[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ55822.1

[Show Plain Result]


## Summary of Sequence Search
    1::239
   41::180     1e-09  26%  229 aa  DGOR_ECOLI RecName: Full=Galactonate operon transcriptional
   66::249     9e-09  27%  263 aa  NANR_SALTY RecName: Full=Transcriptional regulator nanR;
   66::249     9e-09  27%  263 aa  NANR_SALTI RecName: Full=Transcriptional regulator nanR;
   66::249     9e-09  27%  263 aa  NANR_SALPK RecName: Full=Transcriptional regulator nanR;
   66::249     9e-09  27%  263 aa  NANR_SALPC RecName: Full=Transcriptional regulator nanR;
   66::249     9e-09  27%  263 aa  NANR_SALPA RecName: Full=Transcriptional regulator nanR;
   66::249     9e-09  27%  263 aa  NANR_SALG2 RecName: Full=Transcriptional regulator nanR;
   66::249     9e-09  27%  263 aa  NANR_SALEP RecName: Full=Transcriptional regulator nanR;
   66::249     9e-09  27%  263 aa  NANR_SALCH RecName: Full=Transcriptional regulator nanR;
   66::249     9e-09  27%  263 aa  NANR_SALAR RecName: Full=Transcriptional regulator nanR;
   25::119     3e-08  36%  219 aa  LUTR_BACSU RecName: Full=HTH-type transcriptional regulator
   45::233     6e-08  25%  254 aa  PDHR_SALTY RecName: Full=Pyruvate dehydrogenase complex repressor;
   45::233     6e-08  25%  254 aa  PDHR_SALTI RecName: Full=Pyruvate dehydrogenase complex repressor;
   45::224     8e-08  25%  254 aa  PDHR_ECOLI RecName: Full=Pyruvate dehydrogenase complex repressor;
   45::224     8e-08  25%  254 aa  PDHR_ECOL6 RecName: Full=Pyruvate dehydrogenase complex repressor;
   45::224     8e-08  25%  254 aa  PDHR_ECO57 RecName: Full=Pyruvate dehydrogenase complex repressor;
   53::228     2e-07  26%  233 aa  YCBG_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   44::232     2e-07  24%  257 aa  UXUR_ECOLI RecName: Full=Uxu operon transcriptional regulator;
   46::222     4e-06  33%  240 aa  Y601_MYCBO RecName: Full=Uncharacterized HTH-type transcriptional
   46::222     4e-06  33%  240 aa  Y586_MYCTU RecName: Full=Uncharacterized HTH-type transcriptional
   53::227     4e-06  28%  243 aa  GNTR_BACLI RecName: Full=Gluconate operon transcriptional
   53::222     6e-06  27%  243 aa  GNTR_BACSU RecName: Full=Gluconate operon transcriptional
   44::232     6e-06  25%  254 aa  GLCC_ECOLI RecName: Full=Glc operon transcriptional activator;
   44::232     6e-06  25%  254 aa  GLCC_ECOL6 RecName: Full=Glc operon transcriptional activator;
   43::232     2e-05  24%  259 aa  EXUR_ERWCH RecName: Full=Exu regulon transcriptional regulator;
   43::219     5e-05  25%  258 aa  EXUR_SHIFL RecName: Full=Exu regulon transcriptional regulator;
