[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ55679.1

[Show Plain Result]


## Summary of Sequence Search
    1::854
   39::820     3e-77  32%  847 aa  QUIP_PSEAE RecName: Full=Acyl-homoserine lactone acylase quiP;     
   42::822     2e-69  30%  824 aa  QUIP_PSE14 RecName: Full=Acyl-homoserine lactone acylase quiP;     
   41::797     3e-69  30%  824 aa  QUIP_PSEU2 RecName: Full=Acyl-homoserine lactone acylase quiP;     
   42::822     6e-69  30%  824 aa  QUIP_PSESM RecName: Full=Acyl-homoserine lactone acylase quiP;     
   31::789     9e-64  29%  809 aa  QUIP_PSEF5 RecName: Full=Acyl-homoserine lactone acylase quiP;     
   31::796     1e-57  33%  816 aa  QUIP_PSEPF RecName: Full=Acyl-homoserine lactone acylase quiP;     
   32::161     9e-51  31%  774 aa  PAC2_PSES3 RecName: Full=Penicillin acylase 2;       
   36::791     6e-45  30%  813 aa  QUIP_PSEPK RecName: Full=Acyl-homoserine lactone acylase quiP;     
   32::574     3e-42  32%  802 aa  PAC_BACME RecName: Full=Penicillin G acylase;       
   32::574     2e-40  32%  802 aa  PAC_ARTVI RecName: Full=Penicillin G acylase;       
   33::560     1e-37  32%  844 aa  PAC_KLUCI RecName: Full=Penicillin G acylase;       
   22::131     3e-25  36%  846 aa  PAC_ECOLX RecName: Full=Penicillin G acylase;       
   37::145     5e-25  33%  720 aa  G7AC_BREDI RecName: Full=Glutaryl-7-aminocephalosporanic-acid
   37::145     1e-24  33%  720 aa  G7AC_PSEU7 RecName: Full=Glutaryl-7-aminocephalosporanic-acid
   28::139     1e-12  27%  778 aa  PVDQ_PSEPF RecName: Full=Acyl-homoserine lactone acylase pvdQ;     
  216::425     2e-10  30%  777 aa  PVDQ_PSEF5 RecName: Full=Acyl-homoserine lactone acylase pvdQ;     
  185::355     3e-10  36%  772 aa  PVDQ_PSEPK RecName: Full=Acyl-homoserine lactone acylase pvdQ;     
   40::147     6e-10  30%  762 aa  PVDQ_PSEAE RecName: Full=Acyl-homoserine lactone acylase pvdQ;     
  223::562     1e-07  27%  779 aa  PVDQ_PSEU2 RecName: Full=Acyl-homoserine lactone acylase pvdQ;     
  228::359     1e-07  31%  786 aa  AAC_ACTUT RecName: Full=Aculeacin-A acylase;       
  223::563     2e-06  25%  779 aa  PVDQ_PSE14 RecName: Full=Acyl-homoserine lactone acylase pvdQ;     
  221::428     2e-05  26%  773 aa  PVDQ_PSESM RecName: Full=Acyl-homoserine lactone acylase pvdQ;     
  395::505     3e-05  38%  536 aa  CH602_MOOTA RecName: Full=60 kDa chaperonin 2;AltName: Full=Protein
    1::854

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWTVRRSFPQVSGELELPALSAPVTVYRDEYGITHLYADT
QUIP_PSEAE      ------------------------------------SLPPTSGVQPIKGLAQNVSIRRNALGMPLIETGT
QUIP_PSE14      -----------------------------------------SGTFPLKGLAQNVSVRRNNMGMPLIESST
QUIP_PSEU2      ----------------------------------------VSGTFPLKGLAQNVSVRRNNMGMPLIESSS
QUIP_PSESM      -----------------------------------------SGTFPLKGLAQNVSVRRNNMGMPLIESST
QUIP_PSEF5      -------------------------------WNTQDTLPPTSGVQPLKGLAQNVSVRRNAVGVPLIESSS
QUIP_PSEPF      -------------------------------WNAQDTLPPTSGVQPLKGLAQNVSVRRNAMGMPLIESNS
PAC2_PSES3      -----------------------------------------------------VRVQRDGWGIPHIKASG
QUIP_PSEPK      ------------------------------------SVPPTSGVQPLKGLAQNVSVRRNAMGAPLIESSS
PAC_BACME       -----------------------------------------------------VKVVRDNFGVPHLYAKN
PAC_ARTVI       -----------------------------------------------------VKVVRDNFGVPHLYAKN
PAC_KLUCI       -----------------------------------------------------VKIVRDEYGMPHIYADD
PAC_ECOLX       ----------------------------------------------LPALSSEIKIVRDEYGMPHIYAND
