYKGKNISQVLDMTVEEAREFFDA----VPTVSRKLQTLMDVGLGYIRLGQS
UVRA_XYLFA      VPCDVCHGKRYNRETLEIRYKGYNINDVLEMTVEDALKLFEA----VPAIARKLETLVDVGLSYLKLGQS
UVRA_RHILO      VTCDVCHGKRYNRETLDVLFKGKSIADVLDMTVEEGVDFFAA----VPGVRDKLDTLKQVGLGYIHIGQQ
UVRA_XYLFT      VPCDICHGKRYNRETLEIRYKGYNINDVLEMTVEDALKLFEA----VPAIARKLETLVDVGLSYLKLGQS
UVRA_STRMU      VPCEVCHGTRYNSETLEVHYKDKNIAEILNMTVNDAAEFFAP----IPKIARKIRTIKDVGLGYVTLGQP
UVRA_MYCTU      VPCEVCQGARYNRETLEVHYKGKTVSEVLDMSIXXXXXXXXP----IAGVHRYLRTLVDVGLGYVRLGQP
UVRA_MYCBO      VPCEVCQGARYNRETLEVHYKGKTVSEVLDMSIXXXXXXXXP----IAGVHRYLRTLVDVGLGYVRLGQP
UVRA_LISMO      VPCEVCHGKRYNGETLDIRYKGKNIAEVLEMTVEEGLEYFTNQ----PRIARKLQTIVDVGLGYIRLGQP
UVRA_LISMF      VPCEVCHGKRYNGETLDIRYKGKNIAEVLEMTVEEGLEYFTNQ----PRIARKLQTIVDVGLGYIRLGQP
UVRA_LISIN      VPCEVCHGKRYNGETLDIRYKGKNIAEVLEMTVEEGLEYFTNQ----PRIARKLQTIVDVGLGYIRLGQP
UVRA_HAEIN      VPCDQCKGKRYNRETLEIRYKGKTIHQVLDMTVEEAREFFDA----IPMIARKLQTLMDVGLSYIRLGQS
UVRA_VIBPA      VPCDVCKGKRYNRETLEVRYKGKTIDEVLEMTV----EDARTFFDPVPAIARKLQTLMDVGLSYIRLGQA
UVRA_STAAN      VPCEVCDGKRYNRETLEVTYKGKNIADILEMTVEEATQFFEN----IPKIKRKLQTLVDVGLGYVTLGQQ
UVRA_STAAM      VPCEVCDGKRYNRETLEVTYKGKNIADILEMTVEEATQFFEN----IPKIKRKLQTLVDVGLGYVTLGQQ
UVRA_CLOTE      VPCEICKGKRYNRETLEVKYKNKNISEILDMTVEESVDFFKN----IPKIKNKLQTLMDVGLGYVRLGQP
UVRA_BORBU      VPCDLCKGKKFNEETLEVRYKGKNIHDVLEMSVFEASKFFEN----VPKISHYLKFLIEVGLEYIKLGQS
UVRA_HAEDU      VPCDHCKGKRYNRETLEVRYKGKTIHQVLEMTVEEAREFFDA----IPAIARKLQTLIDVGLSYIRLGQS
UVRA_STRCO      VPCEVCHGARYNRETLEVHYKGKSIADVLNMPIEEATDFFEA----VPAISRHMKTLKDVGLGYVRLGQS
UVRA_SALTY      VPCDQCKGKRYNRETLEIKYKGKTIHEVLDMTIEEAREFFDA----VPALARKLQTLMDVGLTYIRLGQS
UVRA_SALTI      VPCDQCKGKRYNRETLEIKYKGKTIHEVLDMTIEEAREFFDA----VPALARKLQTLMDVGLTYIRLGQS
UVRA_AGRT5      VTCDVCHGKRYNRETLDVTFKGKSIADVLDMTV----EEGVEFFAAVPAVRDKLQSLFDVGLGYIKVGQQ
UVRA_MYCPE      VKCESCNGKKYNQETLQVLYKGKSIYDVLEMSVVEARDFFYE----IPEIKRKLDLMVEVGIDYLKLGTS
UVRA_MYCPN      VTCEMCDGKKYNPQTLEVKYLGKSIFDVLQMSCQEAYDFFKA----IPNIARKLKLLCDVGLEYLQLGLN
UVRA_MICLU      VPCEVCHGARYNRETLEVTYKGKNIAEVLDMPIEEAADFFSAYTRI----SRYLDTLVDVGLGYVRLGQP
UVRA_STRAW      VPCEVCHGARYNRETLEVHYKGKSIADVLNMPIEEAMHFFEA----VPAIARHLNTLNDVGLGYVRLGQS
UVRA_TREPA      ITCDVCHGTRFNRETLAVFYKGKNISHVLDMTIEEARSFFSA----VPPIVRKLEALCSVGLGYVRLGQS
UVRA_DEIRA      VPCEVCHGARYNRETLEVKYNHKTIADVLDLTVEDAHEFFEA----IPTIERKMQLLLDVGLGYMKIGQP
UVRA_VIBVY      VPCDVCKGKRYNRETLEVHYKGKSIDEVLEMTVEDAHEFFAP----VPVIARKLQTLMDVGLSYIRLGQA
UVRA_VIBVU      VPCDVCKGKRYNRETLEVHYKGKSIDEVLEMTVEDAHEFFAP----VPVIARKLQTLMDVGLSYIRLGQA
UVRA_BRUSU      VTCDVCHGKRYNRETLDVLFKGKSIADVLDMTV----EEGAEFFSAVPAVRDKLETLVKVGLGYIKVGQQ
UVRA_BRUME      VTCDVCHGKRYNRETLDVLFKGKSIADVLDMTV----EEGAEFFSAVPAVRDKLETLVKVGLGYIKVGQQ
UVRA_BRUAB      VTCDVCHGKRYNRETLDVLFKGKSIADVLDMTV----EEGAEFFSAVPAVRDKLETLVKVGLGYIKVGQQ
UVRA_BRUA2      VTCDVCHGKRYNRETLDVLFKGKSIADVLDMTV----EEGAEFFSAVPAVRDKLETLVKVGLGYIKVGQQ
UVRA_BRAJA      VTCDVCKGKRYNRETLEVLFKGKSIADVLDMTV----EEAADFFKAVPRVRETFQTLHRVGLDYIHVGQQ
UVRA_ECOL6      VPCDQCKGKRYNRETLEIKYKGKTIHEVLDMTI----EEAREFFDAVPALARKLQTLMDVGLTYIRLGQS
UVRA_SHIFL      VPCDQCKGKRYNRETLEIKYKGKTIHEVLDMTI----EEAREFFDAVPALARKLQTLMDVGLTYIRLGQS
UVRA_ECOLI      VPCDQCKGKRYNRETLEIKYKGKTIHEVLDMTI----EEAREFFDAVPALARKLQTLMDVGLTYIRLGQS
UVRA_ECO57      VPCDQCKGKRYNRETLEIKYKGKTIHEVLDMTI----EEAREFFDAVPALARKLQTLMDVGLTYIRLGQS
UVRA_PASMU      VPCEQCKGKRYNRETLEIRYKGKTIHQVLEMTV----EEAREFFDAIPQIARKLQTLMDVGLSYIRLGQS
UVRA_STRR6      VACEVCHGTRYNSETLEVHYKEKNISQVLDMTVNDAVEFFQH----IPKIQRKLQTIKDVGLGYVTLGQP
UVRA_STRPN      VACEVCHGTRYNSETLEVHYKEKNISQVLDMTVNDAVEFFQH----IPKIQRKLQTIKDVGLGYVTLGQP
UVRA_STAEQ      VPCEVCDGKRYNRETLEVTYKGKNIADVLEMTV----EEATHFFENIPKIKRKLQTLVDVGLGYITLGQQ
UVRA_MYCGE      VKCEVCNGKKYNSQTLEIKYLGKSIFDVLQMSCKEAYEFFKA----IPNISRKLRLLCDVGLEYLQLGIN
UVRA_YERPE      VPCDHCKGKRYNRETLEVKYKGKSIHEVLAMTIEEAREFFDA----VPALARKLQTLIDVGLSYICLGQS
UVRA_VIBCH      VPCDVCKGKRYNRETLEVRYKGKTIDEVLDMTV----EDAREFFDPVPVIARKLQTLMDVGLSYIRLGQS
UVRA_HELPY      VQCDSCKGAKYNPQTLEIKVKGKSIADVLNMSVEEAYEFFAK----FPKIAVKLKTLMDVGLGYITLGQN
UVRA_HELPJ      VQCDSCKGAKYNPQTLEIKVKGKSIADVLNMSVEEAYEFFAK----FPKIAVKLKTLIDVGLGYITLGQN
UVRA_ZYMMO      VTCDVCHGARYNRETQEVKFKGQSIADVLNMTVDQAAEFFEA----VPSIRDKMAMLARVGLGYIKVGQQ
UVRA_MYCPU      ITCDHCDGKRYNEETLQIKYRSKSISDVLDMTVSDALAFFENRLIVKNK----LQTLEDVGLGYIKLGQS
UVRA_VITST      VPCEVCHGKRYNRETLEILYKGKNIHQVLEMTV----AEAHAFFEAVPTLSRKLQTLMDVGLSYVRLGQS
UVRA_CHLMU      ITCPSCSGKRFLPQVLEIRYKNKTIADILEMTAYEAESFFLDQ----PSIHNKIQALCTLGLQYLPLGRP
UVRA_STAES      VPCEVCDGKRYNRETLEVTYKGKNIADVLEMTV----EEATHFFENIPKIKRKLQTLVDVGLGYIXXXXX
UVRA_CHLTR      ITCPSCLGKRFLPQVLEVRYKNKTIADILEMTAYEAKNFFLDE----PSIHQKIETLCTLGLQYLPLGRP
UVRA_CHLPN      RPCPTCSGFRIQPLAQEVLYEGKHFGELLHTPIETVALRFPFIKKIQKPLKALL----DIGLGYLPIGQK
UVRA_PSELE      APCPVCKGTRFNAKTLE-----------------------------------------------------
MSBA_POLSJ      ------------------------------------------------------------------LGHN
RBSA3_RHIME     -----------------------------------------------------------------SIDAP
CYDD_BACSU      ----------------------------------------------------------------------
Y035_METJA      ----------------------------------------------------------------------
MSBA_COXBU      ------------------------------------------------------------------IGEN
MSBA_BORPE      ------------------------------------------------------------------VGQN
MSBA_BORPA      ------------------------------------------------------------------VGQN
MSBA_BORBR      ------------------------------------------------------------------VGQN
MACB_ALCBS      --------------------------------------------------------LTDLGLEDRLENRP
ABCB8_DANRE     -------------------------------------------------AHNFITGFAD---GYNTVGER
NDVA_RHOP2      ------------------------------------------------------------GLGFTAAGER
PHNC_THIDA      ----------------------------------------------------------------------
MSBA_RALEJ      -----------------------------------------------------------------NIGDN
MACB2_AERHH     -------------------------------------------------SQALLTRL---GLSDRSHHTP
MSBA_RALME      -----------------------------------------------------------------NIGDN
MSBA_AZOSE      ------------------------------------------------------------------IGEN
MACB_RHORT      ----------------------------------------------LERAHALLDRL---GMGARS-GHF
CBIO2_LEUMM     ----------------------------------------------------------------------
MACB2_YERPN     -------------------------------------------------ANMLLTRL---GLGDRVSYQP
MACB1_YERPS     -------------------------------------------------ANMLLTRL---GLGDRVSYQP
MACB1_YERPE     -------------------------------------------------ANMLLTRL---GLGDRVSYQP
MACB1_YERPA     -------------------------------------------------ANMLLTRL---GLGDRVSYQP
ABCB8_XENTR     ------------------------------------------------------------------LGER
Y373_PYRAB      ----------------------------------------------------------------------
Y043_BIFLO      ----------------------------------------------------IVDSLQAVGLANLRQSDP
UVRA_PARDE      ----------------------------------------------------------------------
MSBA_PSEPK      ------------------------------------------------------------------VGEN
AB2B_ARATH      ----------------------------------------------LANAHSFITSLPE---GYSTVGER
ZNUC_ROSDO      --------------------------------------------------------LAQAGVRDLS-GSQ
ZNUC_HALHL      --------------------------------------------------------VADTGVEEL-LDQP
Y2240_PHOPR     ----------------------------------------------------------------------
Y222_THEMA      ----------------------------------------------------------------------
MSBA_SYNAS      -------------------------------------------------AHDFIVNLPE---GYDTIGEL
MSBA_DECAR      ------------------------------------------------------------------IGEN
YKOD_BACSU      ------------------------------------------------------------GLAHLADHHP
Y2324_STRCO     ---------------------------------------------------------------------P
MSBA_RHOFD      ------------------------------------------------------------------IGEN
MSBA_PSYA2      --------------------------------------------------------------GYQSIGAE
MSBA_METCA      ------------------------------------------------------------------VGQQ
MSBA_BURS3      ----------------------------------------------------------------------
MSBA_BURCA      ----------------------------------------------------------------------
MSBA_BORA1      ------------------------------------------------------------------VGEN
MACB_PSE14      ----------------------------------------------------------------------
CYAB_BORPE      ------------------TLFNRSVRDNIALTRPGASMHEVVAAARLAGAHEFICQLPE---GYTMLGEN
RTX1B_ACTPL     ----------------------------------------------LAGAHEFISELRE---GYNTIGEQ
NDVA_RHOPS      ----------------------------------------------------------------------
MSBA_PSESM      ------------------------------------------------------------------VGEN
MSBA_PSEF5      ------------------------------------------------------------------VGEN
MSBA_NITOC      ------------------------------------------------AAHAMINRLPD-GLDTV-IGEK
HMUV_RHOPA      --------------------------------------------------------LRDVGLDHFR-HRD
Y1051_HAEIN     ------------------------------------------------------------------VGER
NDVA_RHOPB      ----------------------------------------------------------------------
MSBA_PSE14      ------------------------------------------------------------------VGEN
MACB1_PSESM     ----------------------------------------------------------------------
MACB1_PSEE4     -------------------------------------------------ARELLTRLGLAG----HLANR
CBIO_METAC      --------------------------------------------------------LAEIGLGKYRYRSP
CBIO1_LACS1     ----------------------------------------------------------------------
ABCB8_RAT       -------------------------------------------------AHEFISSFPD---GYSTVGER
ABCB8_PONAB     -------------------------------------------------AHEFITSFPE---GYNTIGER
ABCB8_HUMAN     -------------------------------------------------AHEFITSFPE---GYNTVGER
Y2003_STAA8     ------------------------------------------------------------------VGER
Y1956_STAAR     ------------------------------------------------------------------VGER
Y1924_STAAC     ------------------------------------------------------------------VGER
Y1866_STAAM     ------------------------------------------------------------------VGER
Y1847_STAA3     ------------------------------------------------------------------VGER
Y1806_STAAW     ------------------------------------------------------------------VGER