   43::219     5e-05  25%  258 aa  EXUR_ECOLI RecName: Full=Exu regulon transcriptional regulator;
   43::219     5e-05  25%  258 aa  EXUR_ECO57 RecName: Full=Exu regulon transcriptional regulator;
   49::223     6e-05  28%  230 aa  YIEP_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
   43::163     1e-04  22%  258 aa  LLDR_SHIFL RecName: Full=Putative L-lactate dehydrogenase operon
   43::163     1e-04  22%  258 aa  LLDR_ECOLI RecName: Full=Putative L-lactate dehydrogenase operon
   43::210     3e-04  28%  236 aa  YIN1_STRAM RecName: Full=Uncharacterized HTH-type transcriptional
   46::214     3e-04  27%  228 aa  YDFH_SHIFL RecName: Full=Uncharacterized HTH-type transcriptional
   46::214     3e-04  27%  228 aa  YDFH_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
   46::214     3e-04  27%  228 aa  YDFH_ECOL6 RecName: Full=Uncharacterized HTH-type transcriptional
   46::214     3e-04  27%  228 aa  YDFH_ECO57 RecName: Full=Uncharacterized HTH-type transcriptional
   24::120     5e-04  30%  210 aa  NTRA_CHEHE RecName: Full=Nta operon transcriptional regulator;
   22::78      7e-04  32%  243 aa  YVOA_BACSU RecName: Full=HTH-type transcriptional repressor yvoA;
    1::239

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxQVVRGELAVDXXXXXXXXXXXXXDVSRLTVREAVKVLRTKNIVRVKRGRGTYVN
DGOR_ECOLI      -----------------------------------------SRNIIREVFRSLMAKRLIEMKRYRGAFVA
NANR_SALTY      ---------------------------------------NVGRPSVREALAALKRKGLVQINNGERARVS
NANR_SALTI      ---------------------------------------NVGRPSVREALAALKRKGLVQINNGERARVS
NANR_SALPK      ---------------------------------------NVGRPSVREALAALKRKGLVQINNGERARVS
NANR_SALPC      ---------------------------------------NVGRPSVREALAALKRKGLVQINNGERARVS
NANR_SALPA      ---------------------------------------NVGRPSVREALAALKRKGLVQINNGERARVS
NANR_SALG2      ---------------------------------------NVGRPSVREALAALKRKGLVQINNGERARVS
NANR_SALEP      ---------------------------------------NVGRPSVREALAALKRKGLVQINNGERARVS
NANR_SALCH      ---------------------------------------NVGRPSVREALAALKRKGLVQINNGERARVS
NANR_SALAR      ---------------------------------------NVGRPSVREALAALKRKGLVQINNGERARVS
LUTR_BACSU      ----------------------------------------VSRSAVREALSALKAMGLVEMKQGEGTYLK
PDHR_SALTY      ---------------------------------------DVSRPSLREAIQRLEAKGLLLRRQGGGTFVQ
PDHR_SALTI      ---------------------------------------DVSRPSLREAIQRLEAKGLLLRRQGGGTFVQ
PDHR_ECOLI      ---------------------------------------DVSRPSLREAIQRLEAKGLLLRRQGGGTFVQ
PDHR_ECOL6      ---------------------------------------DVSRPSLREAIQRLEAKGLLLRRQGGGTFVQ
PDHR_ECO57      ---------------------------------------DVSRPSLREAIQRLEAKGLLLRRQGGGTFVQ