G7AC_BREDI      ---------------------------------------------------APIAAYKDGYGVPHIYGVD
G7AC_PSEU7      ---------------------------------------------------APIAAYKDGYGVPHIYGVD
PVDQ_PSEPF      -----------------------------------------------PSVQTGADIRRTGFGVPHIRAEN
PVDQ_PSEF5      ----------------------------------------------------------------------
PVDQ_PSEPK      ----------------------------------------------------------------------
PVDQ_PSEAE      ------------------------------------------------------------YGVPHIRAKD
PVDQ_PSEU2      ----------------------------------------------------------------------
AAC_ACTUT       ----------------------------------------------------------------------
PVDQ_PSE14      ----------------------------------------------------------------------
PVDQ_PSESM      ----------------------------------------------------------------------
CH602_MOOTA     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PEDLFTAQGYVHAQDRFWSMDFNRHVTAGRLAELFGADQVPTDAYLRTMGWRRVAEAEYDLLAEETRRYL
QUIP_PSEAE      FHDALFALGYVHASDRLSQMVSLRLLAQGRLAEMVGPGALEIDRFMRTVNLRQAAEIQYRNASPRLQRFF
QUIP_PSE14      YHDALFTLGYIHAGDRIGQMLGMRLLAQGRLSEMAGADALEVDRLMRSVNLKQNASDLYNAASPRLKRFF
QUIP_PSEU2      YHDALFTLGYVHAGDRISQMLGMRLLAQGRLSEMAGADALDVDRLMRSVNLKQNASDLYNAASPRLKRFF
QUIP_PSESM      YHDALFTLGYVHAGDRIGQMLGMRLLAQGRLSEVAGADALEVDRLMRSVNLKRNASDLYNAASPRLKRFF
QUIP_PSEF5      FHDALFTLGYVHASDRIGQMVTLHLLAQGRLAEMSGADALEVDRLMRAINLKKSADELYKASSPRIKRFF
QUIP_PSEPF      FHDALFALGYVHASDRINQMVTLRLLAQGRLAEMSGSSMLDADRYMRAVNLKKSAGELYKASSPRLKRFF
PAC2_PSES3      EADAYRALGFVHAQDRLFQMELTRRKXXXXXXXXXXXXXXXXDILVRRLGMEKVCRRDFEALGAEAKDML
QUIP_PSEPK      FHDALFSLGYVHAGDRIEQMVAMRLLAQGRLAELAGSEALDIDRLMRAANLKQSAAQQYADASPRLKRFF
PAC_BACME       KKDLYEAYGYVMAKDRLFQLEMFRRGNEGTVSEIFGEDYLSKDEQSRRDGYNKEIKKMIDGLDRQPKELI
PAC_ARTVI       KKDLYEAYGYVMAKDRLFQLEMFRRGNEGTVSEIFGEDYLSKDEQSRRDGYNKEIKKMIDGLDRQPRELI
PAC_KLUCI       TYRLFYGYGYVVAQDRLFQMEMARRSTQGTVSEVLGKAFVSFDKDIRQNYWPDSIRAQIASLSAEDKSIL
PAC_ECOLX       TWHLFYGYGYVVAQDRLFQMEMARRSTQGTVAEVLGKDFVKFDKDIRRNYWPDAIRAQIAALSPEDMSIL
G7AC_BREDI      APSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVPERAQQWYAQQSPDFRANL
G7AC_PSEU7      APSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVPERAQQWYAQQSPDFRANL
PVDQ_PSEPF      ERGLGFGIGYAYAQDNLCLLANEIVTVNGERSRYFGPEQLTSDVFFQWLNTPQAVNAFWQAQPAEVRDLV
PVDQ_PSEF5      ----------------------------------------------------------------------
PVDQ_PSEPK      ----------------------------------------------------------------------
PVDQ_PSEAE      ERGLGYGIGYAYARDNACLLAEEIVTARGERARYFGSDNLPSDIFYAWLNQPEALQAFWQAQTPAVRQLL
PVDQ_PSEU2      ----------------------------------------------------------------------
AAC_ACTUT       ----------------------------------------------------------------------
PVDQ_PSE14      ----------------------------------------------------------------------
PVDQ_PSESM      ----------------------------------------------------------------------
CH602_MOOTA     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DAYAEGVNAYLEGKSATEVSLEYAVLAATNSEYEIEPWSAVDSLAWLKAMAWDLAGNMHDEIARASLLAR
QUIP_PSEAE      EVYARGVNAYLY-RYRDKLPMDLA-----QSGYRPEYWKPEDSALVFALLNFGLAVNLQEEIASLT-LAQ
QUIP_PSE14      DVYARGVNAYLRDKLPADVA---------SSGYKPEYWKPEDXXXXXXXXXXXXXXXXQEELS-ALVLAQ
QUIP_PSEU2      DVYARGVNAYLRDKLPADIA---------SSGYKPEYWKPEDXXXXXXXXXXXXXXXXQEELS-ALVLAQ
QUIP_PSESM      DVYARGVNAYLRDKLPADVA---------RAGYTPEYWKPEDXXXXXXXXXXXXXXXXQEELS-ALVLAQ
QUIP_PSEF5      EVYARGVNAYLRDKLPPDLAAQ---------GYTPEYWKAEDSALIFCLLNFGQSANLQEEI-NALVLAQ