Y1799_STAAB     ------------------------------------------------------------------VGER
Y1788_STAAS     ------------------------------------------------------------------VGER
Y1683_STAAN     ------------------------------------------------------------------VGER
MSBA_RALSO      -----------------------------------------------------------------NIGDN
MSBA_PSEU2      ------------------------------------------------------------------VGEN
MSBA_CHRSD      -------------------------------------------------AHEFIERLPN---GYDTVGDN
MSBA_ALHEH      ------------------------------------------------------------------IGEN
MACB_SHESA      ----------------------------------------------------------------------
MACB_RHIME      ---------------------------------------------------------AEALLQSLKLGER
MACB_NEIMA      --------------------------------------------------------LQDLGLASKEGNKP
MACB_AGRT5      -------------------------------------------------AISLLTRL---GLAERTGNIP
HMT1_SCHPO      --------------------------------------------------------------GYNSVGER
CBIO1_SYMTH     ----------------------------------------------------VMTALERVGLDPAMKDRS
ABCB8_MOUSE     -------------------------------------------------AHEFISSFPD---GYSTVGER
Y282_TREDE      -----------------------------------------------PAIDEVLTELS---LNRLKERHP
MSBA_VIBF1      ------------------------------------------------------------------IGEN
MACB_SALTY      ---------------------------------------------------------------------P
MACB_SALTI      ---------------------------------------------------------------------P
MACB_SALPA      ---------------------------------------------------------------------P
MACB_SALCH      ---------------------------------------------------------------------P
MACB_RHOPB      ----------------------------------------------------------------------
MACB_NEIGO      --------------------------------------------------------LQDLGLASKEGNKP
MACB_NEIG1      --------------------------------------------------------LQDLGLASKEGNKP
MACB_ERWCT      ----------------------------------------------------------------------
MACB_CAMFF      ----------------------------------------------------------------------
MACB_ACIAD      --------------------------------------------------------LTELGLGSKTENRP
MACB2_PSEU2     ----------------------------------------------------------------------
MACB2_PSESM     -------------------------------------------------AQALLTRL---GLGGHLQHRP
MACB1_PSEPF     ----------------------------------------------------------------------
HLYB_PROVU      ----------------------------------------------LAGAHDFISELRE---GYNTIGEQ
HISP_SALTY      ------------------------------------------------ARERALKYLAKVGIDERAQGKY
HISP_ECOLI      --------------------------------------------------------LAKVGIDERAQGKY
CBIO1_LACSS     -----------------------------------------------------------VGLPEAVLEQS
ZNUC_YERPS      ----------------------------------------------------ILPALTRVQAAHL-LDQP
Y1383_MYCBO     --------------------------------------------------HDRVLRLPD---GYDTVLGA
Y1348_MYCTU     --------------------------------------------------HDRVLRLPD---GYDTVLGA
RGMG1_RHIME     ---------------------------------------------------------AEMRLKASSVDAP
NODI_RALSO      ---------------------------------------------------------------------P
NDVA_RHOP5      ----------------------------------------------------------------------
NDVA_BRAJA      ----------------------------------------------------------------------
MSBA_THIDA      ------------------------------------------------AAHAFIQAMPD-GLDTL-IGEN
MSBA_PSEPF      ------------------------------------------------------------------VGEN
MACB_NITEU      -----------------------------------------------------MQRAADL-LGRLGLSDK
MACB1_PSEU2     ----------------------------------------------------------------------
L259_DROME      ------------------------------------------------------------------VGER
DRRA_STRPE      ----------------------------------------------------------------------
CBIO1_STRMU     ----------------------------------------------------------------------
ZNUC_YERPN      ----------------------------------------------------ILPALTRVQAAHL-LDQP
ZNUC_YERPE      ----------------------------------------------------ILPALTRVQAAHL-LDQP
ZNUC_YERPA      ----------------------------------------------------ILPALTRVQAAHL-LDQP
Y3946_ANASP     -----------------------------------------------------LTELAERPVHHLSLGQ-
MSBA_PSEAE      ------------------------------------------------------------------VGEN
MACB_RHOP2      ----------------------------------------------------------------------
MACB_NEIMB      --------------------------------------------------------LQDLGLASKEGNKP
MACB_CHLCH      -----------------------------------------------------IRRLEMVGLAHRLHHTP
MACB_BRUA2      ----------------------------------------------------------------------
MACB_AZOSE      --------------------------------------------------------LASLGLGERIEHRP
MACB_AZOSB      --------------------------------------------------------LASLGLGERSHHRP
MACB2_PSEF5     ----------------------------------------------------------------------
MACB2_PSEE4     ----------------------------------------------------------------------
LOLD_PSESM      ----------------------------------------------IPEARQRATALLEVGLGHRLAHKP
HMUV_PSEPF      --------------------------------------------------------------GHLS-GRS
NODI_RHIEC      ---------------------------------------------------AVMSSLLEFARLESKVNAR
MSBA_THICR      ------------------------------------------------AAHAFIEKLPE-GLNTI-IGDN
MSBA_BURTA      ----------------------------------------------------------------------
MSBA_BURPS      ----------------------------------------------------------------------
MSBA_BURP1      ----------------------------------------------------------------------
MSBA_BURMA      ----------------------------------------------------------------------
MNTB_BACSU      ----------------------------------------------------------------------
MDR_ORYSJ       -------------------------------------------------AHDFISNLKD---GYDTCGER
MACB_SHISS      ----------------------------------------------------------------------
MACB_SHIFL      ----------------------------------------------------------------------
MACB_SHIDS      ----------------------------------------------------------------------
MACB_SHEON      ----------------------------------------------------------------------
MACB_PSEAB      ----------------------------------------------------------------------
MACB_HAHCH      -------------------------------------------------AHMLLSRL---GLEERCEHKP
MACB_ECOUT      ----------------------------------------------------------------------
MACB_ECOLI      ----------------------------------------------------------------------
MACB_ECOL5      ----------------------------------------------------------------------
MACB_ECO57      ----------------------------------------------------------------------
MACB_BRUME      ----------------------------------------------------------------------
MACB_BARHE      ----------------------------------------------------------------------
MACB3_PARDP     ----------------------------------------------------------------------
MACB1_ECOK1     ----------------------------------------------------------------------
LKTB_PASSP      --------------------------------------------------------ISDVREGYNTIGEQ
ABCE1_MOUSE     ------------------------------------------------------------------IDQE
ABCE1_HUMAN     ------------------------------------------------------------------IDQE
Y2387_METMA     ----------------------------------------------------------------------
Y1418_METAC     ----------------------------------------------------------------------
PAXB_PASAE      ----------------------------------------------LAGAHDFISELRE---GYNTMGEQ
NODI_RHIGA      ----------------------------------------------------------------------
NODI_BURS3      ------------------------------------------------AAHALVKPLLEFAKLENKADAK
MSBA_HAHCH      ------------------------------------------------------------------LGEN
MSBA_BURXL      ----------------------------------------------------------------------
MACB_PSEPK      ----------------------------------------------------------------------
MACB_PSEAE      ----------------------------------------------------------------------
MACB_CHRVO      ----------------------------------------------------------------------
MACB_BURTA      -------------------------------------------------------------------GHR
MACB_BURPS      ----------------------------------------------------------------------
MACB_BURP1      ----------------------------------------------------------------------
LKTB_PASTR      ----------------------------------------------LAGAHDFISELRE---GYNTIGEQ
LKTB_MANGL      ----------------------------------------------LAGAHDFISELRE---GYNTIGEQ
LKTB7_PASHA     ----------------------------------------------LAGAHDFISELRE---GYNTIGEQ
LKB2B_PASHA     ----------------------------------------------LAGAHDFISELRE---GYNTIGEQ
LKB2A_PASHA     ----------------------------------------------LAGAHDFISELRE---GYNTIGEQ
LKB1B_PASHA     ----------------------------------------------LAGAHDFISELRE---GYNTIGEQ
LKB1A_PASHA     ----------------------------------------------LAGAHDFISELRE---GYNTIGEQ
LKB16_PASHA     ----------------------------------------------LAGAHDFISELRE---GYNTIGEQ
LKB14_PASHA     ----------------------------------------------LAGAHDFISELRE---GYNTIGEQ
LKB13_PASHA     ----------------------------------------------LAGAHDFISELRE---GYNTIGEQ
CBIO3_OENOB     ----------------------------------------------------------------------
AB17B_ARATH     -------------------------------------------------AHDFITSLSN---GYTNCGDK
AB16B_ARATH     -------------------------------------------------AHEFITSLSD---GYDTYGDR
AB10B_ARATH     ------------------------------------------------------------------VGER
ZNUC_YERE8      ----------------------------------------------------ILPALKRVHAAHL-LDQP
Y5847_STRAW     ----------------------------------------------LGIAPDVMRRRVEETLDLLGLAEP
Y3016_METMA     ----------------------------------------------------------------------
Y1815_PYRHO     ----------------------------------------------------------------------
Y133_METTH      -------------------------------------------------------------LGYES--KP
NDVA_NITHX      ----------------------------------------------------------------------