YCBG_BACSU      ----------------------------------------VSRPVLREALSSLETLGVITRKTRGGTYFN
UXUR_ECOLI      ---------------------------------------DVTRTVVREALIMLEIKGLVEVRRGAGIYVN
Y601_MYCBO      ----------------------------------------VSRPAVREALKRLSAAGLVEVRQGDVTTVR
Y586_MYCTU      ----------------------------------------VSRPAVREALKRLSAAGLVEVRQGDVTTVR
GNTR_BACLI      ----------------------------------------VSRSPIREALKILASEKIIRLERMGAVVIG
GNTR_BACSU      ----------------------------------------VSRSPVREALKILASEKIIRLERMGAVVIG
GLCC_ECOLI      -----------------------------------------SRSALREGLTVLRGRGIIETAQGRDSRVA
GLCC_ECOL6      -----------------------------------------SRSALREGLTVLRGRGIIETAQGRDSRVA
EXUR_ERWCH      ---------------------------------------NVSRTVVREAIIMLEVEGYVEVRKGSGIHVN
EXUR_SHIFL      ---------------------------------------NVSRTVVREAIIMLEVEGYVEVRKGSGIHVN
EXUR_ECOLI      ---------------------------------------NVSRTVVREAIIMLEVEGYVEVRKGSGIHVN
EXUR_ECO57      ---------------------------------------NVSRTVVREAIIMLEVEGYVEVRKGSGIHVN
YIEP_ECOLI      ----------------------------------------VSRTAVREAVKTLTAKGMVLPRPRIGTRVM
LLDR_SHIFL      ----------------------------------------VSRNSLREALAKLVSEGVLLSRRGGGTFIR
LLDR_ECOLI      ----------------------------------------VSRNSLREALAKLVSEGVLLSRRGGGTFIR
YIN1_STRAM      ----------------------------------------VSRTPVRESLILLAQEGLVQVFPKIGSFVS
YDFH_SHIFL      ---------------------------------------NVSRQPVREAFIKLAENGLIQIRPQRGSYVN
YDFH_ECOLI      ---------------------------------------NVSRQPVREAFIKLAENGLIQIRPQRGSYVN
YDFH_ECOL6      ---------------------------------------NVSRQPVREAFIKLAENGLIQIRPQRGSYVN
YDFH_ECO57      ---------------------------------------NVSRQPVREAFIKLAENGLIQIRPQRGSYVN
NTRA_CHEHE      ----------------------------------------VSRTPLREALNRLTTEGFLTTTANKGFFAR
YVOA_BACSU      ----------------QIKNGELQPDMPLPSEREYAEQFGISRMTVRQALSNLVNEGLLYRLKGRGTFVS


                         .         .         *         .         .         .         .:140
query           APEHWTDLELILRMAQRRSXXXXXXXXXXEVRRILEAGAAELCAQRRSDADLALLTTHVAEMDKAIAADD
DGOR_ECOLI      PRNQWNYLDTVLQWVLENDYDPRLISAMSEVRNLVEPAIARWAAERATSSDLAQIESALNEM--IANNQD
NANR_SALTY      RPSADTIISELSGMAKDFLTHPGGIAHFEQLRLFFESSLVRYAAEHATDEQIALLTKALEINSQSL--DD
NANR_SALTI      RPSADTIISELSGMAKDFLTHPGGIAHFEQLRLFFESSLVRYAAEHATDEQIALLTKALEINSQSL--DD
NANR_SALPK      RPSADTIISELSGMAKDFLTHPGGIAHFEQLRLFFESSLVRYAAEHATDEQIALLTKALEINSQSL--DD
NANR_SALPC      RPSADTIISELSGMAKDFLTHPGGIAHFEQLRLFFESSLVRYAAEHATDEQIALLTKALEINSQSL--DD
NANR_SALPA      RPSADTIISELSGMAKDFLTHPGGIAHFEQLRLFFESSLVRYAAEHATDEQIALLTKALEINSQSL--DD