QUIP_PSEPF      EVYARGVNAYL-FRYADKLPGDLA-----SSGYKPEYWKPEDSALIFCLLNFSQSANLPEEIA-SLVLAQ
PAC2_PSES3      RAYVAGVNAFL--ASGAPLPIEYGLLGA-----EPEPWEPWHSIAVMRRL--------------------
QUIP_PSEPK      EVYARGVNAYLFRYR------DKLPAGLASSGYRPEYWKPEDSALIFCLYAFSQSVNLQEELS-ALTLAQ
PAC_BACME       AKFAEGISRYVNEALKDKLSKEF-------HEYQFLPWTSTDVVVYMVSMTYFM--DNHQELKNAEILAK
PAC_ARTVI       AKFAEGISRYVNEALKDKLSKEF-------HEYQFLPWTSTDVVVYMVSMTY--LWIITRELKNAEILAK
PAC_KLUCI       QGYADGMNAWIDKVNASPDKL----LPQQFSTFGFKPWEPFDAMIFVGTMA-NRFSDSTSEIDNLALLTA
PAC_ECOLX       QGYADGMNAWID----------------------------------------------------------
G7AC_BREDI      DAFAAGINAYAQ----------------------------------------------------------
G7AC_PSEU7      DAFAAGINAYAQ----------------------------------------------------------
PVDQ_PSEPF      EGYAAGYNRYL-----------------------------------------------------------
PVDQ_PSEF5      ----------------------------------------------------------------------
PVDQ_PSEPK      ----------------------------------------------------------------------
PVDQ_PSEAE      EGYAAGFNRFLDGKTTS-----------------------------------------------------
PVDQ_PSEU2      ----------------------------------------------------------------------
AAC_ACTUT       ----------------------------------------------------------------------
PVDQ_PSE14      ----------------------------------------------------------------------
PVDQ_PSESM      ----------------------------------------------------------------------
CH602_MOOTA     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GLPREQVEELYPAYPEEQHAPILAGGRVRDGKFVLXXXXXXXXXXXXXXIPATAAVRALAGLQEPLEAIP
QUIP_PSEAE      KVGSDKLAWLTPTYPDEDEAEKLKGLRL-DGQ-----------------VPGLAGVEGAARQVAALSML-
QUIP_PSE14      KVGADKLAWLLPTYPDEE-LPFAEADKLKG-------------------LNLNNQVNDLSDLNKIALQLS
QUIP_PSEU2      KVSADKLAWLLPTYPDEE-LPFAEADKLKG-------------LNLNNQVTGLSDLNRIALQLSDLNML-
QUIP_PSESM      KVGADKLAWLLPTYPDEE-LPFAEADKLKG-------------------LNLSNQVTGLSDLNRIALQLS
QUIP_PSEF5      KVGSDKLPWLTPSYPDEP-LPLAEADKLKGLNLTVP------------------------GLNEVSRAIN
QUIP_PSEPF      TVTNDKLAWLTPSAPDE-NLPLAEADKLQGIKL-------------NGQIP---GLTELSNASEQLAAL-
PAC2_PSES3      ----------------------------------------------------------------------
QUIP_PSEPK      KAGSDKLAWLLPGAPDEPLAEM-----------------EVDKLKGLNLASQLPGLPALAAASQKLADLD
PAC_BACME       -LEHEYGTEVSRKMFDDKNDPSAPTSIVSEGK------PKRDXXXXXXXXXXXAVIKASEKVGKERENFV
PAC_ARTVI       -LEHEYGTEVSRKMFDDKNDPSAPTSIVSEGK------PKREXXXXXXXXXXXAVIKASEKVGKERE---
PAC_KLUCI       VKDKYGNDEGMAVFNQNPSAPTTIAARESSYKFDLQNTQTAALLVPRYDQPAPMLDRPAKGTDGALETIA
PAC_ECOLX       ----------------------------------------------------------------------
G7AC_BREDI      ----------------------------------------------------------------------
G7AC_PSEU7      ----------------------------------------------------------------------
PVDQ_PSEPF      ----------------------------------------------------------------------
PVDQ_PSEF5      ----------------------------------------------------------------------
PVDQ_PSEPK      -------------------------------------------------------VEALAGAQPPTLARA
PVDQ_PSEAE      ----------------------------------------------------------------------
PVDQ_PSEU2      ----------------------------------------------------------------------
AAC_ACTUT       ----------------------------------------------------------------------
PVDQ_PSE14      ----------------------------------------------------------------------