MSBA_LEGPH      ------------------------------------------------------------------VGEN
MSBA_LEGPA      ------------------------------------------------------------------VGEN
MSBA_FRANO      ---------------------------------------------------------------HTNIGNN
MDR2_CRIGR      ------------------------------------------------------------------VGER
MDR1_RAT        ------------------------------------------------------------------VGER
MDR1_MOUSE      ------------------------------------------------------------------VGDK
MDR1_CRIGR      ------------------------------------------------------------------VGER
MACB_SHIBS      ----------------------------------------------------------------------
MACB_PASMU      ----------------------------------------------------------------------
MACB_BURS3      ----------------------------------------------------------------------
MACB2_YERPS     ----------------------------------------------------------------------
MACB2_YERPE     ----------------------------------------------------------------------
MACB2_YERPA     ----------------------------------------------------------------------
MACB1_YERPN     ----------------------------------------------------------------------
CBIO_METMJ      ----------------------------------------------------------------------
CBIO2_METHJ     ---------------------------------------------------AVSNALHSVGLEGFEKRPP
ZNUC_BRUAB      --------------------------------------------------------LEAVGIAHLAKAET
ZNUC_BRUA2      --------------------------------------------------------LEAVGIAHLAKAET
YXEO_BACSU      --------------------------------------------------------LKQVGLEHKADSYP
Y1747_METAC     -----------------------------------------------------IKKLADSALEMMELSAY
Y068_PYRFU      ----------------------------------------------------------------------
XYLG_PSEPF      ---------------------------------------------------------------------P
RBSA_MESSB      -------------------------------------------------------KIAALKVKSAGIDAP
POTA_FUSNN      ----------------------------------------------------------------------
PHNC1_PSEAB     -----------------------------------------------------LEALARVGLADFA-GQR
NODI_RHISN      ---------------------------------------------------------------------P
MSBA_VIBPA      ------------------------------------------------------------------IGEN
MSBA_VIBCH      ------------------------------------------------------------------IGEN
MSBA_PSYCK      --------------------------------------------------------------GYQSIGAE
MSBA_LEGPL      ------------------------------------------------------------------VGEN
MDR65_DROME     -------------------------------------------------AHEFITNLPE---SYRSMGER
MDR3_MOUSE      ------------------------------------------------------------------VGER
MDR3_HUMAN      ------------------------------------------------------------------VGER
MDR3_CRIGR      ------------------------------------------------------------------VGER
MDR2_RAT        ----------------------------------------------------------------------
MACB_PSYA2      --------------------------------------------------------LSDLGLADKVNNRP
MACB_PHOLL      ----------------------------------------------------------------------
MACB_BURCH      ----------------------------------------------------------------------
MACB_BURCA      ----------------------------------------------------------------------
MACB_BARQU      ----------------------------------------------------------------------
MACB_ACTAC      --------------------------------------------------------LEKLGLGDKWQNKP
HLYB_ECOL6      ----------------------------------------------LAGAHDFISELRE---GYNTIGEQ
HLYBP_ECOLX     ----------------------------------------------LAGAHDFISELRE---GYNTIGEQ
HLYBC_ECOLX     ----------------------------------------------LAGAHDFISELRE---GYNTIGEQ
HLYB3_ECOLX     ----------------------------------------------LAGAHDFISELRE---GYNTIGEQ
FECE_ECOLI      ----------------------------------------------------------------------
NDVA_BARHE      -------------------LFNRTIHDNISIGRTTATNEELYEAAKIAAAHDFILKKTD--RYNTMIGEQ
MSBA_VIBVY      ------------------------------------------------------------------VGEN
MSBA_NEIG1      ----------------------------------------------------------------LGLHQP
MRP9_HUMAN      ------------------------------------------------------------------IGER
MDR2_MOUSE      ------------------------------------------------------------------VGDK
MDR1_HUMAN      ------------------------------------------------------------------VGDK
MACB_PSYCK      --------------------------------------------------------LSDLGLADKVNNRP
MACB_HAEDU      ----------------------------------------------------------------------
MACB1_PSEF5     ------------------------------------------------------------------LGHR
LOLD_BURTA      ------------------------------------------------ARHHAREMLEQVGLGARAKHRP
FHUC_ECOLI      ----------------------------------------------------------------------
ABCC8_HUMAN     ------------------------------------------------------------------IGER
ABCC8_CRICR     ------------------------------------------------------------------IGER
ABCBA_MOUSE     ------------------------------------------------------------------VGEK
ABCBA_HUMAN     ------------------------------------------------------------------VGEK
AB1E_ARATH      ------------------------------------------------------------------MDQV
AB19B_ARATH     --------------------------------------------------HSFITLLPK---GYTQVGER
ZNUC_SILST      --------------------------------------------------------LAEAGVPGLRKRQ-
WHITE_DROME     ----------------------------------------------------------------------
PHNC2_PSEAE     -----------------------------------------------------LEALARVGLADFA-GQR
NODI_BURXL      ----------------------------------------------------------------------
MACB_SODGM      ----------------------------------------------------------------------
MACB_PELLD      --------------------------------------------------HEALESLKKVGLMH-RLDHT
MACB_BORA1      ----------------------------------------------------------------------
MACB1_PARDP     ----------------------------------------------------------------------
HLYB_ECO57      ----------------------------------------------LAGAHDFIRELKE---GYNTIGEQ
FHUC_BACSU      --------------------------------------------------------------------RP
CCMA_ALCBS      -----------------------------------------------------MAALAAVGLGFEEV--P
CBIO_THEMA      -----------------------------------------------------------VGLSGLEKEDP
CBIO2_SPIKU     -----------------------------------------------------------VGLPLNYLERS
ABCB5_HUMAN     ----------------------------------------------------------------------
AB16G_ARATH     ----------------------------------------------------------------------
ZNUC_SHISS      -----------------------------------------------PGTHKILPALKRVQAGHL-INAP
ZNUC_SHIDS      -----------------------------------------------PGTHKILPALKRVQAGHL-INAP
ZNUC_SHIBS      -----------------------------------------------PGTHKILPALKRVQAGHL-INAP
ZNUC_ECOUT      -----------------------------------------------PGTHKILPALKRVQAGHL-INAP
ZNUC_ECOLI      -----------------------------------------------PGTHKILPALKRVQAGHL-INAP
ZNUC_ECOL6      -----------------------------------------------PGTHKILPALKRVQAGHL-INAP
ZNUC_ECOL5      -----------------------------------------------PGTHKILPALKRVQAGHL-INAP
ZNUC_ECOK1      -----------------------------------------------PGTHKILPALKRVQAGHL-INAP
ZNUC_ECO57      -----------------------------------------------PGTHKILPALKRVQAGHL-INAP
Y483_STRPN      ----------------------------------------------------------------------
Y430_STRR6      ----------------------------------------------------------------------
WHITE_LUCCU     ----------------------------------------------------------------------
RTX3B_ACTPL     ----------------------------------------------LAGAHDFISELRE---GYNTIGEL
NODI_RALEJ      ----------------------------------------------------------------------
NDVA_NITWN      ----------------------------------------------------------------------
NDVA_BARQU      ------------------------------------------------------------------VGER
MSBA_VIBVU      ------------------------------------------------------------------VGEN
MSBA_ACIAD      ------------------------------------------------------------------LGAQ
MSBA2_COLP3     ------------------------------------------------------------------IGEN
METN_LEIXX      --------------------------------------------------------LAFVGLTEKAWAYP
MDR1_LEIEN      ----------------------------------------------------------------------
HISP_PSEAE      --------------------------------------------------------LAKVGLAEKVERQY
CBIO2_OCEIH     ----------------------------------------------------IASILPSVGLSDSVLERS
CBIO2_LACPL     --------------------------------------------------------LALVGLDESLLTRS
ABCC8_RAT       ------------------------------------------------------------------IGER
AB3B_ARATH      ------------------------------------------------------------------VGEH
AB14B_ARATH     --------------------------------------------------------------GYMTVGDK
ZNUC_PSEPK      ---------------------------------------------------AALSALQEVGAEQV-IDSP
YHEH_BACSU      ----------------------------------------------------------------------
YCOBA_PROFR     ----------------------------------------------------------------------
Y3364_BACAN     -------------------------------------------------SHIIQKRIAELFLGFQDLHQS
Y3323_BACC1     -------------------------------------------------SHIIQKRIAELFLGFQDLHQS
Y3105_BACHK     -------------------------------------------------SHIIQKRIAELFLGFQDLHQS
WHITE_CERCA     ----------------------------------------------------------------------
RBSA_ERWCT      -----------------------------------------------------------------SMEQP
NDVA_RHOPA      ----------------------------------------------------------------------
NDVA_RHIRD      --------------------------------------------------------------GYLTVGER
NDVA_AGRT5      --------------------------------------------------------------GYLTVGER
MSBA_METFK      ------------------------------------------------------------------IGDR
MSBA_ALCBS      ------------------------------------------------------------------LGQD
MACB_WOLSU      ----------------------------------------------------------------------
MACB_ECOLX      ----------------------------------------------------------------------
