[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ55924.1

[Show Plain Result]


## Summary of Sequence Search
    1::707
   19::718       0.0  64%  721 aa  GLGX_MYCTU RecName: Full=Glycogen operon protein glgX homolog;     
   19::718       0.0  64%  721 aa  GLGX_MYCBO RecName: Full=Glycogen operon protein glgX homolog;     
    1::629     e-170  50%  657 aa  GLGX_ENT38 RecName: Full=Glycogen debranching enzyme;       
    1::646     e-168  49%  661 aa  GLGX_SERP5 RecName: Full=Glycogen debranching enzyme;       
    1::629     e-167  49%  657 aa  GLGX_SHIDS RecName: Full=Glycogen debranching enzyme;       
    1::629     e-167  49%  657 aa  GLGX_ECO81 RecName: Full=Glycogen debranching enzyme;       
    1::629     e-167  49%  657 aa  GLGX_SHIBS RecName: Full=Glycogen debranching enzyme;       
    1::629     e-167  49%  657 aa  GLGX_ECOLU RecName: Full=Glycogen debranching enzyme;       
    1::629     e-167  49%  657 aa  GLGX_ECOLI RecName: Full=Glycogen debranching enzyme;       
    1::629     e-167  49%  657 aa  GLGX_ECODH RecName: Full=Glycogen debranching enzyme;       
    1::629     e-167  49%  657 aa  GLGX_ECOBW RecName: Full=Glycogen debranching enzyme;       
    1::629     e-167  49%  657 aa  GLGX_ECO8A RecName: Full=Glycogen debranching enzyme;       
    1::629     e-167  49%  657 aa  GLGX_ECO5E RecName: Full=Glycogen debranching enzyme;       
    1::629     e-167  49%  657 aa  GLGX_ECO57 RecName: Full=Glycogen debranching enzyme;       
    1::629     e-167  49%  657 aa  GLGX_ECO7I RecName: Full=Glycogen debranching enzyme;       
    1::629     e-167  49%  657 aa  GLGX_SHIB3 RecName: Full=Glycogen debranching enzyme;       
    7::629     e-167  49%  657 aa  GLGX_ECOSE RecName: Full=Glycogen debranching enzyme;       
    1::629     e-167  49%  657 aa  GLGX_ECOLC RecName: Full=Glycogen debranching enzyme;       
    1::629     e-167  49%  657 aa  GLGX_ECOHS RecName: Full=Glycogen debranching enzyme;       
    1::629     e-167  49%  657 aa  GLGX_ECO27 RecName: Full=Glycogen debranching enzyme;       
    1::603     e-167  49%  658 aa  GLGX_ERWT9 RecName: Full=Glycogen debranching enzyme;       
    1::629     e-167  49%  657 aa  GLGX_ECO55 RecName: Full=Glycogen debranching enzyme;       
    1::629     e-166  49%  657 aa  GLGX_ECO24 RecName: Full=Glycogen debranching enzyme;       
    1::629     e-166  49%  657 aa  GLGX_SHIFL RecName: Full=Glycogen debranching enzyme;       
    1::629     e-166  49%  657 aa  GLGX_SHIF8 RecName: Full=Glycogen debranching enzyme;       
    1::629     e-166  49%  657 aa  GLGX_ECOSM RecName: Full=Glycogen debranching enzyme;       
    1::629     e-166  49%  657 aa  GLGX_ECOL5 RecName: Full=Glycogen debranching enzyme;       
    1::629     e-166  49%  657 aa  GLGX_ECOL6 RecName: Full=Glycogen debranching enzyme;       
    1::629     e-166  49%  657 aa  GLGX_ECOUT RecName: Full=Glycogen debranching enzyme;       
    1::629     e-166  49%  657 aa  GLGX_ECOK1 RecName: Full=Glycogen debranching enzyme;       
    1::629     e-166  49%  657 aa  GLGX_ECO45 RecName: Full=Glycogen debranching enzyme;       
    7::629     e-165  49%  657 aa  GLGX_SHISS RecName: Full=Glycogen debranching enzyme;       
    1::629     e-164  48%  658 aa  GLGX_ESCF3 RecName: Full=Glycogen debranching enzyme;       
    1::629     e-164  49%  658 aa  GLGX_KLEP7 RecName: Full=Glycogen debranching enzyme;       
    1::629     e-164  49%  658 aa  GLGX_KLEP3 RecName: Full=Glycogen debranching enzyme;       
    1::629     e-163  48%  658 aa  GLGX_SALPB RecName: Full=Glycogen debranching enzyme;       
    1::629     e-163  48%  658 aa  GLGX_SALPK RecName: Full=Glycogen debranching enzyme;       
    1::629     e-163  48%  658 aa  GLGX_SALPA RecName: Full=Glycogen debranching enzyme;       
    1::629     e-163  48%  658 aa  GLGX_SALTY RecName: Full=Glycogen debranching enzyme;       
    1::629     e-163  48%  658 aa  GLGX_SALPC RecName: Full=Glycogen debranching enzyme;       
    1::629     e-163  48%  658 aa  GLGX_SALNS RecName: Full=Glycogen debranching enzyme;       
    1::629     e-163  48%  658 aa  GLGX_SALHS RecName: Full=Glycogen debranching enzyme;       
    1::629     e-163  48%  658 aa  GLGX_SALDC RecName: Full=Glycogen debranching enzyme;       
    1::629     e-163  48%  658 aa  GLGX_SALCH RecName: Full=Glycogen debranching enzyme;       
    1::629     e-163  47%  658 aa  GLGX_SALSV RecName: Full=Glycogen debranching enzyme;       
    1::629     e-163  48%  658 aa  GLGX_SALEP RecName: Full=Glycogen debranching enzyme;       
    1::629     e-163  47%  658 aa  GLGX_SALA4 RecName: Full=Glycogen debranching enzyme;       
    1::629     e-163  47%  654 aa  GLGX_SALTI RecName: Full=Glycogen debranching enzyme;       
    1::597     e-162  49%  662 aa  GLGX_YERE8 RecName: Full=Glycogen debranching enzyme;       
    1::629     e-162  47%  658 aa  GLGX_SALG2 RecName: Full=Glycogen debranching enzyme;       
    1::629     e-162  47%  657 aa  GLGX_CITK8 RecName: Full=Glycogen debranching enzyme;       
    1::622     e-161  49%  658 aa  GLGX_PECCP RecName: Full=Glycogen debranching enzyme;       
    7::597     e-161  49%  662 aa  GLGX_YERPB RecName: Full=Glycogen debranching enzyme;       
    7::597     e-160  49%  662 aa  GLGX_YERPY RecName: Full=Glycogen debranching enzyme;       
    7::597     e-160  49%  662 aa  GLGX_YERPS RecName: Full=Glycogen debranching enzyme;       
    1::622     e-160  48%  658 aa  GLGX_ERWCT RecName: Full=Glycogen debranching enzyme;       
    1::606     e-160  48%  660 aa  GLGX_ENTS8 RecName: Full=Glycogen debranching enzyme;       
    7::597     e-160  49%  662 aa  GLGX_YERP3 RecName: Full=Glycogen debranching enzyme;       
    7::597     e-160  49%  662 aa  GLGX_YERPG RecName: Full=Glycogen debranching enzyme;       
    7::597     e-160  49%  662 aa  GLGX_YERPP RecName: Full=Glycogen debranching enzyme;       
    7::597     e-160  49%  662 aa  GLGX_YERPN RecName: Full=Glycogen debranching enzyme;       
    7::597     e-160  49%  662 aa  GLGX_YERPE RecName: Full=Glycogen debranching enzyme;       
    7::597     e-160  49%  662 aa  GLGX_YERPA RecName: Full=Glycogen debranching enzyme;       
    1::541     e-153  50%  657 aa  GLGX_ERWCH RecName: Full=Glycogen debranching enzyme;       
   26::626     e-137  46%  659 aa  GLGX_HAEIN RecName: Full=Glycogen operon protein glgX homolog;     
   82::636     e-113  47%  764 aa  ISOA3_ARATH RecName: Full=Isoamylase 3, chloroplastic;       
   76::652     e-112  44%  783 aa  ISOA1_ARATH RecName: Full=Isoamylase 1, chloroplastic;       