NANR_SALG2      RPSADTIISELSGMAKDFLTHPGGIAHFEQLRLFFESSLVRYAAEHATDEQIALLTKALEINSQSL--DD
NANR_SALEP      RPSADTIISELSGMAKDFLTHPGGIAHFEQLRLFFESSLVRYAAEHATDEQIALLTKALEINSQSL--DD
NANR_SALCH      RPSADTIISELSGMAKDFLTHPGGIAHFEQLRLFFESSLVRYAAEHATDEQIALLTKALEINSQSL--DD
NANR_SALAR      RPSADTIISELSGMAKDFLTHPGGIAHFEQLRLFFESSLVRYAAEHATDEQIALLTKALEINSQSL--DD
LUTR_BACSU      EFENQISQPLSAALLMKKEDVKQLL----EVRKLLEIGVASLAAEKRTEADLERIQDALKEMG-SIEAD-
PDHR_SALTY      SSQSFSD-----PLVELLSDHPESQFDLLETRHALEGIAAYYAALRSTDEDKDRIRELHHAIELAQESGD
PDHR_SALTI      SSQSFSD-----PLVELLSDHPESQFDLLETRHALEGIAAYYAALRSTDEDKDRIRELHHAIELAQESGD
PDHR_ECOLI      SSQSFSD-----PLVELLSDHPESQYDLLETRHALEGIAAYYAALRSTDEDKERIRELHHAIELAQQSGD
PDHR_ECOL6      SSQSFSD-----PLVELLSDHPESQYDLLETRHALEGIAAYYAALRSTDEDKERIRELHHAIELAQQSGD
PDHR_ECO57      SSQSFSD-----PLVELLSDHPESQYDLLETRHALEGIAAYYAALRSTDEDKERIRELHHAIELAQQSGD
YCBG_BACSU      DKIGMQPFSVMLALA------TDNLPAIIEARMALELGLVTIAAEKINEEELQRLQKTIDD----IANST
UXUR_ECOLI      SGSQNTD------SPDANVCNDAGPFELLQARQLLESNIAEFAALQATREDIVKMRQALQLEERELASSA
Y601_MYCBO      DFRRHAGLDLLPRLLFRNGELDISV-----VRSILEAKVAELAAERNEPELAELLQDSLRALD---TEED
Y586_MYCTU      DFRRHAGLDLLPRLLFRNGELDISV-----VRSILEAKVAELAAERNEPELAELLQDSLRALD---TEED
GNTR_BACLI      LTEK-------------------EIGEIYDVRLVMETFVFERLGRANVDELVTDLSKILEMMKVSIKYKD
GNTR_BACSU      LTEK--------KIAE-----------IYDVRLLLETFVFERLVKIDIEPLVKDLSKILEMMKVSIKYED
GLCC_ECOLI      RLNRVQDTSPLIHLF---STQPRTLYDLLDVRALLEGESARLAATLGTQADFVVITRC---YEKMLAASE
GLCC_ECOL6      RLNRVQDTSPLIHLF---STQPRTLYDLLDVRALLEGESARLAATLGTQADFVVITRC---YEKMLAASE
EXUR_ERWCH      QQRH-----LLAANGSDADFLTAGPFELLQARQLIESNIAEFAATQVTRQDIIQL----MEIQENARQED
EXUR_SHIFL      QPRHQQAADNNMEFAN------YGPFELLQARQLIESNIAEFAATQVTKQDIMKLMA----IQEQARGEQ
EXUR_ECOLI      QPRHQQAADNNMEFAN------YGPFELLQARQLIESNIAEFAATQVTKQDIMKLMA----IQEQARGEQ
EXUR_ECO57      QPRHQQAADNNMEFAN------YGPFELLQARQLIESNIAEFAATQVTKQDIMKLMA----IQEQARGEQ
YIEP_ECOLI      PQSNWNFLDQLLTWWMTEENFHQVIDHFLVMRICLEPQACLLAATVGTAEQKAHLNTLMAEMAALKENFR
LLDR_SHIFL      RHDTWSEQNIVQPLKTLMADDPDYSFDILEARYAIEASTAWHAAMRATPGD----KEKIQLCFEATLSED
LLDR_ECOLI      RHDTWSEQNIVQPLKTLMADDPDYSFDILEARYAIEASTAWHAAMRATPGD----KEKIQLCFEATLSED
YIN1_STRAM      RPARVADAQFL--------------------REAVELGSLDALPAELDPAVVGELRDNLVRQGRKDL--D
YDFH_SHIFL      K----------ISMAQVRNGSF--------IRQAIECAVARRAASMITESQCYQLEQNLHQQRIAIERKQ
YDFH_ECOLI      K----------ISMAQVRNGSF--------IRQAIECAVARRAASMITESQCYQLEQNLHQQRIAIERKQ
YDFH_ECOL6      K----------ISMAQVRNGSF--------IRQAIECAVARRAASMITESQCYQLEQNLHQQRIAIERKQ
YDFH_ECO57      K----------ISMAQVRNGSF--------IRQAIECAVARRAASMITESQCYQLEQNLHQQRIAIERKQ