MACB2_ECOK1     ----------------------------------------------------------------------
HMUV_PSEPK      ----------------------------------------------------------------------
CBIO_METTH      ----------------------------------------------------------------------
CBIO2_MYCS5     -----------------------------------------------------------VGLPEEYLKRS
CBIO1_STAAB     --------------------------------------------------------LMDLGFSRDVMSQS
ATM1_YARLI      -----------------------------------------------------------------NVGER
ATM1_CANGA      ------------------------------------------------------------------VGER
AB1B_ARATH      -------------------------------------------------AHSFIIKLPD---GFTQVGER
ZNUC_PARDP      -------------------------------------------------------------------GRQ
Y753_CLOTE      -----------------------------------------------------------LNISYLEDKNP
Y4347_VIBVY     ----------------------------------------------------------------------
Y132_PYRHO      ----------------------------------------------------------------------
XYLG_PSE14      ---------------------------------------------------------------------P
PHNC_AGRT5      -----------------------------------------------------IAALERLGIEHVAM-QA
NODI_BURPS      ----------------------------------------------------------------------
NODI_BURP1      ----------------------------------------------------------------------
NODI_BURMA      ----------------------------------------------------------------------
NODI_BURCA      ----------------------------------------------------------------------
NDVA_BARBK      ------------------------------------------------------------------VGER
NDVA_BARBA      ------------------------------------------------------------------VGER
MSBA_SHEDO      ------------------------------------------------------------------VGEN
MSBA_SACD2      -------------------------------------------------------------------GED
LOLD_PSEU2      ----------------------------------------------IPEARKRSTALLEVGLGHRLAHKP
LOLD_PSEF5      ----------------------------------------------IPEARQRATALLEVGLGHRLEHKP
LOLD_PSE14      ----------------------------------------------IPEARKRSTALLEVGLGHRLAHKP
LOLD_BURPS      --------------------------------------------------------LEQVGLGARAKHRP
LOLD_BURMA      --------------------------------------------------------LEQVGLGARAKHRP
HMUV_PSEF5      -------------------------------------------------------------------GRS
HMUV_PSEAE      -------------------------------------------------------------------GRS
HMUV_PSEAB      -------------------------------------------------------------------GRS
CBIO1_STRSV     ----------------------------------------------------------------------
CBIO1_MYCMS     ----------------------------------------------------------------------
ARAG_CHRSD      ---------------------------------------------------------------------P
ARAG2_BURTA     ---------------------------------------------------------------------P
ABCC9_RAT       ------------------------------------------------------------------IGER
ABCC9_MOUSE     ------------------------------------------------------------------IGER
ZNUC_BUCBP      ---------------------------------------------------------------------P
ZNUC_BRUSU      --------------------------------------------------------LEAVGIAHLAKAET
ZNUC_BRUME      --------------------------------------------------------LEAVGIAHLAKAET
Y130_PYRAB      --------------------------------------------------------LREVGLEGFEDRSP
XYLG_PSEU2      ---------------------------------------------------------------------P
RBSA2_STRCO     ----------------------------------------------LKGQHTAAERIAQLGVRMAGLGQH
NODI_RHIL3      ----------------------------------------------------------------------
NODI2_RHIME     ----------------------------------------------------------------------
MSBA_NEIMB      ----------------------------------------------------------------LGLHQP
MSBA_NEIMA      ----------------------------------------------------------------LGLHQP
MNTB_LISMO      ----------------------------------------------------------------------
MNTB_LISIN      ----------------------------------------------------------------------
MACB2_PSEPF     ----------------------------------------------------------------------
MACB1_AERHH     ----------------------------------------------------------------------
LPTB_SHIFL      -----------------------------------------------------------------SMGQ-
LPTB_ECOLI      -----------------------------------------------------------------SMGQ-
LPTB_ECOL6      -----------------------------------------------------------------SMGQ-
LPTB_ECO57      -----------------------------------------------------------------SMGQ-
CBIO2_THETN     ---------------------------------------------------------------------P
CBIO2_MESFL     ----------------------------------------------------------------------
ABCCC_DICDI     ----------------------------------------------------------------VEIGER
ABCCB_HUMAN     ------------------------------------------------------------------IGER
ZNUC_PHOLL      ----------------------------------------------------ILPALERVNAAHL-LQQP
Y2030_SULSO     ----------------------------------------------------------------------
Y1281_GEOSL     --------------------------------------------------------LEQVGVAHLH-NKP
Y020_ONYPE      ------------------------------------------------------------------VNRP
RLI1_YEAST      ------------------------------------------------------------------IDQE
PHNC2_HALMA     ----------------------------------------------------------------------
PHNC1_HALMA     -----------------------------------------------------LERLDAVGL----VGRP
NODI_RHILV      ----------------------------------------------------------------------
NODI_RALME      ----------------------------------------------------------------------
NODI_BURTA      ----------------------------------------------------------------------
MSBA_FRATT      -----------------------------------------------------------------NIGNN
MSBA_FRAT1      -----------------------------------------------------------------NIGNN
MDR1_CAEEL      --------------------------------------------------------------GYNTLGDR
MDL1_YEAST      ----------------------------------------------------------------------
LOLD_PSEPK      -------------------------------------------------AEALLKR---VGLGHRLNHKP
LOLD_DECAR      -----------------------------------------------------------VGLGHRLEHRP
LKTB_ACTAC      ----------------------------------------------LAGAHDFISELRE---GYNTVGEQ
CBIO2_MYCPU     ----------------------------------------------------------------------
ARAG_AZOBR      ---------------------------------------------------------------------P
ARAG2_BURS3     ---------------------------------------------------------------------P
ARAG2_BURCM     ---------------------------------------------------------------------P
AB5B_ARATH      ------------------------------------------------------------------VGEH
ZNUC_SHIFL      -----------------------------------------------PGTHKILPALKRVQAGHL-INAP
ZNUC_SHIF8      -----------------------------------------------PGTHKILPALKRVQAGHL-INAP
ZNUC_SALTY      ----------------------------------------------------ILPALKRVQAGHL-IDAP
ZNUC_SALTI      ----------------------------------------------------ILPALKRVQAGHL-IDAP
ZNUC_SALPA      ----------------------------------------------------ILPALKRVQAGHL-IDAP
ZNUC_SALCH      ----------------------------------------------------ILPALKRVQAGHL-IDAP
NDVA_RHIL3      ------------------------------------------------------------------VGER
MSBA_SHEFN      ------------------------------------------------------------------VGEN
MSBA_CHRVO      ------------------------------------------------------------------IGEN
MACB_CHLPD      ----------------------------------------------------------------------
MACB_CAMJR      ----------------------------------------------------------------------
MACB_CAMJE      ----------------------------------------------------------------------
HMUV_PSEE4      ----------------------------------------------------------------------
FEPC_ECOLI      ---------------------------------------------------AVTKAMQATGITHLA-DQS
CBIO2_STRPM     ----------------------------------------------------------------------
CBIO2_STRPF     ----------------------------------------------------------------------
CBIO2_STRPD     ----------------------------------------------------------------------
CBIO2_STRPC     ----------------------------------------------------------------------
CBIO2_STRPB     ----------------------------------------------------------------------
CBIO2_LACSS     -----------------------------------------------------------VGMTQFMTREP
CBIO2_LACLS     ----------------------------------------------------------------------
CBIO1_STRPG     ----------------------------------------------------------------------
CBIO1_STRP8     ----------------------------------------------------------------------
CBIO1_STRP6     ----------------------------------------------------------------------
CBIO1_STRP3     ----------------------------------------------------------------------
CBIO1_STRP1     ----------------------------------------------------------------------
CBIO1_STAAW     --------------------------------------------------------LMDLGFSRDVMSQS
CBIO1_STAAS     --------------------------------------------------------LMDLGFSRDVMSQS
CBIO1_STAAR     --------------------------------------------------------LMDLGFSRDVMSQS
CBIO1_STAAN     --------------------------------------------------------LMDLGFSRDVMSQS
CBIO1_STAAM     --------------------------------------------------------LMDLGFSRDVMSQS
CBIO1_STAAC     --------------------------------------------------------LMDLGFSRDVMSQS
CBIO1_STAA8     --------------------------------------------------------LMDLGFSRDVMSQS
CBIO1_STAA3     --------------------------------------------------------LMDLGFSRDVMSQS
CBIO1_MYCCT     ----------------------------------------------------------------------
CBIO1_BACLD     ----------------------------------------------------------------------
ARAG2_BURCH     ---------------------------------------------------------------------P
ARAG2_BURCA     ---------------------------------------------------------------------P
ABCG5_MOUSE     -----------------------------------------------------LSHVADQMIGSYNFGG-
ABCCA_DICDI     ----------------------------------------------------------------VEIGER