   36::739     8e-87  38%  777 aa  ISOA_FLASP RecName: Full=Isoamylase;         EC=3.2.1.68;Flags:
   23::756     9e-86  36%  776 aa  ISOA_PSEUM RecName: Full=Isoamylase;         EC=3.2.1.68;Flags:
   23::756     9e-86  36%  776 aa  ISOA_PSEAY RecName: Full=Isoamylase;         EC=3.2.1.68;Flags:
  230::710     9e-71  39%  882 aa  ISOA2_ARATH RecName: Full=Isoamylase 2, chloroplastic;       
  212::741     8e-37  32%  843 aa  PULA_THEMA RecName: Full=Pullulanase;         EC=3.2.1.41;AltName:
  151::609     1e-28  32%  718 aa  PULA_BACSU RecName: Full=Pullulanase;         EC=3.2.1.41;AltName:
  207::594     9e-23  33%  965 aa  PULA1_ARATH RecName: Full=Pullulanase 1, chloroplastic;       
  553::916     2e-19  30% 1090 aa  PULA_KLEPN RecName: Full=Pullulanase;         EC=3.2.1.41;AltName:
  563::926     1e-18  29% 1096 aa  PULA_KLEAE RecName: Full=Pullulanase;         EC=3.2.1.41;AltName:
   24::310     1e-18  34%  621 aa  GLGB_RHOMR RecName: Full=1,4-alpha-glucan-branching enzyme;        
   22::307     5e-18  35%  621 aa  GLGB_DECAR RecName: Full=1,4-alpha-glucan-branching enzyme;        
  150::426     3e-16  35%  741 aa  GLGB2_STRCO RecName: Full=1,4-alpha-glucan-branching enzyme 2;     
  115::292     2e-15  36%  596 aa  TREZ_RHIS1 RecName: Full=Malto-oligosyltrehalose trehalohydrolase; 
  165::492     5e-15  29%  588 aa  BBMA1_BACSU RecName: Full=Intracellular maltogenic amylase;        
  102::304     7e-15  35%  598 aa  TREZ_ARTSQ RecName: Full=Malto-oligosyltrehalose trehalohydrolase; 
   78::295     9e-15  36%  589 aa  TREZ_BREHE RecName: Full=Malto-oligosyltrehalose trehalohydrolase; 
  134::414     2e-14  32%  731 aa  GLGB_ERWCH RecName: Full=1,4-alpha-glucan-branching enzyme;        
  184::492     3e-14  29%  588 aa  BBMA2_BACSU RecName: Full=Intracellular maltogenic amylase;        
  125::401     3e-14  30%  715 aa  GLGB_VIBVU RecName: Full=1,4-alpha-glucan-branching enzyme;        
   85::246     6e-14  40%  575 aa  TREZ_ARTRM RecName: Full=Malto-oligosyltrehalose trehalohydrolase; 
  139::419     6e-14  30%  734 aa  GLGB_MYXXD RecName: Full=1,4-alpha-glucan-branching enzyme;        
  125::401     7e-14  30%  715 aa  GLGB_VIBVY RecName: Full=1,4-alpha-glucan-branching enzyme;        
  146::424     7e-14  31%  737 aa  GLGB_RHILO RecName: Full=1,4-alpha-glucan-branching enzyme;        
   62::314     7e-14  33%  627 aa  GLGB_BACLD RecName: Full=1,4-alpha-glucan-branching enzyme;        
  142::420     1e-13  35%  732 aa  GLGB_NITEC RecName: Full=1,4-alpha-glucan-branching enzyme;        
  302::440     2e-13  34%  755 aa  GLGB_VIBPA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  170::428     2e-13  31%  743 aa  GLGB_PSEF5 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  237::417     2e-13  36%  732 aa  GLGB_PSEAE RecName: Full=1,4-alpha-glucan-branching enzyme;        
  160::410     2e-13  33%  727 aa  GLGB_YERPS RecName: Full=1,4-alpha-glucan-branching enzyme;        
  160::410     2e-13  33%  727 aa  GLGB_YERPP RecName: Full=1,4-alpha-glucan-branching enzyme;        
  160::410     2e-13  33%  727 aa  GLGB_YERPN RecName: Full=1,4-alpha-glucan-branching enzyme;        
  160::410     2e-13  33%  727 aa  GLGB_YERPE RecName: Full=1,4-alpha-glucan-branching enzyme;        
  160::410     2e-13  33%  727 aa  GLGB_YERPA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  160::410     2e-13  33%  727 aa  GLGB_YERP3 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  140::418     2e-13  33%  734 aa  GLGB_NITEU RecName: Full=1,4-alpha-glucan-branching enzyme;        
  186::462     2e-13  33%  774 aa  GLGB1_STRCO RecName: Full=1,4-alpha-glucan-branching enzyme 1;     
  160::410     3e-13  34%  727 aa  GLGB_YERE8 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  135::412     3e-13  28%  726 aa  GLGB_THICR RecName: Full=1,4-alpha-glucan-branching enzyme;        
  132::419     3e-13  33%  740 aa  GLGB_RHORT RecName: Full=1,4-alpha-glucan-branching enzyme;        
  231::518     3e-13  33%  838 aa  GLGB1_STRAW RecName: Full=1,4-alpha-glucan-branching enzyme 1;     
  124::406     4e-13  30%  722 aa  GLGB_RUBXD RecName: Full=1,4-alpha-glucan-branching enzyme;        
  168::425     4e-13  32%  741 aa  GLGB_PSESM RecName: Full=1,4-alpha-glucan-branching enzyme;        
  258::424     4e-13  36%  740 aa  GLGB_MAGSA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  129::408     5e-13  33%  725 aa  GLGB_ERWCT RecName: Full=1,4-alpha-glucan-branching enzyme;        
  237::417     6e-13  35%  732 aa  GLGB_PSEA7 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  259::423     8e-13  36%  746 aa  GLGB_NITMU RecName: Full=1,4-alpha-glucan-branching enzyme;        
   30::314     1e-12  32%  636 aa  GLGB_AZOSE RecName: Full=1,4-alpha-glucan-branching enzyme;        
  255::401     2e-12  31%  715 aa  GLGB_VIBF1 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  137::436     2e-12  27%  772 aa  GLGB_SYNR3 RecName: Full=1,4-alpha-glucan-branching enzyme;        
   74::350     2e-12  29%  666 aa  GLGB_VIBCH RecName: Full=1,4-alpha-glucan-branching enzyme;        
  132::416     2e-12  32%  727 aa  GLGB_PARUW RecName: Full=1,4-alpha-glucan-branching enzyme;        
  136::413     3e-12  32%  732 aa  GLGB_RHOSR RecName: Full=1,4-alpha-glucan-branching enzyme;        
   31::307     3e-12  30%  625 aa  GLGB_RHOFD RecName: Full=1,4-alpha-glucan-branching enzyme;        
  170::428     3e-12  34%  743 aa  GLGB_PSEPF RecName: Full=1,4-alpha-glucan-branching enzyme;        
  168::425     3e-12  31%  741 aa  GLGB_PSE14 RecName: Full=1,4-alpha-glucan-branching enzyme;        
   45::314     3e-12  31%  644 aa  GLGB_PROAC RecName: Full=1,4-alpha-glucan-branching enzyme;        
  139::322     3e-12  35%  640 aa  GLGB_DESVH RecName: Full=1,4-alpha-glucan-branching enzyme;        
    9::279     3e-12  31%  592 aa  GLGB2_STRAW RecName: Full=1,4-alpha-glucan-branching enzyme 2;     
  160::410     5e-12  32%  728 aa  GLGB_SERP5 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  139::322     5e-12  34%  640 aa  GLGB_DESVV RecName: Full=1,4-alpha-glucan-branching enzyme;        
  284::422     7e-12  35%  736 aa  GLGB_PSEPK RecName: Full=1,4-alpha-glucan-branching enzyme;        
  177::358     7e-12  33%  678 aa  GLGB_DICDI RecName: Full=1,4-alpha-glucan-branching enzyme;        
   38::312     7e-12  33%  666 aa  GLGB_BACCL RecName: Full=1,4-alpha-glucan-branching enzyme;        
   39::314     9e-12  31%  705 aa  GLGB_DEIRA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  132::408     9e-12  31%  724 aa  GLGB1_XANAC RecName: Full=1,4-alpha-glucan-branching enzyme 1;     