NTRA_CHEHE      VLEANTLFDLY------------------ELRAFLEQSAVRLACQRATDQEIAVLRDFLLEQDES-GEIS
YVOA_BACSU      KPK-------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ASTFARAETAFHETIVRSCGNVFIPAICAPVDRLLLHLHARTATIAHIRVRAQSHHRRILSGIAAGSPAA
DGOR_ECOLI      REAFNEADIRYHEAVLQSVHNPVLQQLSIAISSLQRAVFERT----------------------------
NANR_SALTY      NALFIRSDVEFHRVLAEIPGNIFMAIHVALLDWLILHEHNNVSYQQHI---------VIVDAIRQRDPDK
NANR_SALTI      NALFIRSDVEFHRVLAEIPGNIFMAIHVALLDWLILHEHNNVSYQQHI---------VIVDAIRQRDPDK
NANR_SALPK      NALFIRSDVEFHRVLAEIPGNIFMAIHVALLDWLILHEHNNVSYQQHI---------VIVDAIRQRDPDK
NANR_SALPC      NALFIRSDVEFHRVLAEIPGNIFMAIHVALLDWLILHEHNNVSYQQHI---------VIVDAIRQRDPDK
NANR_SALPA      NALFIRSDVEFHRVLAEIPGNIFMAIHVALLDWLILHEHNNVSYQQHI---------VIVDAIRQRDPDK
NANR_SALG2      NALFIRSDVEFHRVLAEIPGNIFMAIHVALLDWLILHEHNNVSYQQHI---------VIVDAIRQRDPDK
NANR_SALEP      NALFIRSDVEFHRVLAEIPGNIFMAIHVALLDWLILHEHNNVSYQQHI---------VIVDAIRQRDPDK
NANR_SALCH      NALFIRSDVEFHRVLAEIPGNIFMAIHVALLDWLILHEHNNVSYQQHI---------VIVDAIRQRDPDK
NANR_SALAR      NALFIRSDVEFHRVLAEIPGNIFMAIHVALLDWLILHEHNNVSYQQHI---------VIVDAIRQRDPDK
LUTR_BACSU      ----------------------------------------------------------------------
PDHR_SALTY      LDAESEAVLQYQIAVTEAAHNVVLLHLLRCMEPMLAQNVRQNFELLYARREVSTHRTRIFEAIMAGKPEE
PDHR_SALTI      LDAESEAVLQYQIAVTEAAHNVVLLHLLRCMEPMLAQNVRQNFELLYARREVSTHRTRIFEAIMAGKPEE
PDHR_ECOLI      LDAESNAVLQYQIAVTEAAHNVVLLHLLRCMEPMLAQNVRQNFELLYSRREVSSHRTRIFEAIMAGKPEE
PDHR_ECOL6      LDAESNAVLQYQIAVTEAAHNVVLLHLLRCMEPMLAQNVRQNFELLYSRREVSSHRTRIFEAIMAGKPEE
PDHR_ECO57      LDAESNAVLQYQIAVTEAAHNVVLLHLLRCMEPMLAQNVRQNFELLYSRREVSSHRTRIFEAIMAGKPEE
YCBG_BACSU      DNHYGEADKEFHRIIALSANN---PVVEGMIQSLLI-THAKIDSQIPYRERTVEYHKKIYDALAKRDPYK
UXUR_ECOLI      PGSSESGDMQFHLAIAEATHNSMLVELFRQSNPMWIQLHSHLDDSLY-RKEWLGDHKQILAALIKKDARA
Y601_MYCBO      PIVWQRHTLDFWDHVVDSAGSI--------VDRLMYNAFRAAXXXXXXXXKRPSDYRKLADAICSGDPTG
Y586_MYCTU      PIVWQRHTLDFWDHVVDSAGSI--------VDRLMYNAFRAAXXXXXXXXKRPSDYRKLADAICSGDPTG
GNTR_BACLI      ADEFSFQDVLFHETIVRSINHSYILMILKPVSFILLSMRARLKEKYEDFERILDNHELYIKAIKTKDRDL
GNTR_BACSU      ADEFSFQDVLFHETIIRAIDHSYIQMILKPVSFILLSMRVRLKEKYEDFTRILDNHELYIQAIKTKDRAL
GLCC_ECOLI      NNEHAQLDHAFHLAICQASHNVLVFTLQSLTDLMFNSVFASVNNLYHQKKQIDRQHARIYNAVLQRLPHV
GLCC_ECOL6      NNEHAQLDHAFHLAICQASHNVLVFTLQSLTDLMFNSVFASVNNLYHQKKQIDRQHARIYNAVLQRLPHV
EXUR_ERWCH      RFRDSEWDLKFHVQVALATQNSAMATIVEKMWSQRIHNPYWRKLHEHIDDKSCEDHDQILKALIRKDPYA
EXUR_SHIFL      CFRDSEWDLQFHIQVALATQNSALAAIVEKMWTQRSHNPYWKKLHEHIDSRTVDNHDQILKALIRKDPHA
EXUR_ECOLI      CFRDSEWDLQFHIQVALATQNSALAAIVEKMWTQRSHNPYWKKLHEHIDSRTVDNHDQILKALIRKDPHA
EXUR_ECO57      CFRDSEWDLQFHIQVALATQNSALAAIVEKMWTQRSHNPYWKKLHEHIDSRTVDNHDQILKALIRKDPHA