ABCC9_HUMAN     ------------------------------------------------------------------IGER
ABCB9_HUMAN     -------------------------------------------------AHGFIMELQD---GYSTTGEK
AB4C_ARATH      ------------------------------------------------------------------IGER
AB21B_ARATH     ------------------------------------------------------------------VGEH
ZNUC_RHIEC      --------------------------------------------------------LEAAGIAHM-IGAE
YCLP_BACSU      ----------------------------------------------------------------------
Y1704_LACJO     ---------------------------------------------------------------------P
Y1384_MYCBO     ------------------------------------------------------------------VGEA
Y1349_MYCTU     ------------------------------------------------------------------VGEA
XYLG_PSESM      ---------------------------------------------------------------------P
RGMG_RHOFD      -----------------------------------------------PAIHHISQQMVGLRIKTPSLTQT
RBSA1_RHIME     -----------------------------------------------------------------ALDQD
PHNC_RHIEC      --------------------------------------------------HAIAA-LERLGIEQTAL-QP
PHNC1_NATPD     ---------------------------------------------------AAIARLHDVGLGGYA-DRR
MRP5_RAT        ------------------------------------------------------------------IGER
MRP5_MOUSE      ------------------------------------------------------------------IGER
MRP5_HUMAN      ------------------------------------------------------------------IGER
MDR49_DROME     --------------------------------------------------HDFITRLPK---GYTQVGEK
MACB_VIBPA      --------------------------------------------------HRQRTERAQSLLARLGLEDR
HMUV_PASPI      --------------------------------------------------------MVKVGVDHLA-NRL
HMUV_LISDA      --------------------------------------------------------MVKVGVDHLA-NRL
CBIO2_MYCPN     --------------------------------------------------------LEKMGLKYTFLERN
CBIO1_STRTD     ------------------------------------------------AEQRALESLRLVGLSDELRDQN
CBIO1_STRT2     ------------------------------------------------AEQRALESLRLVGLSDELRDQN
CBIO1_STRT1     ------------------------------------------------AEQRALESLRLVGLSDELRDQN
CBIO1_STRR6     -------------------------------------------------------KLALVGIDESLFDRS
CBIO1_STRPN     -------------------------------------------------------KLALVGIDESLFDRS
CBIO1_STRP2     -------------------------------------------------------KLALVGIDESLFDRS
CBIO1_MYCGA     ----------------------------------------------------------------------
CBIO1_CLONN     ----------------------------------------------------------------------
ABCG5_RAT       -----------------------------------------------------LSHVADQMIGNYNFGG-
AB4B_ARATH      ------------------------------------------------------------------VGEH
ZNUC_RHIL3      ----------------------------------------------------MLSALESAGIAHM-LDAE
ZNUC_PSEAE      -----------------------------------------------------LAALREVGAAHV-LERP
ZNUC_PSEAB      -----------------------------------------------------LAALREVGAAHV-LERP
ZNUC_JANSC      ------------------------------------------------------------------LKRQ
Y2655_BACCR     ---------------------------------------------------------------------P
TAP1_GORGO      -------------------------------------------------AHSFISGLPQ---GYTEVGEA
RAD50_SULTO     ---------------------------------------------------------------YTTSGQP
PHNC2_ROSDO     ----------------------------------------------------------------------
NODI_RHIS3      ----------------------------------------------------------------------
NDVA_AGRVI      ------------------------------------------------------------------VGER
MDLA_BUCAP      -------------------------------------------------------KLADIHKDIVCLPQG
LOLD_PSEPF      ----------------------------------------------IPEARQRATALLEVGLGHRLEHKP
CBIO1_LACC3     -----------------------------------------------------------VGLPHDVLEKS
CBIO1_LACBA     --------------------------------------------------------LTTVGLDQSYAERS
AB1G_ARATH      ----------------------------------------------------------------------
AB1A_ARATH      --------------------------------------------------------------------KP
AB14C_ARATH     ------------------------------------------------------------------IGER
AB13G_ARATH     ----------------------------------------------------------------------
AB12B_ARATH     ------------------------------------------------------------------VGEH
ZNUC_SILPO      --------------------------------------------------------LARAGVPDLANRQ-
ZNUC_PSEU2      ---------------------------------------------------AAASALEEVGAGKV-IDSP
ZNUC_ERWCT      ----------------------------------------------------ILPALKRVQAAHL-LEQP
YOX6_SCHPO      ------------------------------------------------------------------IDQE
YGAD_BACSU      ------------------------------------------------------------------VGER
Y3926_AZOC5     ---------------------------------------------------------------------P
Y2317_HALSA     -------------------------------------------------------RVADA-LDAVELGER
RBSA2_RUBXD     ---------------------------------------------------------------------P
PSTB1_THETN     --------------------------------------------------------LEAVGLSKDYLFKD
POTA_LACLS      ----------------------------------------------------------------------
POTA_LACLA      ----------------------------------------------------------------------
PHNC_LACPL      -----------------------------------------------------LQLLDEVGLKEYAY-QR
PHNC2_RHOFD     --------------------------------------------------------LAERALAGFDVGDK
PHNC2_PSE14     -----------------------------------------------------MAALDRVGLADLAT-QR
NODI1_RHIME     ----------------------------------------------------------------------
NDVA_RHIEC      ------------------------------------------------------------------VGER
MDR3_CAEEL      --------------------------------------------------HTFVMGLPD---GYTSVGAS
MACB_CAMJJ      ----------------------------------------------------------------------
GLNQ_BACSU      ----------------------------------------------------------------------
CBIO1_UREPA     --------------------------------------------------------LNKLGLGDDYLERS
CBIO1_OCEIH     ----------------------------------------------------------------------
CBIO1_MYCGE     ----------------------------------------------------------------------
ARTM_BACSU      ----------------------------------------------------------------------
ABCB6_HUMAN     ------------------------------------------------------------------VGER
AB2E_ARATH      ------------------------------------------------------------------MDQE
AB27B_ARATH     ------------------------------------------------------------------VGER
AB13B_ARATH     ------------------------------------------------------------------VGEG
ZNUC_AGRT5      -------------------------------------------------AREIDAALNATGIAHLANAE-
Y5533_VIBVU     ----------------------------------------------------------------------
Y5482_VIBPA     ----------------------------------------------------------------------
Y4342_METAC     ----------------------------------------------------------------------
Y4021_METAC     ----------------------------------------------------------------------
Y1680_STRA3     ---------------------------------------------------------------------P
RBSA_RHOSR      ---------------------------------------------------------------YARITDP
RBSA_BURPS      ----------------------------------------------------------------------
RBSA2_BURP1     ----------------------------------------------------------------------
RBSA1_STRAW     -----------------------------------------------------------LGVRMAGLGQH
RBSA1_BURS3     ----------------------------------------------------------------------
PHNC2_TRIEI     ----------------------------------------------------------------------
MSBA_SHESR      ------------------------------------------------------------------VGEN
MSBA_SHESM      ------------------------------------------------------------------VGEN
MSBA_SHEON      ------------------------------------------------------------------VGEN
MRP3_MOUSE      ------------------------------------------------------------------IGEK
MACB_BRAJA      ----------------------------------------------------------------------
LOLD_RALSO      ------------------------------------------------ARHTAQAMLARVGLGERTAHRP
LOLD_PSEHT      ---------------------------------------------------AALEMLEKVGLAHRSSHKP
LOLD_HYPNA      ----------------------------------------------------------------------
LCNCL_LACLA     -------------------------------------------------------------LGYQTLSSD
COMA_STRR6      ----------------------------------------------------------------------
COMA_STRPN      ----------------------------------------------------------------------
CBIO_SALTI      --------------------------------------------------------------------QP
CBIO_SALPA      --------------------------------------------------------------------QP
CBIO_MOOTA      --------------------------------------------------------LRSVGLEDLA-ARP
CBIO_METJA      --------------------------------------------------------------------KP
CBIO1_METHJ     --------------------------------------------------HRVSEALRTVGLSEYRTRVP
AB6B_ARATH      ------------------------------------------------------------------IGMR
AB11B_ARATH     ------------------------------------------------------------------VGEH
YWJA_BACSU      ------------------------------------------------------------------IGER
YO075_YEAST     ----------------------------------------------------------------------
YHEI_BACSU      ------------------------------------------------------------------VGEK
YCOBB_RHOCA     --------------------------------------------------------------------RP
YBBL_ECOLI      ------------------------------------------------------------------LTKN
Y2641_BACAN     ---------------------------------------------------------------------P
Y2424_BACHK     ---------------------------------------------------------------------P
Y1893_SULSO     ----------------------------------------------------------------------
RBSA_CORGL      -----------------------------------------------------------------SLKQP
PSTB_SULSO      ---------------------------------------------------------------YDRLNSP
PHNC_RHIME      --------------------------------------------------------------------QP
PHNC_RHIL3      --------------------------------------------------HAIAA-LERLGIEQTAL-QA