PVDQ_PSESM      ----------------------------------------------------------------------
CH602_MOOTA     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RTFGPASSDLGSNSWVVSGEHTASGLPLLANDPHLGAVMPSIWYQMGLHCTTVDESCPFDVTGFTFPGLT
QUIP_PSEAE      ---GVAA----SNNWAIAPQRSRSGKSLMANDTHLPLSMPSVWNYVQI------RSPKYQAAGVSIAGLP
QUIP_PSE14      NMLGVAAS----SNWAIAPQRSRSGKSLLASDMQLPAGLNSAWSFVQIRAPK------YQVSGVSIAGLP
QUIP_PSEU2      ---GVAAS----SNWAIAPQRSRNGKSLLASDMQLPAGLNSAWSFVQIRAPK------YQVSGVTIAGMP
QUIP_PSESM      NMLGVAAS----SNWAIAPQRSRSGKSLLASDMQLPAGLNSAWSFVQIRAPK------YQVSGASIAGLP
QUIP_PSEF5      RLAQLNSGTRGGSNLAIAPQRSRTGRSLLAADSHLQA-----WYYTQIRAPK------YQAAGASIAGLP
QUIP_PSEPF      NLLGTQS----SNNWAIAPQRSRSGKSLLASDSHGPLAAPSLWSFVQIRAP------KYQAAGVTVAGLP
PAC2_PSES3      ------------NNWAVAPGRTATGRPILAGDPHRVFEIPGMYAQHHLACDR------FDMIGLTVPGVP
QUIP_PSEPK      LLGSPGSANL-----ALGPQRSRSGKSLLASDSR------AAWALSPVQINT----SKYQVAGLSLPGLP
PAC_BACME       QTSEELGLPLGSNAAIVGSEKSATGNALLFSGPQVGFVAPGFLYEVGLHAPG------FDMEGSGFIGYP
PAC_ARTVI       -NFVQSSEELGSNAAIVGSEKSATGNALLFSGPQVGFVAPGFLYEVGLHAPG------FDMEGSGFIGYP
PAC_KLUCI       AQFANGANGLASNMWVIGKNKAQDAKAIMVNGPQFGWYAPAYTYGIGLH------GAGYDVTGNTPFAYP
PAC_ECOLX       ---GLAGYPTTSNMWVIGKSKAQDAKAIMVNGPQFGWYAPAYTYGIGLH------GAGYDVTGNTPFAYP
G7AC_BREDI      RTLGPDLADQGSNSWAVAPGKTANGNALLLQNPHLSWTTDYFTYYEA-HLVTPD----FEIYGATQIGLP
G7AC_PSEU7      RTLGPDLADQGSNSWAVAPGKTANGNALLLQNPHLSWTTDYFTYYEA-HLVTPD----FEIYGATQIGLP
PVDQ_PSEPF      --------DRGSNAVAVGSERSFNGRGMLLANPHFPWVGGMRFYQM--HLTIPGK---LDVMGAALPGLP
PVDQ_PSEF5      --------DRGSNAVAIGSERSFNGRGLLLANPHFPWVGGMRFYQM--HLTIPGQ---LDVMGAALPGLP
PVDQ_PSEPK      QSSAGFASALGSNAVAVGAQRSANGRGLLLANPHFPWMGGMRFYQMQL---TIPGQ--LDVMGAALPGLP
PVDQ_PSEAE      ----------GSNAIAVGSERSADGKGMLLANPHFPWNGAMRFYQM--HLTIPGR---LDVMGASLPGLP
PVDQ_PSEU2      ----------GSNAVAIGRELSANGRGMLLANPHFPWGGGMRFYQM--HLTIPGK---LDVMGAALPGLP
AAC_ACTUT       ---------IGSNAYGLGAQATVNGSGMVLANPHFPWQGAERFYRMHLKVPG-----RYDVEGAALIGDP
PVDQ_PSE14      ----------GSNAVAVGHELSANGRGMLLANPHFPWGGGMRFYQM--HLTIPGK---LDVMGAALPGLP
PVDQ_PSESM      ----------GSNAVAVGRDLSANGRGMLLANPHFPWGGGMRFYQM--HLTIPGK---LDVMGAALPGLP
CH602_MOOTA     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GVVIGANDTIAWGFTNLGPDVIDLYLEKLDGDSAIVDGAPEPLETRTETIRVAGGDDVEITVRSSRHGPL
QUIP_PSEAE      GVVAGFNGKLAWGMTMVLGDNQDLYLEQLRRQGYLADGKWQPTRERQETFFIKGQRPIREVIHETRHGPL
QUIP_PSE14      LVLSGFNGKLAWSMSNVKGDNQDLFLEKIKRESYMADGKWVPAASHQETFLVKGGSPIRETVYETRHGAL
QUIP_PSEU2      LVLSGFNGKLAWSMSNVKGDNQDLFLEKIKRESYMVDGKWLPAAAHQETFLVKGGSPLRETVYETRHGAL
QUIP_PSESM      LVLSGFNGKLAWSMSNVKGDNQDLFLEKIKRESYMADGKWVPAASHQETFLVKGGSPIRETVYETRHGAL
QUIP_PSEF5      AILQGFNGKVAWSMSSVEGDNQDLFLEKLKRQGNALNGKWQPVTVRNETYFVKGQRPIREAVYETRHGPX
QUIP_PSEPF      MVLGGFNGKVAWSLTSVLGDNQDLFLEKIQGSSLTVNGKWQPVAVRNETYFVKGQRPIREAVYETRHGAL
PAC2_PSES3      GFPHFANGKVAYCVTHAFMDIHDLYLEQFDGRTARFGNEFEPVAWRRDRIAVRGGADREFDIVETRHGPV
QUIP_PSEPK      IVLAGYNGKLAWSSSAVMADNQDLFLEQLRRQSYLADGKWLPARARSETYFVRGQRPVREVMYDTRHGTL
PAC_BACME       FIMFGANNHFALSATAGYGNVTDIFEEKLNAKNSLYKGKWRDMEKRKESFTVKGDNGEKKTVEKTVHGPV
PAC_ARTVI       FIMFGANNHFALSATAGYGNVTDIFEEKLNTKNSLYKGKWRDMEKRKESFTVKGDNGEKKTVEKTVHGPV
PAC_KLUCI       GLVFGHNGTISWGSTAGFGDDVDIFAEKLSAEKPGYNGEWVKMLSRKETIAVKDGQPETFTVWRTLDGNV
PAC_ECOLX       GLVFGHNGVISWGSTAGFGDDVDIFAERLSAEKPLHNGKWVKMLSREETITVKNGQAETFTVWRTVHGNI
G7AC_BREDI      VIRFAFNQRM--GITNTVNGMVGAYRLTLQDGGYLYDGQVRPFERRQASYRLRQADDKPLEIRSSVHGPV
G7AC_PSEU7      VIRFAFNQRM--GITNTVNGMVGAYRLTLQDGGYLYDGQVRPFERPQASYRLRQADDKPLEIRSSVHGPV
PVDQ_PSEPF      MINIGFNQHLAWTHTVDSSKHFTLYLDPKDPTRYLLDGQSLPLSKQTVTVQVKQTDPVSRDVYSSQFGPI