YIEP_ECOLI      RERWIEVDMAWHEHIYEMSANPFLTSFAS-----LFHYHTYFTSITSDTVIKLDLHQAIVDAIIQSDGDA
LLDR_SHIFL      PDIASQADVRFHLAIAEASHNIVL----------------------------------------------
LLDR_ECOLI      PDIASQADVRFHLAIAEASHNIVL----------------------------------------------
YIN1_STRAM      LEEFFGLDEAFHQGLMRGHGNVWVAAAKGHLDRARLGLHENVSPAVFV-----AQHREIFDAVTEGDVPL
YDFH_SHIFL      LDDFFELDDNFHQTQIADCQLAWIENLKATVDRV------RYMSFDHVSPPEMRQHLDIFSALQKRDGDA
YDFH_ECOLI      LDDFFELDDNFHQTQIADCQLAWIENLKATVDRV------RYMSFDHVSPPEMRQHLDIFSALQKRDGDA
YDFH_ECOL6      LDDFFELDDNFHQTQIADCQLAWIENLKATVDRV------RYMSFDHVSPPEMRQHLDIFSALQKRDGDA
YDFH_ECO57      LDDFFELDDNFHQTQIADCQLAWIENLKATVDRV------RYMSFDHVSPPEMRQHLDIFSALQKRDGDA
NTRA_CHEHE      AGEMLKLDEEFHFRLV------------------------------------------------------
YVOA_BACSU      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ARDAMRAHFDQLAEDLLRHVVDxxxxxxx
DGOR_ECOLI      -----------------------------
NANR_SALTY      ADRALQTHLNSVS----------------
NANR_SALTI      ADRALQTHLNSVS----------------
NANR_SALPK      ADRALQTHLNSVS----------------
NANR_SALPC      ADRALQTHLNSVS----------------
NANR_SALPA      ADRALQTHLNSVS----------------
NANR_SALG2      ADRALQTHLNSVS----------------
NANR_SALEP      ADRALQTHLNSVS----------------
NANR_SALCH      ADRALQTHLNSVS----------------
NANR_SALAR      ADRALQTHLNSVS----------------
LUTR_BACSU      -----------------------------
PDHR_SALTY      AREASHRHLAFIEEIML------------
PDHR_SALTI      AREASHRHLAFIEEIML------------
PDHR_ECOLI      AREASHRH---------------------
PDHR_ECOL6      AREASHRH---------------------
PDHR_ECO57      AREASHRH---------------------
YCBG_BACSU      AHYHMYEHLKFVRDKILK-----------
UXUR_ECOLI      AKLAMWQHLENVKQRLL------------
Y601_MYCBO      AKKA--------AQDLL------------
Y586_MYCTU      AKKA--------AQDLL------------
GNTR_BACLI      MLKSLHQNFDDVVEDL-------------
GNTR_BACSU      MIQSLHQNFDDVQD---------------
GLCC_ECOLI      AQRAARDHVRTVKKNL-------------
GLCC_ECOL6      AQRAARDHVRTVKKNL-------------
EXUR_ERWCH      AKLAMWQHLENTKQMLFRATTD-------
EXUR_SHIFL      AKLAMWQHLE-------------------
EXUR_ECOLI      AKLAMWQHLE-------------------
EXUR_ECO57      AKLAMWQHLE-------------------
YIEP_ECOLI      AFKACQA----------------------
LLDR_SHIFL      -----------------------------
LLDR_ECOLI      -----------------------------
YIN1_STRAM      ARTAMRTHLRAVFDDIER-----------
YDFH_SHIFL      VERAMTQHLQEISESV-------------
YDFH_ECOLI      VERAMTQHLQEISESV-------------
YDFH_ECOL6      VERAMTQHLQEISESV-------------
YDFH_ECO57      VERAMTQHLQEISESV-------------
NTRA_CHEHE      -----------------------------
YVOA_BACSU      -----------------------------