PHNC1_TRIEI     ---------------------------------------------------------------------P
NODI_BRASS      ----------------------------------------------------------------------
MSBA_FRATO      -----------------------------------------------------------------NIGNN
MSBA_FRATH      -----------------------------------------------------------------NIGNN
MRP3_RAT        ------------------------------------------------------------------IGEK
MRP3_HUMAN      ------------------------------------------------------------------IGEK
MALK_VIBPA      -------------------------------------------------------------LGHLLERQP
MALK_SHISS      ----------------------------------------------------------------------
MALK_SHIFL      ----------------------------------------------------------------------
MALK_SHIF8      ----------------------------------------------------------------------
MALK_ECOUT      ----------------------------------------------------------------------
MALK_ECOLI      ----------------------------------------------------------------------
MALK_ECOL6      ----------------------------------------------------------------------
MALK_ECOL5      ----------------------------------------------------------------------
MALK_ECO57      ----------------------------------------------------------------------
MACB_SHESW      ----------------------------------------------------------------------
MACB_CHLTE      -----------------------------------------------------LKRLEMVGLAQRSDHRP
MACB_BDEBA      ----------------------------------------------------------------------
LSRA_YERE8      -----------------------------------------------------------LNIKFSHLEQP
LSRA_PHOLL      ---------------------------------------------------AVLERYCQINIKFSHINQP
LOLD_SHEDO      ----------------------------------------------LAEAKALLER---VGLGHRLTHLP
LOLD_CHRSD      --------------------------------------------------------LAKVGMEARGEHKP
HRTA_STAS1      ------------------------------------------------------TLLKQIGLNHRLTAFP
CCMA_PSEAE      ---------------------------------------------------AIWQALADVGLGFEDV--P
CBIO3_CLOP1     ----------------------------------------------------------------------
CBIO2_CLOPS     ----------------------------------------------------------------------
CBIO2_CLOPE     ----------------------------------------------------------------------
BTUD_VIBPA      ------------------------------------------------------------------LHRS
BTUD_CITK8      ------------------------------------------------------------------LGRS
ARAG_BACST      -----------------------------------------------------------------SVFQK
ABCA7_HUMAN     --------------------------------------------------------LARLGLSWYA-DRP
ABCA4_DICDI     ------------------------------------------------------TKIAEVGLGE-KLNAP
AB29B_ARATH     ----------------------------------------------------------------------
AB15B_ARATH     -------------------------------------------------AHDFITSLTE---GYDTYGDR
ZNUC_RHIME      --------------------------------------------------------LAATGMLHMAKAE-
YVFR_BACSU      ----------------------------------------------------------------------
Y986_MYCTU      ----------------------------------------------------------------------
Y1583_CLOPE     ----------------------------------------------------------------------
Y1508_METJA     ----------------------------------------------------------------------
Y124_THEMA      ----------------------------------------------------VRSTLKDVGILHKE-NDP
Y1242_METJA     ----------------------------------------------------------------------
RBSA_SHISS      -----------------------------------------------------------------SMEQA
RBSA_SALTY      -----------------------------------------------------------------SMEQA
RBSA_SALTI      -----------------------------------------------------------------SMEQA
RBSA_SALPA      -----------------------------------------------------------------SMEQA
RBSA_SALCH      -----------------------------------------------------------------SMEQA
RBSA_OCEIH      ---------------------------------------------------------------------P
RBSA_ECOUT      -----------------------------------------------------------------SMEQA
RBSA_ECOLI      -----------------------------------------------------------------SMEQA
RBSA_ECOL6      -----------------------------------------------------------------SMEQA
RBSA_ECOL5      -----------------------------------------------------------------SMEQA
RBSA_BACCR      --------------------------------------------------------------------QA
RBSA1_ECO57     -----------------------------------------------------------------SMEQA
RBSA1_BURCM     ----------------------------------------------------------------------
RBSA1_BURCH     ----------------------------------------------------------------------
RBSA1_BURCA     ----------------------------------------------------------------------
PHNC_WOLSU      ----------------------------------------------------------------------
PHNC2_RALME     -----------------------------------------------------LTVIERVGLLEKALSRA
PHNC2_BACHD     ----------------------------------------------------------------------
PHNC2_ANASP     --------------------------------------------------------------------QK
PHNC1_RALME     -----------------------------------------------------LDALAQVGIDDYAF-QR
PDR13_ORYSJ     --------------------------------------------------------------------QG
NDVA_BRUSU      ------------------------------------------------------------------VGER
NDVA_BRUME      ------------------------------------------------------------------VGER
NDVA_BRUAB      ------------------------------------------------------------------VGER
NDVA_BRUA2      ------------------------------------------------------------------VGER
NAP5_ARATH      ------------------------------------------------------------------IGER
LMRA_LACLA      ------------------------------------------------------------------VGER
LAGD_LACLA      ----------------------------------------------------------------------
HMUV_SALRD      ----------------------------------------------------------------------
HMUV_RHOP5      --------------------------------------------------------LHEVGLAEFR-DRK
GLNQ_BACST      ----------------------------------------------------------------------
CBRD_DICD3      --------------------------------------------------------------------RP
CBIO_SALTY      --------------------------------------------------------------------QP
CBIO2_LACLM     ----------------------------------------------------------------------
CBIO2_ENTFA     -----------------------------------------------------------VGLDEKYLQHS
BTUD_VIBSL      ------------------------------------------------------------------LHRS
ABCGK_DICDI     ----------------------------------------------------------------------
ABCBB_HUMAN     -----------------------------------------------------------------NVGSQ
ABCA7_RAT       ----------------------------------------------VPEAQVAQTALSGVRLGLPSYARP
ABCA7_MOUSE     ----------------------------------------------VPEAQVAQTALSGVRLGLPSYARP
AB9B_ARATH      -----------------------------------------------------------------SVGER
AB5C_ARATH      ------------------------------------------------------------------IGER
AB31G_ARATH     -------------------------------------------------------------LRYALVGLP
AB22G_ARATH     -----------------------------------------------------LERCQDTMIG----GAF
AB22B_ARATH     -------------------------------------------------AHDFIVTLSD---GYDTYGDR
ZNUC_SACD2      -----------------------------------------------PSRSARKAALEQVGIANLSSAQ-
ZNUC_PSYCK      ------------------------------------------------------------------LSRQ
ZNUC_PSYA2      ------------------------------------------------------------------LSRQ
YRIBC_METTM     ----------------------------------------------------------------------
YHIH_ECOLI      --------------------------------------------------------------------RP
YFEB_YERPE      -----------------------------------------------------------VGLTALRSRQ-
Y348_CHLPN      -------------------------------------------------AFHILERVGLESVADRQIGQ-
Y1934_STRMU     TVLQDPDGQFI----------GLTVAEDLAFALENDC-----------VAHETMFERVDTWADKLDLKEL
Y1633_STRA5     ---------------------------------------------------------------------P
XYLG_THEP3      -----------------------------------------------------------------TIRQR
THIQ_RHIME      --------------------------------------------------------LARVGLAGFGKRLP
SRTF_STRPY      ----------------------------------------------------ILPLLNKVGLGNIDK-RP
SRTF_STRP1      ----------------------------------------------------ILPLLNKVGLGNIDK-RP
RBSA_PHOLL      -----------------------------------------------------------------SMGQV
RBSA_BACHK      --------------------------------------------------------------------QA
RBSA_BACCZ      --------------------------------------------------------------------QA
RBSA_BACC1      --------------------------------------------------------------------QA
RBSA_BACAN      --------------------------------------------------------------------QA
RBSA2_AGRT5     -----------------------------------------------------------------SVGDA
RBSA1_AGRT5     ---------------------------------------------------------------------P
RAD50_PYRHO     ---------------------------------------------------------------YDGVERP
RAD50_PYRAB     ---------------------------------------------------------------------P
PTXA_PSEST      -----------------------------------------------------LSCLARVGLADKALSR-
PHNC_MESFL      ----------------------------------------------------------------------
MALK_SALTY      ----------------------------------------------------------------------
MALK_SALTI      ----------------------------------------------------------------------
MALK_SALPA      ----------------------------------------------------------------------
MALK_SALCH      ----------------------------------------------------------------------
LSRA_PHOLU      ---------------------------------------------------AVLERYCQLNIKFSHINQP
LOLD_XANC5      -----------------------------------------------------LQLLESVGLGHRVEHKP
LOLD_PSEAE      -----------------------------------------------------------VGLGHRLSHKP
LOLD_BRAJA      -------------------------------------------------------------LGYLGLGDR
LMRA_LACLM      ------------------------------------------------------------------VGER
LIVF_ARCFU      ----------------------------------------------------------------------
HMUV_RHOPB      --------------------------------------------------------LHEVGLDAFRDRQ-