PVDQ_PSEF5      LINIGFNQHLAWTHTVDASKHFTLYLDPKDPTRYLLDGRSLPLERQTLTVQSKGPDGQTRTLYSSVFGPI
PVDQ_PSEPK      VVNIGFNQHLAWTHTVDTSKHFTLYLDPKDPTRYVLDGKSLPMARQTIRVAVKGTDQIERQVYSSQFGPV
PVDQ_PSEAE      VVNIGFSRHLAWTHTVDTSSHFTLYLDPKDPRRYLVDGRSLPLEEKSVAIEVRGADGVEHKVYQSIYGPL
PVDQ_PSEU2      LINIGFNQHLAWSHTSKHFTLHRLQLDPKDSTRYLLDGQSVAMGKQQVSVDVKQADSVPRIVYSSIFGPV
AAC_ACTUT       IIEIGHNRTVAWSHTSTARRFVWHRLSLVPGDSYYVDGRPERMRARTVTVQTGSG-PVSRTFHDTRYGPV
PVDQ_PSE14      LINIGFNRHLAWSHTSKHFTLHRLQLDPKDSTRYLLDGKSIAMGQQQVSVEVKQPDDVPRIIYSSKFGPV
PVDQ_PSESM      LINIGFNQHLAWSHTSKHFTLHRLQLDPKDSTRYLLDGKSVAMGKQQVSVEVKQADGVPRIIYSSKFGPV
CH602_MOOTA     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LSDPELGAQLRTFAAKAPVTPEGEPAETAQDGDYAVAISWTALTPGRTADAIFLLNRARTFDEFREAART
QUIP_PSEAE      LNS-ALG-ERKNILQPLPL-----------KSGYGLAYRSIQQEADKTLDGFFDLSRAKTIEQAFDATRE
QUIP_PSE14      LN--------------ASATPPGN--------GLSLALQVPNFKDDKSLDAFFDLSRAPNVEKAFDTSRE
QUIP_PSEU2      LN--------------ASATPPGN--------GLSLALQVPNFKDDKSLDAFFDLSRAPNVEKAFDTSRE
QUIP_PSESM      LN--------------ASATPPGN--------GLSLALQVPDFKDDKSLDAFFDLSRAPNVEKAFDTSRE
QUIP_PSEF5      XXXXXXXXXXXXXXXXXQ-TPE--------------------LKDDKTLDAFFDLSRAQNVEKASDASRE
QUIP_PSEPF      LNSTQ---------------------AAAQGTGFGLALQTPSFTDDKSLDAFFDLSRAQNVERASDATRE
PAC2_PSES3      IA--------------------GDPLEGAALTLRSVQFAETDLS----FDCLTRMPGASTVAQLYDATRG
QUIP_PSEPK      LAQPE-------------------------NASLGLALNLPQFKGDRSLDALFDLTRAKNVERAFDSTRE
PAC_BACME       ISRDETNK-------------------------VAYSKSWSFRTEAQSMSAYMKANWAKNLKEFENAASE
PAC_ARTVI       ISRDETNKVA-----------------------YSKYVSFRG-TEAQSMSAYMKANWAKNLKEFENAASE
PAC_KLUCI       I---KTDTRTQTAYAKARAWAGKEVAS---------LLAWTHQM------------KAKNWPEWTQQAAK
PAC_ECOLX       LQTDQT---TQTAYAKS----------RAWDGEVASLLAWTHQM------------KAKNWQEWTQQAAK
G7AC_BREDI      FE--------------------------RADGT-AVAVRVAGLDRPGMLEQYFDMITAHSFDDYEAAMAR
G7AC_PSEU7      FE--------------------------RADGT-AVAVRVAGLDRPGMLEQYFDMITADSFDDYEAALAR
PVDQ_PSEPF      VQ---------------------WPGKLDWNNQFAYSLRDANLDNDRVLKQWYAMNRAGNLKDLQDSVHT
PVDQ_PSEF5      VQ---------------------WPGELDWDHQYAYSLRDANLDNSRVLAQWYAMNQASSVAGLQDSVHQ
PVDQ_PSEPK      VQWP------------------------------------------------------------------
PVDQ_PSEAE      VV---------------------WPGKLDWNRSEAYALRDANLENTRVLQQWYSINQASDVADLRRRVEA
PVDQ_PSEU2      VQ---------------------WPGKLDWDSKFAFSLRDANLQNDRVLQQWYAMDKADSLKAFQDSVRK
AAC_ACTUT       AVVP------------------------------------------------------------------
PVDQ_PSE14      VQ---------------------WPGKLDWDDKFAFSLRDANLENDRVLQQWYSMDKADSLKAFQDSLHK
PVDQ_PSESM      VQ---------------------WPGKLDWDDKFAFSLRDANLKNDRVLQQWYAMDQADSLKAFQDSVHR
CH602_MOOTA     ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           FEVPAQNLIYADTSGNIGYQAPGKIPVRGKGDGRWPAPGWDSDYDWKEYLPFEELPTVVNPDSGFIVTAN
QUIP_PSEAE      IRAMPLNIVFADEK-HIGWQVTGRYPNRKEGRGLLPSPGWDGRYDWDGYADPILHPSDQDPQQGWLGTAN
QUIP_PSE14      IRAITLNMIFADAS-NIGWQVTGRFPNRREGQGLLPSPGWDGKYDWDGFADSMLHPYDQDPRQGWLAAAN
QUIP_PSEU2      IRAITLNMIFADAS-NIGWQVTGRFPNRREGQGLLPSPGWDGKYDWDGFADSMLHPYDQDPRQGWLAAAN
QUIP_PSESM      IRAITLNMVFADAS-NIGWQVTGRFPNRREGQGLLPSPGWDGKYDWDGFADSMLHPYDQDPRQGWLAAAN
QUIP_PSEF5      IRAIALNMVFADAS-NIGWQVTGRFPNRREGEGLLPSPGWDGRYDWDGYADPMLHPYDQDPPQGWIATAN
QUIP_PSEPF      IRAIALNLVFADAS-NIGWQVTGRFPNRREGEGLLPSPGWEGRYDWDGYADPMLHPYDQDPAQGWLGTAN
PAC2_PSES3      WGLIDHNLVAGDVAGSIGHLVRARVPSRPRENGWLPVPGWSGEHEWRGWIPHEAMPRVIDPPGGLIVTAN
QUIP_PSEPK      VTAAAVNFVFAEPE-HIGWQVSGRYPNRREGQGLLPSPGWDGRYDWDGYADPMLHPYDQDPPAGWIGHAN