  159::432     1e-11  29%  749 aa  GLGB_THEFY RecName: Full=1,4-alpha-glucan-branching enzyme;        
  166::436     1e-11  28%  754 aa  GLGB_PROMP RecName: Full=1,4-alpha-glucan-branching enzyme;        
  152::429     1e-11  32%  744 aa  GLGB_NOCFA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  139::416     1e-11  31%  731 aa  GLGB_MYCPA RecName: Full=1,4-alpha-glucan-branching enzyme;        
   66::354     1e-11  31%  682 aa  GLGB_CRYNE RecName: Full=1,4-alpha-glucan-branching enzyme;        
  132::408     1e-11  31%  724 aa  GLGB1_XANCP RecName: Full=1,4-alpha-glucan-branching enzyme 1;     
  132::408     1e-11  31%  724 aa  GLGB1_XANC8 RecName: Full=1,4-alpha-glucan-branching enzyme 1;     
  175::343     2e-11  33%  691 aa  GLGB_YARLI RecName: Full=1,4-alpha-glucan-branching enzyme;        
  257::422     2e-11  32%  762 aa  GLGB_NEIDE RecName: Full=1,4-alpha-glucan-branching enzyme;        
   19::311     2e-11  29%  622 aa  GLGB_SALRD RecName: Full=1,4-alpha-glucan-branching enzyme;        
  180::420     2e-11  31%  749 aa  GLGB_NITOC RecName: Full=1,4-alpha-glucan-branching enzyme;        
  175::459     3e-11  33%  775 aa  GLGB_RALSO RecName: Full=1,4-alpha-glucan-branching enzyme;        
  139::416     3e-11  31%  731 aa  GLGB_MYCTU RecName: Full=1,4-alpha-glucan-branching enzyme;        
  139::416     3e-11  31%  731 aa  GLGB_MYCTA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  139::416     3e-11  31%  731 aa  GLGB_MYCBP RecName: Full=1,4-alpha-glucan-branching enzyme;        
  139::416     3e-11  31%  731 aa  GLGB_MYCBO RecName: Full=1,4-alpha-glucan-branching enzyme;        
  151::318     3e-11  31%  639 aa  GLGB_BUTFI RecName: Full=1,4-alpha-glucan-branching enzyme;        
  171::417     3e-11  33%  733 aa  GLGB_BURVG RecName: Full=1,4-alpha-glucan-branching enzyme;        
  139::413     3e-11  29%  777 aa  GLGB_ACTP2 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  139::415     3e-11  31%  731 aa  GLGB2_XANOM RecName: Full=1,4-alpha-glucan-branching enzyme 2;     
  166::436     3e-11  27%  754 aa  GLGB_PROM9 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  140::416     3e-11  31%  732 aa  GLGB1_XANOR RecName: Full=1,4-alpha-glucan-branching enzyme 1;     
  125::410     4e-11  30%  730 aa  GLGB_HAEIN RecName: Full=1,4-alpha-glucan-branching enzyme;        
  184::424     4e-11  31%  737 aa  GLGB_CELJU RecName: Full=1,4-alpha-glucan-branching enzyme;        
  139::413     4e-11  29%  777 aa  GLGB_ACTPJ RecName: Full=1,4-alpha-glucan-branching enzyme;        
  139::413     4e-11  29%  777 aa  GLGB_ACTP7 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  142::420     6e-11  29%  736 aa  GLGB_RHOBA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  139::416     6e-11  30%  731 aa  GLGB_MYCUA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  266::411     6e-11  32%  725 aa  GLGB_METFK RecName: Full=1,4-alpha-glucan-branching enzyme;        
  269::414     6e-11  34%  740 aa  GLGB_METCA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  166::405     6e-11  34%  720 aa  GLGB_CHLPN RecName: Full=1,4-alpha-glucan-branching enzyme;        
  228::373     6e-11  32%  695 aa  GLGB_ALHEH RecName: Full=1,4-alpha-glucan-branching enzyme;        
  287::425     8e-11  35%  741 aa  GLGB_PSEU2 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  236::423     8e-11  32%  820 aa  GLGB_ORYSJ RecName: Full=1,4-alpha-glucan-branching enzyme,
   71::305     8e-11  34%  634 aa  GLGB_LACPL RecName: Full=1,4-alpha-glucan-branching enzyme;        
  125::410     8e-11  30%  730 aa  GLGB_HAEIG RecName: Full=1,4-alpha-glucan-branching enzyme;        
  235::524     8e-11  30%  834 aa  GLGB_BURTA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  165::413     8e-11  32%  729 aa  GLGB2_XANCP RecName: Full=1,4-alpha-glucan-branching enzyme 2;     
  165::413     8e-11  32%  729 aa  GLGB2_XANC8 RecName: Full=1,4-alpha-glucan-branching enzyme 2;     
  134::436     1e-10  27%  755 aa  GLGB_PROMA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  289::457     1e-10  30%  799 aa  GLGB_MAIZE RecName: Full=1,4-alpha-glucan-branching enzyme 2,
  220::386     1e-10  30%  701 aa  GLGB_JANSC RecName: Full=1,4-alpha-glucan-branching enzyme;        
  125::410     1e-10  30%  730 aa  GLGB_HAEI8 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  126::403     1e-10  31%  719 aa  GLGB2_XANAC RecName: Full=1,4-alpha-glucan-branching enzyme 2;     
  170::436     1e-10  30%  776 aa  GLGB_TRIEI RecName: Full=1,4-alpha-glucan-branching enzyme;        
  253::399     1e-10  31%  716 aa  GLGB_PHOPR RecName: Full=1,4-alpha-glucan-branching enzyme;        
   36::312     1e-10  29%  637 aa  GLGB_OCEIH RecName: Full=1,4-alpha-glucan-branching enzyme;        
   83::325     1e-10  34%  638 aa  GLGB_DESDG RecName: Full=1,4-alpha-glucan-branching enzyme;        
  125::420     2e-10  32%  736 aa  GLGB_BURCH RecName: Full=1,4-alpha-glucan-branching enzyme;        
  125::420     2e-10  32%  736 aa  GLGB_BURCA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  181::316     2e-10  32%  630 aa  GLGB_AQUAE RecName: Full=1,4-alpha-glucan-branching enzyme;        
  155::403     2e-10  34%  720 aa  GLGB2_XANOR RecName: Full=1,4-alpha-glucan-branching enzyme 2;     
  179::427     2e-10  34%  744 aa  GLGB1_XANOM RecName: Full=1,4-alpha-glucan-branching enzyme 1;     
  174::445     2e-10  30%  764 aa  GLGB_STRAU RecName: Full=1,4-alpha-glucan-branching enzyme;        
  274::412     2e-10  31%  729 aa  GLGB_PSEA6 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  272::410     2e-10  31%  730 aa  GLGB_PASMU RecName: Full=1,4-alpha-glucan-branching enzyme;        
  136::410     2e-10  29%  815 aa  GLGB_HAES2 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  136::410     2e-10  29%  807 aa  GLGB_HAES1 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  111::376     2e-10  29%  611 aa  GLGB_FUSNN RecName: Full=1,4-alpha-glucan-branching enzyme;        
  196::364     2e-10  30%  699 aa  GLGB_FELCA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  184::354     2e-10  32%  686 aa  GLGB_EMENI RecName: Full=1,4-alpha-glucan-branching enzyme;        
  119::397     2e-10  31%  711 aa  GLGB_CORJK RecName: Full=1,4-alpha-glucan-branching enzyme;        
  187::357     2e-10  32%  689 aa  GLGB_ASPOR RecName: Full=1,4-alpha-glucan-branching enzyme;        
  195::373     2e-10  32%  703 aa  GLGB_ASHGO RecName: Full=1,4-alpha-glucan-branching enzyme;        
  286::424     3e-10  29%  736 aa  GLGB_RHIME RecName: Full=1,4-alpha-glucan-branching enzyme;        