CBIO_METMP      --------------------------------------------------------------------KP
CBIO2_CLOTE     ----------------------------------------------------------------------
CBIO1_LEUMM     ----------------------------------------------------------------------
BTUD_ERWCT      ------------------------------------------------------------------LARP
ATM1_YEAST      ------------------------------------------------------------------VGER
ABCG8_HUMAN     ----------------------------------------------------------------------
ABCG1_HUMAN     -------------------------------------------------------------LGLLSCANT
ABCC1_DICDI     ------------------------------------------------------------------IGER
AB14G_ARATH     --------------------------------------------------------IAELGLNRCTIGGP
YBHF_SHIFL      ----------------------------------------------------------------------
YBHF_ECOLI      ----------------------------------------------------------------------
Y731_ARCFU      ----------------------------------------------------------------------
Y528_PYRFU      ----------------------------------------------------VFNSLKLVGMGYID--RE
RGMG_THETN      --------------------------------------------------------IRDLKIKTPSLFQR
RBSA_STRA5      ---------------------------------------------------------------YIKSGRP
RBSA_STRA3      ---------------------------------------------------------------YIKSGRP
RBSA_STRA1      ---------------------------------------------------------------YIKSGRP
RBSA_RHOBA      -----------------------------------------------------------------SLREK
RBSA3_RHIL3     -------------------------------------------------AHNLVRRL---GVRMGGIDMP
RAD50_PYRFU     --------------------------------------------------------------------RP
PSTB_GLUOX      ----------------------------------------------------VLTRVALWNEVRDRLNAP
MSBA_IDILO      ------------------------------------------------------------------VGEN
MODC_GRABC      -----------------------------------------------------------LGIGALLKRRP
MDL2_YEAST      ------------------------------------------------------------------IGPH
LOLD_XANCP      -----------------------------------------------------LQLLESVGLGHRVEHKP
LOLD_XANC8      -----------------------------------------------------LQLLESVGLGHRVEHKP
LOLD_VIBCH      --------------------------------------------------------LERVGLGHRVAHRP
LOLD_RALME      -------------------------------------------------AQAVLER---VGLGGRSKHRP
LCNC_LACLA      -------------------------------------------------------------LGYQTLSSD
HMUV_RHOPS      ----------------------------------------------------------------------
HMUV_RHOP2      --------------------------------------------------------LHEVGLGEFR-SRD
CCMA_RHOPB      --------------------------------------------------------LAAVGLGHIA-HLP
CBIO2_STAHJ     ----------------------------------------------------------------------
CBIO1_THETN     ----------------------------------------------------------------------
CBIO1_MYCPN     ----------------------------------------------------------------------
ADCC_STRR6      ----------------------------------------------------------------------
ADCC_STRPN      ----------------------------------------------------------------------
ABCCD_DICDI     ------------------------------------------------------------------IGER
ABCB9_MOUSE     -------------------------------------------------AHGFIMELQD---GYSTTGEK
AB6G_ARATH      ----------------------------------------------------------------------
AB18B_ARATH     -------------------------------------------------AHDFITSLSN---GYTCCGDR
AB10C_ARATH     ------------------------------------------------------------------IGER
ZNUC_MAGSM      ---------------------------------------------------AMLAVLEETGVAHV-LHAP
ZNUC_HAES1      -----------------------------------------------------------LSIGHLRLNA-
YDIF_BACSU      --------------------------------------------------------------------KP
Y804_OCEIH      ----------------------------------------------------------------------
Y492_RICBR      ------------------------------------------------------------------IGEK
TCYC_BACSU      ----------------------------------------------------------------------
TAP1_HUMAN      ----------------------------------------------------------------------
SSUB1_PARDP     ------------------------------------------------AVQAAQSMLDSVGIGDKARAYP
RGMG_PSEU2      -----------------------------------------------------------------SLEQC
RGMG_PSESM      -----------------------------------------------------------------SLEQC
RGMG_PSEF5      -----------------------------------------------------------------SLEQC
RGMG_BACHD      -----------------------------------------------------------------SIEQI
RGMG3_BURCM     -----------------------------------------------------------------SVAQP
RBSA_BACSK      --------------------------------------------------------------------QK
RBSA2_BURTA     ----------------------------------------------------------------------
RBSA1_RUBXD     -----------------------------------------------------------------SLEQE
PHNC3_BACHD     ----------------------------------------------------------DVALAYRSLQQR
PHNC3_ANASP     ----------------------------------------------LPKAYIALECLDRVGLLSKALAR-
PHNC2_RHOP2     ----------------------------------------------------------------------
PDR3_TOBAC      ------------------------------------------------------------GIKGMLVGMP
NOCP_AGRT5      --------------------------------------------------------LDKVGIANKHAAYP
MSBA1_COLP3     -----------------------------------------------------------------NIGEN
MNTB_BACHD      ----------------------------------------------------------------------
MNTA_SYNY3      ----------------------------------------------------------------------
MGLA_TREDE      ----------------------------------------------------------------LSADQG
METN_PROAC      --------------------------------------------------------LSFVGLTSKAWDHP
MACB_NITWN      ----------------------------------------------------------------------
LOLD_ZYMMO      ----------------------------------------------------------------------
LOLD_XANAC      -----------------------------------------------------LQLLESVGLGHRVEHKP
LOLD_VIBF1      ------------------------------------------------AAKRATELLEKVGLAHRIEHRP
LOLD_MESSB      -------------------------------------------------------------LAYMKLGSR
HMUV_VIBF1      ----------------------------------------------------------------------
HMUV_VIBCH      ----------------------------------------------------------------------
CYDC_HAEIN      ----------------------------------------------------------------LWLGDG
CCMA_GRABC      ---------------------------------------------------AILNALEAVGLSALS-ALP
CBIO2_SYMTH     ----------------------------------------------------------------------
CBIO2_LACLA     ----------------------------------------------------------------------
CBIO1_MYCMO     -----------------------------------------------------------VGLPENYLQRS
CBIO1_BACHK     ----------------------------------------------------------------------
CBIO1_BACHD     -----------------------------------------------------------VGIDHLLDEEP
CBIO1_BACC1     ----------------------------------------------------------------------
CBIO1_BACAN     ----------------------------------------------------------------------
CBIO1_BACAH     ----------------------------------------------------------------------
BTUD_SALTY      -----------------------------------------------------LNEVADMGLGD-KLGRS
BTUD_SALTI      -----------------------------------------------------LNEVADMGLGD-KLGRS
BTUD_SALPK      -----------------------------------------------------LNEVADMGLGD-KLGRS
BTUD_SALPA      -----------------------------------------------------LNEVADMGLGD-KLGRS
BTUD_SALHS      -----------------------------------------------------LNEVADMGLGD-KLGRS
BTUD_SALEP      -----------------------------------------------------LNEVADMGLGD-KLGRS
BTUD_SALDC      -----------------------------------------------------LNEVADMGLGD-KLGRS
BTUD_SALCH      -----------------------------------------------------LNEVADMGLGD-KLGRS
BTUD_ECOUT      ------------------------------------------------------------------LGRS
BTUD_ECOL6      ------------------------------------------------------------------LGRS
BTUD_ECOL5      ------------------------------------------------------------------LGRS
BTUD_ECOK1      ------------------------------------------------------------------LGRS
BTUD_ECO81      ------------------------------------------------------------------LGRS
BTUD_ECO45      ------------------------------------------------------------------LGRS
BTUD_ECO27      ------------------------------------------------------------------LGRS
ABCG2_MOUSE     -----------------------------------------------------LEKVADSKVGT----QF
ABCC9_RABIT     ------------------------------------------------------------------IGER
ABCC2_DICDI     ------------------------------------------------------------------IGER
ABCB9_RAT       -------------------------------------------------AHGFIMELQD---GYSTTGEK
ABCB6_MOUSE     ------------------------------------------------------------------VGER
AB9C_ARATH      ------------------------------------------------------------------IGER
AB4G_ARATH      -------------------------------------------------------------LAHTRLGQG
AB26B_ARATH     -------------------------------------------------AHDFITALPN---GYNTIVDD
YFMF_BACSU      ----------------------------------------------------------------------
Y3551_METAC     --------------------------------------------------HVGLTRLKD---------KP
Y2766_STAAR     ---------------------------------------------------------------------P
Y2708_STAAC     ---------------------------------------------------------------------P
Y2684_STAAM     ---------------------------------------------------------------------P
Y2668_BACC1     ---------------------------------------------------------------------P
Y2603_STAAW     ---------------------------------------------------------------------P
Y2569_STAAS     ---------------------------------------------------------------------P
Y2476_STAAN     ---------------------------------------------------------------------P
Y2153_ENTFA     ----------------------------------------------------------------------
TAGB_DICDI      ----------------------------------------------------------------------
RGMG_PSE14      -----------------------------------------------------------------SLEQC