PAC_BACME       YTM-SLNWYYADKKGDIAYYHVGRYPVRNKIDERIPTPG-TGEYEWKGFIPFKENPHVINPKNGYVVNWN
PAC_ARTVI       YTM-SLNWYYADKKGDIAYYHVGRYPVRNKIDERIPTPG-TGEYEWKGFIPFKENPHVINPKNGYVVNWN
PAC_KLUCI       -QALTINWYYADVNGNIGYVHTGAYPDRQPGDPRLPVP--DGKWDWKGLLSFDLNPKVYNPQSGYIANWN
PAC_ECOLX       -QALTINWYYADVNGNIGYVHTGAYPDRQSGDPRLPVPG-TGKWDWKGLLPFEMNPKVYNPQSGYIANWN
G7AC_BREDI      MQVPTFNIVYADREGTINYSFNGVAPKRAEGDAFWQVPGDSSRYLWTETHPLDDLPRVTNPPGGFVQNSN
G7AC_PSEU7      MQVPTFNIVYADREGTINYSFNGVAPKRAEGDAFWQVPGDSSRYLWTETHPLDDLPRVTNPPGGFVQNSN
PVDQ_PSEPF      IQIPWVNTLAVDDKGQTLYMNLSVVPNVSTDDGSNSACAWDIDAAQKGIYASSQLPQLLRKDNDSAWLAN
PVDQ_PSEF5      LQIPWVNTLAVDDQGRALYMNQSVVP--------------------------------------------
PVDQ_PSEPK      ----------------------------------------------------------------------
PVDQ_PSEAE      LQIPWVNTLAADEQGNALYMNQSVVP--------------------------------------------
PVDQ_PSEU2      IQIPWVNTLAVDAQGQALYMNLSVVPVDAARLARCSDPGSRSECNWEGIYPSSRQPQLLSNDSAWMV--N
AAC_ACTUT       ----------------------------------------------------------------------
PVDQ_PSE14      IQIPWVNTLAVDAKGQALYMNLSVVPNVDAADGSRSECNWDISAEAAQIYPSSRQPQLLSNDSAWMV--N
PVDQ_PSESM      IQIPWVNTLAVDAKGQALYMNISVVP--------------------------------------------
CH602_MOOTA     ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           QAVVDSGYPHLLTTDWDYGYRSQRVVTLLEAAIADGGLTVEDMVDIQLDNENSGARALVPYLVEVDVXXX
QUIP_PSEAE      HRTVQPGYGAQLSNSWYYPERAERIAQL---AGASKSHDTQSMIRMQYDQDNPGLRQAIDALPEAQ-RSR
QUIP_PSE14      QRTIPKGYGMQLSNSWGYPERAERIAELANSGKQDLRSTVAMQYDFQAPGMSKPLKQAIDALPEAD-RNK
QUIP_PSEU2      QRTIPKGYGMQLSNSWGYPERAERI-----AELANGGQDLRSTIAMQYDQTTTFAAKLKPLKQAIDALPE
QUIP_PSESM      QRTIPKGYGMQLSNSWGYPERAERIAELANSGKQDLRSTVAMQYDFQAPGMSKPLKQAIDALPEAD-RNN
QUIP_PSEF5      QRVISQGYGMQLSNSWHAPERAERMAGLASSGKQDN----RSLIALQYDQSTLFAAKLQPLKQAIEALPD
QUIP_PSEPF      QRVIPHGYGMQLSNSWAAPERGERLAEL------------------------------------------
PAC2_PSES3      NRVVADDHPDYLCTDCHPPYRAERIMERLVXXXXXXXXXXXXXXXXTLSPHVGLLRARLEAL-GIQGSLP
QUIP_PSEPK      QRSLPRGYGMQLSSTWYYPERAERLAQL------------------------------------------
PAC_BACME       NKPSKEWVNGEYSFYWGEDNRVQQYINGMEAR---GKVTLEDINEINYTASFAQLRANLFKQLLIDV---
PAC_ARTVI       NK------PSKEWVNGEYSYEDNRVQQYINGMEARGKVTLEDINEINYTASFAQLRAFKPLLIDV-----
PAC_KLUCI       NS-PQKDYPDLFAFLWGGADRVTEIDTILD----------------------------------------
PAC_ECOLX       NS-PQKDYPDLFAFLWGGADRVTEIDRLLE---QKPRLTADQAWDVQTSRQDLNLRLFLPTL--------
G7AC_BREDI      DXXXXRDHPSYLAPQTPHSLRAQQSVRLMS---ENDDLTLERFMALQFSHRAVMADRTLPDLI-------
G7AC_PSEU7      DXXXXKDFPSYLAPQTPHSLRAQQSVRLMS---ENDDLTLERFMALQLSHRAVMADRTLPDLI-------
PVDQ_PSEPF      PAQPLTGFSPLISQDGQLGLRSRFALDRLATLSKKGLVSVQDLQHMVMDDQVFLATQVVPDLLK------
PVDQ_PSEF5      ----------------------------------------------------------------------
PVDQ_PSEPK      ----------------------------------------------------------------------
PVDQ_PSEAE      ----------------------------------------------------------------------
PVDQ_PSEU2      PAAPLQGFSPLISQDGQLGQRARFALDRLESLKTAGKISVENLQAMVMDNEVYQAGQVLPDLL-------
AAC_ACTUT       ----------------------------------------------------------------------
PVDQ_PSE14      PAAPLKGFSPLISQDGQLGQRARFALDRLGSLQQAGKVSAENLQAMVMDNEVYQAGQVLPDLLK------
PVDQ_PSESM      ----------------------------------------------------------------------
CH602_MOOTA     ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           XXXXXXXXXXWXXXXXXXXXXXXXYNATYRHLLPLVFDELGANPKIEASQAWLLLTSLVESPESEWWRGE
QUIP_PSEAE      AREAYDRLMAFDGKLTASSSDAALYGAFLHESARQIFDELGP----EDGPAWKAFVELLGRDDSPFWDDT