  260::398     3e-10  34%  705 aa  GLGB_PICTO RecName: Full=1,4-alpha-glucan-branching enzyme;        
   83::327     3e-10  30%  652 aa  GLGB_DEIGD RecName: Full=1,4-alpha-glucan-branching enzyme;        
  195::363     3e-10  29%  711 aa  GLGB_DEBHA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  143::449     4e-10  29%  763 aa  GLGB_SYNJB RecName: Full=1,4-alpha-glucan-branching enzyme;        
  171::417     4e-10  32%  733 aa  GLGB_BURCM RecName: Full=1,4-alpha-glucan-branching enzyme;        
  140::416     4e-10  29%  732 aa  GLGB1_XANC5 RecName: Full=1,4-alpha-glucan-branching enzyme 1;     
  161::420     5e-10  30%  736 aa  GLGB_BURXL RecName: Full=1,4-alpha-glucan-branching enzyme;        
  280::418     6e-10  37%  733 aa  GLGB_LEIXX RecName: Full=1,4-alpha-glucan-branching enzyme;        
  182::315     6e-10  39%  649 aa  GLGB_LACS1 RecName: Full=1,4-alpha-glucan-branching enzyme;        
   37::312     6e-10  29%  627 aa  GLGB_BACSU RecName: Full=1,4-alpha-glucan-branching enzyme;        
  209::342     6e-10  32%  664 aa  GLGB2_CLOPE RecName: Full=1,4-alpha-glucan-branching enzyme 2;     
  134::337     8e-10  31%  588 aa  NEPU_BACST RecName: Full=Neopullulanase;         EC=3.2.1.135;
  274::436     8e-10  32%  754 aa  GLGB_PROM5 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  166::436     8e-10  25%  759 aa  GLGB_PROM4 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  272::410     8e-10  31%  729 aa  GLGB_MANSM RecName: Full=1,4-alpha-glucan-branching enzyme;        
  218::495     8e-10  30%  812 aa  GLGB_FRASC RecName: Full=1,4-alpha-glucan-branching enzyme;        
  276::404     8e-10  33%  738 aa  GLGB_CHLTR RecName: Full=1,4-alpha-glucan-branching enzyme;        
  276::404     8e-10  33%  738 aa  GLGB_CHLTA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  272::410     8e-10  33%  829 aa  GLGB_ACTSZ RecName: Full=1,4-alpha-glucan-branching enzyme;        
  289::427     8e-10  34%  743 aa  GLGB2_XANC5 RecName: Full=1,4-alpha-glucan-branching enzyme 2;     
  139::449     1e-09  29%  770 aa  GLGB_SYNJA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  248::414     1e-09  32%  731 aa  GLGB_ROSDO RecName: Full=1,4-alpha-glucan-branching enzyme;        
  164::420     1e-09  32%  736 aa  GLGB2_RHIL3 RecName: Full=1,4-alpha-glucan-branching enzyme 2;     
  164::418     1e-09  31%  732 aa  GLGB2_RHIEC RecName: Full=1,4-alpha-glucan-branching enzyme 2;     
  204::337     1e-09  32%  659 aa  GLGB2_CLOPS RecName: Full=1,4-alpha-glucan-branching enzyme 2;     
  289::427     1e-09  35%  759 aa  GLGB_MYCSS RecName: Full=1,4-alpha-glucan-branching enzyme;        
  289::427     1e-09  35%  759 aa  GLGB_MYCSK RecName: Full=1,4-alpha-glucan-branching enzyme;        
  196::366     1e-09  30%  699 aa  GLGB_HORSE RecName: Full=1,4-alpha-glucan-branching enzyme;        
  276::404     1e-09  33%  738 aa  GLGB_CHLTB RecName: Full=1,4-alpha-glucan-branching enzyme;        
  276::404     1e-09  33%  738 aa  GLGB_CHLT2 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  289::427     2e-09  35%  759 aa  GLGB_MYCSJ RecName: Full=1,4-alpha-glucan-branching enzyme;        
  199::367     2e-09  31%  702 aa  GLGB_MOUSE RecName: Full=1,4-alpha-glucan-branching enzyme;        
  168::312     2e-09  32%  639 aa  GLGB_BACST RecName: Full=1,4-alpha-glucan-branching enzyme;        
  259::423     2e-09  31%  735 aa  GLGB_AGRT5 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  166::436     2e-09  27%  761 aa  GLGB_SYNPW RecName: Full=1,4-alpha-glucan-branching enzyme;        
  199::369     2e-09  31%  702 aa  GLGB_HUMAN RecName: Full=1,4-alpha-glucan-branching enzyme;        
  280::418     2e-09  34%  734 aa  GLGB_GRABC RecName: Full=1,4-alpha-glucan-branching enzyme;        
  184::354     2e-09  30%  683 aa  GLGB_GLOIN RecName: Full=1,4-alpha-glucan-branching enzyme;        
  284::423     2e-09  29%  735 aa  GLGB1_RHIEC RecName: Full=1,4-alpha-glucan-branching enzyme 1;     
   34::304     3e-09  29%  642 aa  GLGB_STRR6 RecName: Full=1,4-alpha-glucan-branching enzyme;        
   34::304     3e-09  29%  642 aa  GLGB_STRP2 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  167::351     3e-09  29%  622 aa  GLGB_STRA3 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  245::410     3e-09  33%  728 aa  GLGB_CITK8 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  182::374     4e-09  30%  704 aa  GLGB_YEAST RecName: Full=1,4-alpha-glucan-branching enzyme;        
  268::442     4e-09  31%  861 aa  GLGB_SOLTU RecName: Full=1,4-alpha-glucan-branching enzyme;        
  284::422     4e-09  29%  734 aa  GLGB_RHIRD RecName: Full=1,4-alpha-glucan-branching enzyme;        
  166::436     4e-09  25%  755 aa  GLGB_PROMT RecName: Full=1,4-alpha-glucan-branching enzyme;        
  135::422     4e-09  29%  738 aa  GLGB_MESSB RecName: Full=1,4-alpha-glucan-branching enzyme;        
  168::314     4e-09  31%  631 aa  GLGB_MARAV RecName: Full=1,4-alpha-glucan-branching enzyme;        
  204::382     4e-09  31%  719 aa  GLGB_KLULA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  204::337     4e-09  31%  659 aa  GLGB_CLOP1 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  206::405     4e-09  32%  719 aa  GLGB_CHLCV RecName: Full=1,4-alpha-glucan-branching enzyme;        
  284::423     4e-09  27%  735 aa  GLGB1_RHIL3 RecName: Full=1,4-alpha-glucan-branching enzyme 1;     
   32::251     4e-09  26%  499 aa  AMY3_DICT6 RecName: Full=Alpha-amylase 3;       
   34::304     5e-09  29%  642 aa  GLGB_STRPN RecName: Full=1,4-alpha-glucan-branching enzyme;        
  238::430     5e-09  32%  750 aa  GLGB_RALEJ RecName: Full=1,4-alpha-glucan-branching enzyme;        
  121::252     7e-09  33%  580 aa  TREZ_MYCTU RecName: Full=Malto-oligosyltrehalose trehalohydrolase; 
  132::409     7e-09  27%  721 aa  GLGB_NOVAD RecName: Full=1,4-alpha-glucan-branching enzyme;        
  276::404     7e-09  31%  737 aa  GLGB_CHLMU RecName: Full=1,4-alpha-glucan-branching enzyme;        
  206::405     7e-09  32%  721 aa  GLGB_CHLAB RecName: Full=1,4-alpha-glucan-branching enzyme;        
  167::351     9e-09  29%  622 aa  GLGB_STRA5 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  167::351     9e-09  29%  622 aa  GLGB_STRA1 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  249::430     9e-09  31%  756 aa  GLGB_RALEH RecName: Full=1,4-alpha-glucan-branching enzyme;        
  166::436     9e-09  25%  755 aa  GLGB_PROM1 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  143::413     9e-09  28%  731 aa  GLGB_COREF RecName: Full=1,4-alpha-glucan-branching enzyme;        