RBSA3_RHIEC     -----------------------------------------------------------------ALSVP
RBSA1_RHIL3     -----------------------------------------------------------------TIDMP
PSTB1_CHRSD     ------------------------------------------------------------------LHEP
POTA_STRA5      ----------------------------------------------------------------------
POTA_STRA3      ----------------------------------------------------------------------
POTA_STRA1      ----------------------------------------------------------------------
PHNC_ANAVT      --------------------------------------------------------------------QR
PHNC2_RALEH     -----------------------------------------------------LDALAQVGIDDYAF-QR
PHNC2_PSESM     -----------------------------------------------------MVALDRVGLADLA-AQR
PEB1C_CAMJJ     ----------------------------------------------------------------------
PEB1C_CAMJE     ----------------------------------------------------------------------
NODI_BRAJA      ----------------------------------------------------------------------
NDVA_RHIME      ------------------------------------------------------------------VGER
NDVA_RHILO      ----------------------------------------------------------------------
MSBA_PSEA6      ------------------------------------------------------------------IGEN
MRP2_RAT        ------------------------------------------------------------------IGEK
MRP2_MOUSE      ------------------------------------------------------------------IGEK
MALK_VIBF1      -------------------------------------------------------------LGHLLERQP
MALK_PHOPR      -------------------------------------------------------------LGHLLERQP
MACB_MANSM      ----------------------------------------------------------------------
MACB_HYPNA      ----------------------------------------------------------------------
LSRA_PHOTE      -----------------------------------------------------------LNIKFSHINQP
LOLD_XANOR      -----------------------------------------------------LQLLESVGLGHRIDHKP
LOLD_XANOM      -----------------------------------------------------LQLLESVGLGHRIDHKP
LOLD_VIBVY      -----------------------------------------------------------VGLQHRMHHRP
LOLD_VIBVU      -----------------------------------------------------------VGLQHRMHHRP
LOLD_RALEJ      ------------------------------------------------AAQAMLER---VGLGGRSKHRP
HMUV_SODGM      ----------------------------------------------------------------------
FBPC_PSEPF      ----------------------------------------------------------------------
EF3_CANGA       ---------------------------------------------------AITAKLVEFGFTEEMINMP
CBIO_CARHZ      --------------------------------------------------------------------RP
CBIO2_MYCHJ     -----------------------------------------------------------VGLDQSFLQKS
CBIO2_MYCH7     -----------------------------------------------------------VGLDQSFLQKS
CBIO1_MYCH2     -----------------------------------------------------------VGLDQSFLQKS
ATM1_ASHGO      ------------------------------------------------------------------VGER
AOTP_PSEAE      --------------------------------------------------------LAKVGVAHRKDAYP
ABCG5_HUMAN     -------------------------------------------------AELSLSHVADRLIGNYSLGG-
ABCG2_PIG       -----------------------------------------------------LDKVADSKVGT----QF
ABCG2_BOVIN     -----------------------------------------------------LDKVADSKVGT----QF
ABCB6_RAT       ------------------------------------------------------------------VGER
AB7G_ARATH      ----------------------------------------------------------------------
AB7C_ARATH      ------------------------------------------------------------------IGER
AB3E_ARATH      ----------------------------------------------------------------------
AB3C_ARATH      ------------------------------------------------------------------IGER
AB15C_ARATH     ------------------------------------------------------------------IGER
ZNUC_RHOS4      ----------------------------------------------------------------------
ZNUC_PSESM      ------------------------------------------------------------------IDSP
ZNUC_MESSB      --------------------------------------------------------LEAAGIAHLARAE-
ZNUC_HAEIN      ----------------------------------------------------ISTALEQLSISHLRKNN-
YKNU_BACSU      -------------------------------------------------AHNFIMELPD---GYTMLGER
Y906_TREDE      SSMRICDISNIAASVFQNPESQFFTTDVLSDLVYPCENCGIEKEEIQERLHRVTKLLSLEPL----LNRK
Y719_METJA      ------------------------------------------------------------------LDRE
Y664_HAEIN      ----------------------------------------------------------------------
Y4GM_RHISN      ------------------------------------------------------------------VGEN
Y391_CHLTE      --------------------------------------------------------------------KP
Y1589_THETN     ----------------------------------------------------------------------
Y1078_HAEIN     ----------------------------------------------------------------------
XYLG_BURCM      ---------------------------------------------------------------------P
SCRT_DROME      -------------------------------------------------------------------GDD
RBSA_SILST      -----------------------------------------------------------------TLQDP
RBSA_RHOS4      --------------------------------------------------------------------QL
RBSA_JANSC      -----------------------------------------------------------------ALDQD
RBSA_DEIGD      ------------------------------------------------------------------LTDP
RBSA_BACHD      --------------------------------------------------------------------QQ
RBSA2_RHIME     -----------------------------------------------------LTRRLGVRMGGVDM--P
RBSA2_RHIL3     -----------------------------------------------------------------ALSVP
RBSA1_THEMA     -----------------------------------------------------------------SIYQI
RBSA1_STRCO     ---------------------------------------------------------------YARIADT
RAD50_AERPE     --------------------------------------------------------------------RP
PSTB_THEMA      ----------------------------------------------------------------------
PMD1_SCHPO      -----------------------------------------------------------------NVGQR
PHNC_HYPNA      -----------------------------------------------PVVDAACQLLDEVGLTEAQANRR
MODC_AGRT5      -----------------------------------------------------------LGISHLLQRRP
MGLA1_PHOPR     ------------------------------------------------------------------MAEK
METN_RALEH      -------------------------------------------------AATVLPLLDLVGLSALK-GRY
MDLB_ECOLI      ---------------------------------------------------------------YTPLGEQ
MDLB_ECOL6      ---------------------------------------------------------------YTPLGEQ
MDLB_ECO57      ---------------------------------------------------------------YTPLGEQ
MACB_RHOBA      --------------------------------------------------------LESVGLGGRLDHMP
LOLD_SPHAL      ----------------------------------------------------------------------
LOLD_BORPE      ----------------------------------------------------------------------
LOLD_BORPA      ----------------------------------------------------------------------
LOLD_BORBR      ----------------------------------------------------------------------
LOLD_AQUAE      --------------------------------------------------------LSELGLGDKLSRKP
LOLD2_PELLD     ----------------------------------------------------------------------
HMUV_NITWN      ----------------------------------------------IAAAHPLVESAMDEVAIRPLRSRQ
CYSA_ANTFO      ----------------------------------------------------------------------
CCMA_PSEF5      ---------------------------------------------------AIWQALAAVGLGFEDV--P
CCMA_BRAJA      --------------------------------------------------------LATVGLDHAT-HLP
CBIO2_MYCGA     ----------------------------------------------------------------------
CBIO1_MESFL     --------------------------------------------------------------------EP
BTUD_YERE8      ------------------------------------------------------------------LPRM
ARAG_BACHD      -----------------------------------------------------------------SIDQK
AB8G_ARATH      -------------------------------------------------SETVTSLLSELNLTHLSHTRL
AB7B_ARATH      -----------------------------------------------------------------SVGER
AB23G_ARATH     ----------------------------------------------------------------------
AB20B_ARATH     ----------------------------------------------------------------------
ZNUC_PASMU      ----------------------------------------------------------------------
YKNV_BACSU      --------------------------------------------------------ISDLAEGYATVEER
Y2439_THEEB     --------------------------------------------------------------------RP
Y1312_MYCBO     ----------------------------------------------------------------------
Y1281_MYCTU     ----------------------------------------------------------------------
Y068_CHLTR      ----------------------------------------------------------------------
SSUB_MYCPA      --------------------------------------------------------LADVGLADHARAWP
SSUB_MYCA1      --------------------------------------------------------LADVGLADHARAWP
RBSA_BURXL      ---------------------------------------------------------------------P
RBSA2_STRAW     ---------------------------------------------------------AKLQVKYARIADA
RBSA2_PASMU     --------------------------------------------------------------------QK
PSTB_WOLSU      ------------------------------------------------------------------LKSP
POTA_STRSV      ----------------------------------------------------------------------
POTA_SPICI      ----------------------------------------------------------------------
PHNC_BACSK      ----------------------------------------------------------------------
PHNC2_PSEU2     -----------------------------------------------------MVALERVGLADLA-AQR
PHNC2_NATPD     ----------------------------------------------------------------------
PDR12_ORYSJ     ----------------------------------------------------------------------
MSMK_STRMU      ----------------------------------------------------------------------
MSBA_PSEHT      ------------------------------------------------------------------VGEN
MODC_PSEF5      -----------------------------------------------------------LGIGHLLQRHP
METN_RHOP5      ----------------------------------------------------------------------
METN2_ERWCT     --------------------------------------------------------LSLVG