QUIP_PSE14      AREAFTRLMAFDGKLSATSADAALYELFLQESAKQIFDELGP----ETSPAWQALVALLGRDDSPYWDDV
QUIP_PSEU2      ADRNKAREAFTRLMAFDGKLSATSADAALYELFQIFLDELGP----ETSPAWQALVALLGRDDSPYWDDV
QUIP_PSESM      AREAFTRLMAFDGKLSATSADAALYELFLQESAKQIFDELGP----ETSPAWQALVALLGRDDSPYWDDV
QUIP_PSEF5      TERAKAREAYSRLLAFDGKVSAGSADAALYELFQIFLDKLGPESS-DAWQAFVANGNLSYSAQADHLLGQ
QUIP_PSEPF      ----------------------------------------------------------------------
PAC2_PSES3      AEELRQTLIAWDGRMDAGSQAASAYNAFRRALTRLVTARSGLEQAI--AHPFAAVPPGVSPQGQVWWAVP
QUIP_PSEPK      ---------------------------------------------------------LLGRDDSPFWDDR
PAC_BACME       ----------------------------------------------------------------------
PAC_ARTVI       ----------------------------------------------------------------------
PAC_KLUCI       ----------------------------------------------------------------------
PAC_ECOLX       ----------------------------------------------------------------------
G7AC_BREDI      ----------------------------------------------------------------------
G7AC_PSEU7      ----------------------------------------------------------------------
PVDQ_PSEPF      ----------------------------------------------------------------------
PVDQ_PSEF5      ----------------------------------------------------------------------
PVDQ_PSEPK      ----------------------------------------------------------------------
PVDQ_PSEAE      ----------------------------------------------------------------------
PVDQ_PSEU2      ----------------------------------------------------------------------
AAC_ACTUT       ----------------------------------------------------------------------
PVDQ_PSE14      ----------------------------------------------------------------------
PVDQ_PSESM      ----------------------------------------------------------------------
CH602_MOOTA     ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           EVSSRDEALRVAMERAAAELTELLGEDVAAWRWGDLHTLTVRNASFGESGIAAVEWLFNRGPVATGGGSS
QUIP_PSEAE      RTPQKEDAILARSLAAAVEFCERLGSERKAWQWGKLHTYEWQSDSAGEAGLGAIKGYLDRGPYPAGGDHT
QUIP_PSE14      KTPQKEDKPAILARSLAAAVTSLLGSDHKAWQWGKLHRDNWTSTSPLAKQLGGGE--FNRGASPAGGDHS
QUIP_PSEU2      KTPQKEDKPAILARSLAAAITSLLGSDHKAWQWGKLHRDNWASTSPLAKQLGGGE--FNRGATPTGGDHT
QUIP_PSESM      KTPQKEDKPAILARSLAAAVTSLLGSDHKAWQWGKLHRDNWTSANPLARQLGGGE--FNRSASAAGGDHT
QUIP_PSEF5      EDSPFWDDSRTAQKEDKPXXEQLLGADRKAWQWGKLHSYQWTNANGRQI----------RGPLQAGGDHN
QUIP_PSEPF      -----------------------LGGDRRAWQWGKLHRYEWKNAN-GQSV---------RGPIAAGGDHT
PAC2_PSES3      TLLRNDDAGMLSWDEALSEALSVATQNLTGRGWGEEHRPRFTHPLSAQ--FPAWAALLNPVSRPIGGDGD
QUIP_PSEPK      NTPQKEDSLAGAMEAGIAQL----GADRRTWQWGKLHQYRWPAPAYHGLGDA-----ISRSPLAAGGDFT
PAC_BACME       ----------------------------------------------------------------------
PAC_ARTVI       ----------------------------------------------------------------------
PAC_KLUCI       ----------------------------------------------------------------------
PAC_ECOLX       ----------------------------------------------------------------------
G7AC_BREDI      ----------------------------------------------------------------------
G7AC_PSEU7      ----------------------------------------------------------------------
PVDQ_PSEPF      ----------------------------------------------------------------------
PVDQ_PSEF5      ----------------------------------------------------------------------
PVDQ_PSEPK      ----------------------------------------------------------------------