  178::490     9e-09  28%  574 aa  CDAS_THEP3 RecName: Full=Cyclomaltodextrinase;         Short=CDase;
  163::492     9e-09  29%  591 aa  CDAS_BACSH RecName: Full=Cyclomaltodextrinase;         Short=CDase;
  276::414     1e-08  29%  729 aa  GLGB_SACD2 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  248::414     1e-08  32%  733 aa  GLGB_GLOVI RecName: Full=1,4-alpha-glucan-branching enzyme;        
  185::424     2e-08  31%  740 aa  GLGB_THIDA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  137::436     2e-08  29%  765 aa  GLGB_SYNSC RecName: Full=1,4-alpha-glucan-branching enzyme;        
  131::410     2e-08  31%  728 aa  GLGB_SHIBS RecName: Full=1,4-alpha-glucan-branching enzyme;        
  131::410     2e-08  31%  728 aa  GLGB_SALAR RecName: Full=1,4-alpha-glucan-branching enzyme;        
  245::410     2e-08  32%  728 aa  GLGB_KLEP7 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  137::436     2e-08  29%  775 aa  GLGB_SYNPX RecName: Full=1,4-alpha-glucan-branching enzyme;        
  283::421     2e-08  29%  743 aa  GLGB_SHEB9 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  283::421     2e-08  29%  743 aa  GLGB_SHEB8 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  283::421     2e-08  29%  743 aa  GLGB_SHEB5 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  283::421     2e-08  29%  743 aa  GLGB_SHEB2 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  142::414     2e-08  29%  728 aa  GLGB_RHOS1 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  177::318     2e-08  32%  640 aa  GLGB_FRAP2 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  245::410     2e-08  32%  728 aa  GLGB_ENT38 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  131::410     2e-08  31%  728 aa  GLGB_ECOL6 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  131::410     3e-08  31%  728 aa  GLGB_SHISS RecName: Full=1,4-alpha-glucan-branching enzyme;        
  131::410     3e-08  31%  728 aa  GLGB_SHIFL RecName: Full=1,4-alpha-glucan-branching enzyme;        
  131::410     3e-08  31%  728 aa  GLGB_SHIF8 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  131::410     3e-08  31%  728 aa  GLGB_SHIDS RecName: Full=1,4-alpha-glucan-branching enzyme;        
  298::436     3e-08  30%  754 aa  GLGB_PROMS RecName: Full=1,4-alpha-glucan-branching enzyme;        
  298::436     3e-08  30%  754 aa  GLGB_PROM2 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  298::436     3e-08  30%  754 aa  GLGB_PROM0 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  131::410     3e-08  31%  728 aa  GLGB_ECOUT RecName: Full=1,4-alpha-glucan-branching enzyme;        
  131::410     3e-08  31%  728 aa  GLGB_ECOLI RecName: Full=1,4-alpha-glucan-branching enzyme;        
  131::410     3e-08  31%  728 aa  GLGB_ECOLC RecName: Full=1,4-alpha-glucan-branching enzyme;        
  131::410     3e-08  31%  728 aa  GLGB_ECOL5 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  131::410     3e-08  31%  728 aa  GLGB_ECOK1 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  131::410     3e-08  31%  728 aa  GLGB_ECOHS RecName: Full=1,4-alpha-glucan-branching enzyme;        
  131::410     3e-08  31%  728 aa  GLGB_ECO24 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  141::414     3e-08  28%  732 aa  GLGB_CORDI RecName: Full=1,4-alpha-glucan-branching enzyme;        
  205::336     3e-08  31%  674 aa  GLGB1_CLOPE RecName: Full=1,4-alpha-glucan-branching enzyme 1;     
  142::414     4e-08  29%  728 aa  GLGB_RHOS4 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  168::313     4e-08  30%  630 aa  GLGB_HALOH RecName: Full=1,4-alpha-glucan-branching enzyme;        
  190::370     4e-08  30%  706 aa  GLGB_CANGA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  205::336     4e-08  31%  674 aa  GLGB1_CLOPS RecName: Full=1,4-alpha-glucan-branching enzyme 1;     
  171::304     5e-08  33%  628 aa  GLGB_STRMU RecName: Full=1,4-alpha-glucan-branching enzyme;        
  131::410     5e-08  31%  728 aa  GLGB_SALTI RecName: Full=1,4-alpha-glucan-branching enzyme;        
  131::410     5e-08  31%  728 aa  GLGB_SALPB RecName: Full=1,4-alpha-glucan-branching enzyme;        
  131::410     5e-08  31%  728 aa  GLGB_SALCH RecName: Full=1,4-alpha-glucan-branching enzyme;        
  187::318     5e-08  31%  640 aa  GLGB_FRATW RecName: Full=1,4-alpha-glucan-branching enzyme;        
  187::318     5e-08  31%  640 aa  GLGB_FRATT RecName: Full=1,4-alpha-glucan-branching enzyme;        
  187::318     5e-08  36%  640 aa  GLGB_FRATN RecName: Full=1,4-alpha-glucan-branching enzyme;        
  187::318     5e-08  31%  640 aa  GLGB_FRATM RecName: Full=1,4-alpha-glucan-branching enzyme;        
  187::318     5e-08  31%  640 aa  GLGB_FRAT1 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  131::410     5e-08  31%  728 aa  GLGB_ECO57 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  260::405     5e-08  31%  721 aa  GLGB_CHLFF RecName: Full=1,4-alpha-glucan-branching enzyme;        
  290::436     6e-08  31%  764 aa  GLGB_SYNS9 RecName: Full=1,4-alpha-glucan-branching enzyme;        
   33::304     6e-08  29%  636 aa  GLGB_STRSV RecName: Full=1,4-alpha-glucan-branching enzyme;        
  131::410     6e-08  30%  728 aa  GLGB_SALTY RecName: Full=1,4-alpha-glucan-branching enzyme;        
  187::318     6e-08  31%  640 aa  GLGB_FRATO RecName: Full=1,4-alpha-glucan-branching enzyme;        
  187::318     6e-08  31%  640 aa  GLGB_FRATH RecName: Full=1,4-alpha-glucan-branching enzyme;        
  187::318     6e-08  31%  640 aa  GLGB_FRATF RecName: Full=1,4-alpha-glucan-branching enzyme;        
  275::413     6e-08  29%  731 aa  GLGB_CORGL RecName: Full=1,4-alpha-glucan-branching enzyme;        
   20::188     8e-08  36%  441 aa  MGTA_THEMA RecName: Full=4-alpha-glucanotransferase;       
  145::304     8e-08  34%  633 aa  GLGB_STRGC RecName: Full=1,4-alpha-glucan-branching enzyme;        
  158::404     8e-08  26%  716 aa  GLGB_RHOPB RecName: Full=1,4-alpha-glucan-branching enzyme;        
  290::436     8e-08  31%  756 aa  GLGB_PROMM RecName: Full=1,4-alpha-glucan-branching enzyme;        
  290::436     8e-08  31%  756 aa  GLGB_PROM3 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  132::436     1e-07  26%  766 aa  GLGB_THEEB RecName: Full=1,4-alpha-glucan-branching enzyme;        
  271::403     1e-07  30%  716 aa  GLGB_NITHX RecName: Full=1,4-alpha-glucan-branching enzyme;        
  166::436     1e-07  29%  765 aa  GLGB_SYNS3 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  283::421     1e-07  27%  746 aa  GLGB_SHEON RecName: Full=1,4-alpha-glucan-branching enzyme;        