PVDQ_PSEAE      ----------------------------------------------------------------------
PVDQ_PSEU2      ----------------------------------------------------------------------
AAC_ACTUT       ----------------------------------------------------------------------
PVDQ_PSE14      ----------------------------------------------------------------------
PVDQ_PSESM      ----------------------------------------------------------------------
CH602_MOOTA     -----------------------------------------------EDALAATRAAVEEG-IVPGGGTA


                         .         .         *         .         .         .         .:840
query           VVNATGWDPAQGYEVTTVPSMRMVVDLADVDNSQWINLTGNSGHAFHPHYADQLELWAAGTMLPMRMTRS
QUIP_PSEAE      TLDVSAYGWGQDFDTWLIPAMRLIVDFGQSEPMIGVNSSGQSGNPASPHYADGIDAWLKG----------
QUIP_PSE14      TLNVSGFEWGKGFDTHVAPGLRMIVDFSLVEPMTGLISTGQSGNPASPYYANSIEPWQKGQYMSIPLQQQ
QUIP_PSEU2      TLNVSGFEWGKGFDARMAPGLRMIVDFSLVEPMTGLISTGQSGNPASPYYANSIEPWQKG----------
QUIP_PSESM      TLNVSGFEWGKGFDARVAPSLRMIVDFSLVEPMTGMINTGQSGNPASPYYANSIEPWQKGQYMSIPLQQQ
QUIP_PSEF5      TINSAAYRWGQDFAITDTPALRLIVDFSLSEPLMGLNSSGQSGNPVSPNYANGIDGWLKAQYLSLPM---
QUIP_PSEPF      TLNTAAFAWGQDFNTTRAPSMRFIVDFGQSEPLMGQNGTGQSGNPVSPNYLNGIDPWLKGQYIGLPM---
PAC2_PSES3      TVLANGLVPSAGPEATYGALSRYVFDVGNWDNSRWVVFHGASGHPASPHYADQNAPWSDCAMVPMLYSRI
QUIP_PSEPK      TLALTPFAWGSDFDTHLPASARMIVDFGQAEPLQILTSSGQSGNPASAHYRDGLDAWFKGRFMSL-----
PAC_BACME       ----------------------------------------------------------------------
PAC_ARTVI       ----------------------------------------------------------------------
PAC_KLUCI       ----------------------------------------------------------------------
PAC_ECOLX       ----------------------------------------------------------------------
G7AC_BREDI      ----------------------------------------------------------------------
G7AC_PSEU7      ----------------------------------------------------------------------
PVDQ_PSEPF      ----------------------------------------------------------------------
PVDQ_PSEF5      ----------------------------------------------------------------------
PVDQ_PSEPK      ----------------------------------------------------------------------
PVDQ_PSEAE      ----------------------------------------------------------------------
PVDQ_PSEU2      ----------------------------------------------------------------------
AAC_ACTUT       ----------------------------------------------------------------------
PVDQ_PSE14      ----------------------------------------------------------------------
PVDQ_PSESM      ----------------------------------------------------------------------
CH602_MOOTA     LVRATALDQAQGDELTGVEPMRQIAANAGVDGSVVVEKVRQSGDSFNAATREYVNLFEAGIVDPLKVTRS


                         +         .         .         .         .         *         .:910
query           AVEEAAEHTLVLRP
QUIP_PSEAE      --------------
QUIP_PSE14      NYEKGGKQRLTLTP
QUIP_PSEU2      --------------
QUIP_PSESM      NYEKGGKQRLTLTP
QUIP_PSEF5      --------------
QUIP_PSEPF      --------------
PAC2_PSES3      AAEAVTSQELV---
QUIP_PSEPK      --------------
PAC_BACME       --------------
PAC_ARTVI       --------------
PAC_KLUCI       --------------
PAC_ECOLX       --------------
G7AC_BREDI      --------------
G7AC_PSEU7      --------------
PVDQ_PSEPF      --------------
PVDQ_PSEF5      --------------
PVDQ_PSEPK      --------------
PVDQ_PSEAE      --------------
PVDQ_PSEU2      --------------
AAC_ACTUT       --------------
PVDQ_PSE14      --------------
PVDQ_PSESM      --------------
CH602_MOOTA     ALENAA--------