  131::410     1e-07  30%  728 aa  GLGB_SALPA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  190::423     1e-07  31%  737 aa  GLGB_BIFLO RecName: Full=1,4-alpha-glucan-branching enzyme;        
  163::493     1e-07  28%  586 aa  AMYM_BACAD RecName: Full=Maltogenic alpha-amylase;       
   29::188     2e-07  35%  442 aa  MGTA_THENE RecName: Full=4-alpha-glucanotransferase;       
  240::404     2e-07  30%  716 aa  GLGB_RHOP2 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  283::421     2e-07  27%  745 aa  GLGB_SHEPC RecName: Full=1,4-alpha-glucan-branching enzyme;        
  269::404     3e-07  30%  716 aa  GLGB_RHOPA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  299::445     5e-07  31%  774 aa  GLGB_SYNP6 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  299::445     5e-07  31%  774 aa  GLGB_SYNE7 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  283::421     5e-07  26%  745 aa  GLGB_SHESR RecName: Full=1,4-alpha-glucan-branching enzyme;        
  283::421     5e-07  26%  745 aa  GLGB_SHESM RecName: Full=1,4-alpha-glucan-branching enzyme;        
  170::315     7e-07  30%  638 aa  GLGB_LACAC RecName: Full=1,4-alpha-glucan-branching enzyme;        
  182::310     7e-07  35%  632 aa  GLGB_DESHY RecName: Full=1,4-alpha-glucan-branching enzyme;        
   80::256     7e-07  27%  711 aa  CDGT_BACST RecName: Full=Cyclomaltodextrin glucanotransferase;     
    6::236     9e-07  26%  561 aa  O16G2_BACSU RecName: Full=Probable oligo-1,6-glucosidase 2;        
  135::438     9e-07  26%  770 aa  GLGB_SYNY3 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  171::420     9e-07  26%  744 aa  GLGB_SHEFN RecName: Full=1,4-alpha-glucan-branching enzyme;        
  267::403     9e-07  26%  716 aa  GLGB_NITWN RecName: Full=1,4-alpha-glucan-branching enzyme;        
  283::421     1e-06  27%  745 aa  GLGB_SHESW RecName: Full=1,4-alpha-glucan-branching enzyme;        
  269::404     2e-06  28%  716 aa  GLGB_RHOPS RecName: Full=1,4-alpha-glucan-branching enzyme;        
  269::404     3e-06  30%  715 aa  GLGB_RHOP5 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  284::422     3e-06  29%  738 aa  GLGB_BURPS RecName: Full=1,4-alpha-glucan-branching enzyme;        
  284::422     3e-06  29%  738 aa  GLGB_BURP6 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  284::422     3e-06  29%  738 aa  GLGB_BURP1 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  284::422     3e-06  29%  738 aa  GLGB_BURP0 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  293::439     3e-06  28%  764 aa  GLGB_ANAVT RecName: Full=1,4-alpha-glucan-branching enzyme;        
  281::419     3e-06  30%  735 aa  GLGB_BURS3 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  178::312     3e-06  33%  645 aa  GLGB_BACWK RecName: Full=1,4-alpha-glucan-branching enzyme;        
  130::334     4e-06  27%  585 aa  NEPU2_THEVU RecName: Full=Neopullulanase 2;       
   74::219     4e-06  33%  659 aa  AMY_BACSU RecName: Full=Alpha-amylase;         EC=3.2.1.1;AltName:
  792::971     4e-06  29% 1196 aa  AMYB_PAEPO RecName: Full=Beta/alpha-amylase;Includes:  RecName:
  156::402     6e-06  26%  712 aa  GLGB_BRASB RecName: Full=1,4-alpha-glucan-branching enzyme;        
  278::409     6e-06  27%  721 aa  GLGB_BRAJA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  136::417     6e-06  29%  731 aa  GLGB_BORPA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  293::439     6e-06  27%  764 aa  GLGB_ANASP RecName: Full=1,4-alpha-glucan-branching enzyme;        
  136::417     7e-06  29%  731 aa  GLGB_BORBR RecName: Full=1,4-alpha-glucan-branching enzyme;        
  166::312     7e-06  33%  645 aa  GLGB_BACCN RecName: Full=1,4-alpha-glucan-branching enzyme;        
  136::417     1e-05  29%  731 aa  GLGB_BORPE RecName: Full=1,4-alpha-glucan-branching enzyme;        
  170::304     1e-05  32%  637 aa  GLGB_BACCZ RecName: Full=1,4-alpha-glucan-branching enzyme;        
  178::312     1e-05  32%  645 aa  GLGB_BACCR RecName: Full=1,4-alpha-glucan-branching enzyme;        
  178::312     1e-05  32%  645 aa  GLGB_BACCQ RecName: Full=1,4-alpha-glucan-branching enzyme;        
  178::312     1e-05  32%  645 aa  GLGB_BACC4 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  178::312     1e-05  32%  645 aa  GLGB_BACC1 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  178::312     1e-05  32%  645 aa  GLGB_BACAN RecName: Full=1,4-alpha-glucan-branching enzyme;        
  178::312     1e-05  32%  645 aa  GLGB_BACAC RecName: Full=1,4-alpha-glucan-branching enzyme;        
  178::312     1e-05  32%  645 aa  GLGB_BACAA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  178::312     1e-05  32%  645 aa  GLGB_BACHK RecName: Full=1,4-alpha-glucan-branching enzyme;        
  178::312     1e-05  32%  645 aa  GLGB_BACC3 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  178::312     1e-05  32%  645 aa  GLGB_BACC0 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  178::312     2e-05  32%  645 aa  GLGB_BACC7 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  178::312     2e-05  32%  645 aa  GLGB_BACC2 RecName: Full=1,4-alpha-glucan-branching enzyme;        
   79::256     2e-05  28%  713 aa  CDGT_BACS8 RecName: Full=Cyclomaltodextrin glucanotransferase;     
   77::385     3e-05  27%  703 aa  CDGT_BACS2 RecName: Full=Cyclomaltodextrin glucanotransferase;     
   79::256     3e-05  28%  713 aa  CDGT_BACS0 RecName: Full=Cyclomaltodextrin glucanotransferase;     
   79::256     4e-05  27%  713 aa  CDGT2_BACCI RecName: Full=Cyclomaltodextrin glucanotransferase;    
  172::311     4e-05  24%  562 aa  AMY2_DICT6 RecName: Full=Alpha-amylase 2;       
   70::257     6e-05  29%  710 aa  CDGT_THETU RecName: Full=Cyclomaltodextrin glucanotransferase;     
    8::202     6e-05  29%  557 aa  AGL_PEDPE RecName: Full=Alpha-glucosidase;       
   83::206     8e-05  31%  561 aa  O16G1_BACSU RecName: Full=Oligo-1,6-glucosidase 1;       
   79::256     8e-05  28%  712 aa  CDGT_BACS3 RecName: Full=Cyclomaltodextrin glucanotransferase;     
   79::256     1e-04  27%  713 aa  CDGT_BAC11 RecName: Full=Cyclomaltodextrin glucanotransferase;     
  459::527     2e-04  36% 1481 aa  APU_THEP3 RecName: Full=Amylopullulanase;AltName:
   73::272     2e-04  28%  512 aa  AMY1_DEBOC RecName: Full=Alpha-amylase 1;       
   91::166     2e-04  42%  719 aa  AMYM_BACST RecName: Full=Maltogenic alpha-amylase;       
   48::114     2e-04  37%  445 aa  AMY2A_ORYSJ RecName: Full=Alpha-amylase isozyme 2A;       
   48::114     2e-04  37%  446 aa  AMY2A_ORYSI RecName: Full=Alpha-amylase isozyme 2A;       
   71::235     4e-04  23%  513 aa  MDE5_SCHPO RecName: Full=Alpha-amylase mde5;       
   51::219     4e-04  31%  437 aa  AMY3E_ORYSJ RecName: Full=Alpha-amylase isozyme 3E;       
   57::220     4e-04  35%  440 aa  AMY3A_ORYSJ RecName: Full=Alpha-amylase isozyme 3A;       
   61::143     5e-04  27%  499 aa  AMY_ASPSH RecName: Full=Alpha-amylase;         EC=3.2.1.1;AltName:
   61::143     5e-04  27%  499 aa  AMYB_ASPAW RecName: Full=Alpha-amylase B;       
   61::143     5e-04  27%  498 aa  AMYA_ASPAW RecName: Full=Alpha-amylase A;       
   61::143     5e-04  27%  499 aa  AMYA3_ASPOR RecName: Full=Alpha-amylase A type-3;       
   61::143     5e-04  27%  499 aa  AMYA1_ASPOR RecName: Full=Alpha-amylase A type-1/2;       
  107::186     7e-04  29%  919 aa  AMY_STRLI RecName: Full=Alpha-amylase;         EC=3.2.1.1;AltName:
   86::263     9e-04  29%  718 aa  CDGT_BACLI RecName: Full=Cyclomaltodextrin glucanotransferase;     
   89::157     9e-04  40%  478 aa  AMY_STRHY RecName: Full=Alpha-amylase;         EC=3.2.1.1;AltName:
   53::228     9e-04  31%  427 aa  AMY2_HORVU RecName: Full=Alpha-amylase type B isozyme;       
    1::707

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxMVEVWPGHAYPLGATYDGSGTNFSLFSEVATGVELCLFDDDGAETRVPLTEQDGHVWHGYLPTVGPGQ
GLGX_MYCTU      -----VWPGNAYPLGATYDGAGTNFSLFSEIAEKVELCLIDEDGVESRIPLDEVDGYVWHAYLPNITPGQ
GLGX_MYCBO      -----VWPGNAYPLGATYDGAGTNFSLFSEIAEKVELCLIDEDGVESRIPLDEVDGYVWHAYLPNITPGQ
GLGX_ENT38      --MTQLTAGKPAPLGASFDGKGVNFTLFSAHAERVELCVFDREGNEYRYDLPAREGDIWHGYLEDGKPGL
GLGX_SERP5      --MTELTPGIAAPLGAYYDGNGINFSLYSAHATGVELCLFDEQQREVRLPLATRSGDIWHGYLPGGKPGQ
GLGX_SHIDS      --MTQLAIGKPAPLGAHYDGQGVNFTLFSAHAERVELCVFDANGHEHRYDLPGHSGDIWHGYLPDARPGL
GLGX_ECO81      --MTQLAIGKPTPLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGHSGDIWHGYLPDARPGL
GLGX_SHIBS      --MTQLAIGKPAPLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGHSGDIWHGYLPDARPGL
GLGX_ECOLU      --MTQLAIGKPAPLGAHYDGQGVNFTLFSAHAERVELCIFDANGQEHRYDLPGHSGDIWHGYLPDARPGL
GLGX_ECOLI      --MTQLAIGKPAPLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGHSGDIWHGYLPDARPGL
GLGX_ECODH      --MTQLAIGKPAPLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGHSGDIWHGYLPDARPGL
GLGX_ECOBW      --MTQLAIGKPAPLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGHSGDIWHGYLPDARPGL
GLGX_ECO8A      --MTQLAIGKPAPLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGHSGDIWHGYLPDARPGL
GLGX_ECO5E      --MTQLAIGKPAPLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGHSGDIWHGYLPDARPGL
GLGX_ECO57      --MTQLAIGKPAPLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGHSGDIWHGYLPDARPGL
GLGX_ECO7I      --MTQLAIGKPAPLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGHSGDIWHGYLPDARPGL
GLGX_SHIB3      --MTQLAIGKPAPLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGHSGDIWHGYLPDARPGL
GLGX_ECOSE      --------GKPAPLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGHSGDIWHGYLPDARPGL
GLGX_ECOLC      --MTQLAIGKPAPLGAHYDGQGVNFTLFSVHAERVELCVFDANGQEHRYDLPGHSGDIWHGYLPDARPGL
GLGX_ECOHS      --MTQLAIGKPAPLGAHYDGQGVNFTLFSVHAERVELCVFDANGQEHRYDLPGHSGDIWHGYLPDARPGL
GLGX_ECO27      --MTQLAIGKPTPLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGHSGDIWHGYLPDARPGL
GLGX_ERWT9      --MMPIRDGQPAPRGASYDGKGVNFSLFSQRAERVELCLYDDDGVETRLDLPAHSGDIWHGYLPAVRPGQ
GLGX_ECO55      --MTQLAIGKPAPLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGHSGDIWHGYLPDARPGL
GLGX_ECO24      --MTQLAIGKPAPLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGHSGDIWHGYLPDARPGL
GLGX_SHIFL      --MTQLAIGKPAPLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGNSGDIWHGYLPDARPGL
GLGX_SHIF8      --MTQLAIGKPAPLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGNSGDIWHGYLPDARPGL
GLGX_ECOSM      --MTQLAIGKPTPLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGHSGDIWHGYLPDARPGL
GLGX_ECOL5      --MTQLAIGKPTPLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGHSGDIWHGYLPDARPGL
GLGX_ECOL6      --MTQLAIGKPTPLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGHSGDIWHGYLPDARPGL
GLGX_ECOUT      --MTQLAIGKPTPLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGHSGDIWHGYLPDARPGL
GLGX_ECOK1      --MTQLAIGKPTPLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGHSGDIWHGYLPDARPGL
GLGX_ECO45      --MTQLAIGKPTPLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGHSGDIWHGYLPDARPGL
GLGX_SHISS      --------GKPAPLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGHSGDIWHGYLPDARPGL
GLGX_ESCF3      --MTQLTTGKATPHGATYDGHGVNFTLFSAHAERVELCVFDAQGNEVRFDLPGRSGDVWHGYLADARPGL
GLGX_KLEP7      --MTSLAAGKPAPLGASYDGKGVNFALFSAHAERVELCVFDEQGNEQRFDLPARSGDIWHGWLAAAGPGL
GLGX_KLEP3      --MTSLAAGKPAPLGASYDGKGVNFALFSAHAERVELCVFDEQGNEQRVDLPARSGDIWHGWLDAAGPGL
GLGX_SALPB      --MTQLAIGEATPHGATYDGHGVNFTLFSAHAERVELCVFDSRGNERRYDLPGRRGDVWHGYLAGARPGL
GLGX_SALPK      --MTQLAIGEATPHGATYDGHGVNFTLFSAHAERVELCVFDSRGNERRYDLPGRRGDVWHGYLAGARPGL
GLGX_SALPA      --MTQLAIGEATPHGATYDGHGVNFTLFSAHAERVELCVFDSRGNERRYDLPGRRGDVWHGYLAGARPGL
GLGX_SALTY      --MTQLAIGEATPHGATYDGHGVNFTLFSAHAERVELCVFDSRGNERRYDLPGRRGDVWHGYLAGARPGL
GLGX_SALPC      --MTQLAIGEATPHGATYDGHGVNFTLFSAHAERVELCVFDSRGNERRYDLPGRRGDVWHGYLAGARPGL
GLGX_SALNS      --MTQLAIGEATPHGATYDGHGVNFTLFSAHAERVELCVFDSRGNERRYDLPGRRGDVWHGYLAGARPGL
GLGX_SALHS      --MTQLAIGEATPHGATYDGHGVNFTLFSAHAERVELCVFDSRGNERRYDLPGRRGDVWHGYLAGARPGL
GLGX_SALDC      --MTQLAIGEATPHGATYDGHGVNFTLFSAHAERVELCVFDSRGNERRYDLPGRRGDVWHGYLAGARPGL
GLGX_SALCH      --MTQLAIGEATPHGATYDGHGVNFTLFSAHAERVELCVFDSRGNERRYDLPGRRGDVWHGYLAGARPGL
GLGX_SALSV      --MTQLAIGEATPHGATYDGHGVNFTLFSAHAERVELCVFDSRGNERRYDLPGRRGDVWHGYLAGARPGL
GLGX_SALEP      --MTQLAIGEATPHGATYDGHGVNFTLFSAHAERVELCVFDSRGNERRYDLPGRRGDVWHGYLAGARPGL
GLGX_SALA4      --MTQLAIGEATPHGATYDGHGVNFTLFSAHAERVELCVFDSRGNERRYDLPGRRGDVWHGYLAGARPGL
GLGX_SALTI      --MTQLAIGEATPHGATYDGHGVNFTLFSAHAERVELCVFDSRGNERRYDLPGRRGDVWHGYLAGARPGL
GLGX_YERE8      --MTTLTSGSPTPMGAHFDGVGINFTLFSAHAEQVELCLFDDNNQELRIPLPARSGDIWHGYLPGGKPGQ
GLGX_SALG2      --MTQLAIGEATPHGATYDGHGVNFTLFSAHAERVELCVFDSRGNERRYDLPGRRGDVWHGYLAGARPGL
GLGX_CITK8      --MTQLATGKATPHGATYDGHGVNFTLFSAHAERVELCVFDALGNEQRYDLPGRSGDVWHGYLADARPGL
GLGX_PECCP      --MAELQTGKPTPLGASFDGQGVNFALFSADAERVELCIFDERQQEQRLELTARSGDIWHGYLPAAQPGL
GLGX_YERPB      --------GSPTPSGAYFDGKGINFTLFSAHAEQVTLCLFDEQGQERQIAMPARTGDIWHGYLPGGKPGQ
GLGX_YERPY      --------GSPTPSGAYFDGKGINFTLFSAHAEQVTLCLFDEQGQERQIAMPARTGDIWHGYLPGGKPGQ
GLGX_YERPS      --------GSPTPSGAYFDGKGINFTLFSAHAEQVTLCLFDEQGQERQIAMPARTGDIWHGYLPGGKPGQ
GLGX_ERWCT      --MAELQTGKPTPLGASFDGNGVNFALFSADAERVELCVFDERQQEQRIVLTARSGDIWHGYLPDAQPGL
GLGX_ENTS8      --MMQLNAGHSAPPGAWFDGAGVNFTLFSAHAEKVELCLFDESGNETRYALPARSGDVWHGYLPGARPGL
GLGX_YERP3      --------GSPTPSGAYFDGKGINFTLFSAHAEQVTLCLFDEQGQERQIAMPARTGDIWHGYLPGGKPGQ
GLGX_YERPG      --------GSPTPSGAHFDGKGINFTLFSAHAEQVTLCLFDEQGQERQIAMPARTGDIWHGYLPGGKPGQ
GLGX_YERPP      --------GSPTPSGAHFDGKGINFTLFSAHAEQVTLCLFDEQGQERQIAMPARTGDIWHGYLPGGKPGQ
GLGX_YERPN      --------GSPTPSGAHFDGKGINFTLFSAHAEQVTLCLFDEQGQERQIAMPARTGDIWHGYLPGGKPGQ
GLGX_YERPE      --------GSPTPSGAHFDGKGINFTLFSAHAEQVTLCLFDEQGQERQIAMPARTGDIWHGYLPGGKPGQ
GLGX_YERPA      --------GSPTPSGAHFDGKGINFTLFSAHAEQVTLCLFDEQGQERQIAMPARTGDIWHGYLPGGKPGQ
GLGX_ERWCH      --MGELLAGRPRPLGSHFDGEGVNFALFSSGASRVELCIFDGL-REQRLPLTARTGDIWHGYLPDAQPGL
GLGX_HAEIN      ----------------------TNFALFSAAAIGVELCLFDEQNQETRLPMVRTE-NVWHLAVTGVKTGT
ISOA3_ARATH     --LFKVSSGEVSPLGVSQVDKGINFALFSQNATSVTLCLSDDDGMIELVPSVNKTGDTWHICVEDLPLNN
ISOA1_ARATH     ------------PFGPTVRDDGVNFSVYSTNSVSATICLISSDLRQNKVPSRNRTGHVWHVFLRGDFKDM
ISOA_FLASP      ----------AQQLGARYDAAQANFRVYSSRATRVEVFLYKNPTGSARLALSKDPAQVWSLSLPTITGAV
ISOA_PSEUM      -------PAHAMSLGASYDAQQANFRVYSSQATRIVLYLYSAGYGSATYTLSPAGSGVWAVTVPVITGAV
ISOA_PSEAY      -------PAHAMSLGASYDAQQANFRVYSSQATRIVLYLYSAGYGSATYTLSPAGSGVWAVTVPVITGAV
ISOA2_ARATH     --------GHPLPLGLSSDDDSWNFSFFSRSSTNVVLCLYDDSTTDKPAPYVNRTGDVWHASVDNTWDFV
PULA_THEMA      --MMEILDDYYYDLGAVYSPEKTIFRVWSPVSKWVKVLLFKEDTEPYQVVNMEYKGNVWEAVVEGDLDGV
PULA_BACSU      ----------------------------------------------------------------------
PULA1_ARATH     ------------PLGAHFTPEGVSLHLWAPTAQAVSVCIYKDKSPMEICPLKEANG-VWSTEGACSWGGC
PULA_KLEPN      ----------------------------------------------------------------------
PULA_KLEAE      ----------------------------------------------------------------------
GLGB_RHOMR      -------------LGAHPDDEGTWFCVWAPHADGVSLGAFNDWNPEAN-PLERYGGGLWAGYVPGARPGH
GLGB_DECAR      -------------LGAHADISGTTFRVWAPNASRVSV-VGDFNGWHGDVPLGESG--VWEIAVAEAHTGN
GLGB2_STRCO     ----------------THEGTGTRFTVWAPNAQGVRVATDFTHWDGTAFPMRSLGSSVWELFLPGVGEGT
TREZ_RHIS1      ----------------------------------------------------------------------
BBMA1_BACSU     ----------------------------------------------------------------------
TREZ_ARTSQ      ----------------------------------------------------------------------
TREZ_BREHE      ----------------------------------------------------------------------
GLGB_ERWCH      ---------------STLDGVGTCFAVWAPNAQRVSVVGDFNFWDGRRHPMRRRENGVWELFVPGVGPGQ
BBMA2_BACSU     ----------------------------------------------------------------------
GLGB_VIBVU      --------------------SGIRFLVYAPHATAVSLVGSFNDWDGRRHPMQRLDYGIWGLFIPDLAEGV
TREZ_ARTRM      ----------------------------------------------------------------------
GLGB_MYXXD      ---------------------GTSFAVWAPTAAGVSV-VGDFNGWDGRLHSMRRMGSIWELFVPEVGEGT
GLGB_VIBVY      --------------------SGIRFLVYAPHATAVSLVGSFNDWDGRRHPMQRLDYGIWGLFIPGLTEGV
GLGB_RHILO      --------------------TGVHFAVWAPNAKRVSVVGFNDWDGRRHTMRDRRDTGIWEVFIPDIGAGR
GLGB_BACLD      -------------------------------------------GVLHRMEKRHQEG-IWELFIPGIGEGE
GLGB_NITEC      --------------------TGTRFAVWAPNAERVSV-VGDFNHWDGRVPMMARDSGVWELFIPDLPGGT
GLGB_VIBPA      ----------------------------------------------------------------------
GLGB_PSEF5      ------------------------------------------DGRRHPMRLRHPSG-VWELFIPRLQAGE
GLGB_PSEAE      ----------------------------------------------------------------------
GLGB_YERPS      ------------------------------------------DGRRHPMRLRRENG-IWELFLPGIEAGQ
GLGB_YERPP      ------------------------------------------DGRRHPMRLRRENG-IWELFLPGIEAGQ
GLGB_YERPN      ------------------------------------------DGRRHPMRLRRENG-IWELFLPGIEAGQ
GLGB_YERPE      ------------------------------------------DGRRHPMRLRRENG-IWELFLPGIEAGQ
GLGB_YERPA      ------------------------------------------DGRRHPMRLRRENG-IWELFLPGIEAGQ
GLGB_YERP3      ------------------------------------------DGRRHPMRLRRENG-IWELFLPGIEAGQ
GLGB_NITEU      --------------------TGTRFAVWAPNAERVSV-VGDFNRWDGRVYPMMVHGHVWELFIPDLPEGA
GLGB1_STRCO     ----------------THEGAGTRFAVWAPNARGVRVAFWDGTGHPMR---SLGSTGVWELFLPGVGAGE
GLGB_YERE8      ------------------------------------------DGRRHPMRLRRENG-IWELFLPGVQAGQ
GLGB_THICR      --------------------SGVQFSVWAPAASRVSVVGDFNGWNGLRHPMTNGQSGVWELFIPGMVSGD
GLGB_RHORT      ----------AHPM--TRDGRGTGFALWAPNATRVSV-IGDFNGWDGRLPMRAHPGSVWDIFLPGVVEGH
GLGB1_STRAW     ----ELWTA----LGATHQGPGTRFTVWAPNARGVRLAGTFNFWDATAFPLRSLGSSVWELFVPGVGEGE
GLGB_RUBXD      ---------------AEMDGCGTAFAVWAPNARRVSVVGDFNLWDGRRHPMRNRNG-VWEIFLPGVGPGA
GLGB_PSESM      ------------------------------------------DGRRHPMRLRHPTG-VWEIFVPRLQPGE
GLGB_MAGSA      ----------------------------------------------------------------------
GLGB_ERWCT      ----------------TLDGEGTRFAVWAPNAQRVSVVGQFNDGRRHPMRLRKENG-IWELFLPDVKAGQ
GLGB_PSEA7      ----------------------------------------------------------------------
GLGB_NITMU      ----------------------------------------------------------------------
GLGB_AZOSE      -------------LGCQLDEAGAHFAVWAPNARAVAVIAWRDDAAVLR-PRDDGSG-IWEGFVAGVAAGD
GLGB_VIBF1      ----------------------------------------------------------------------
GLGB_SYNR3      --------------------AGVQFCLWAPNARSVSVIGDCTNWDGRHLPMQQRIGGIWELFVPGLGAGA
GLGB_VIBCH      --------------------SGVRFLVYAPHAAACSLIGAFNHWDGRRHPMQRLDYGIWGIFIPGLPEGT
GLGB_PARUW      ---------------ATHQGQGVKFAVWAPNAKSVSLIADFNDGKVNPMRIMGYSG-VWELFVPGLQEGE
GLGB_RHOSR      ----------------TPDGTGTSFAVWAPNARGVSVIGDFDGWSGRNYPMRVLGSTVWELFVPGIEAGD
GLGB_RHOFD      ---------------------GANFAVWAPNAESVSVVGDWNSGNVDRLDLRDDGSGIWQGFVENAVRGQ
GLGB_PSEPF      ------------------------------------------DGRRHPMRLRHPSG-VWELFIPRLQAGE
GLGB_PSE14      ------------------------------------------DGRRHPMRLRHPTG-VWEIFVPRLQPGE
GLGB_PROAC      --------------------TGTRFAVWAPNAQAVEVISDFNWWTGDRMRLIPGSG-VWGTFVEGVDEGT
GLGB_DESVH      ----------------------------------------------------------------------
GLGB2_STRAW     ---------------------GTRFTVWAPNARGVRVCFCRWDGAAFPMRSLGSSG-VWELFVPGIGEGE
GLGB_SERP5      ------------------------------------------DGRRHPMRLRRENG-IWELFLPGVKAGQ
GLGB_DESVV      ----------------------------------------------------------------------
GLGB_PSEPK      ----------------------------------------------------------------------
GLGB_DICDI      ----------------------------------------------------------------------
GLGB_BACCL      ---------------------GTRFCVWAPHAREVRLVGSFNDWNGTNSPLTKNDEGVWTIVVPENLEGH
GLGB_DEIRA      ---------------------GVRFAVWAPNAQHVSVVGDFNDWNGFDHPLQRLDFGFWGAFVPAAQPGQ
GLGB1_XANAC     ---------------------GTRFAVWAPNASRVAVVGDFNSWDARRHPLRHQSG-VWELFVPDVGPGA
GLGB_THEFY      ------------------DTEGTAFTVWAPNARGVRVIGDFNHWDGTGHPMRSLGSGVWELFIPGVGDGT
GLGB_PROMP      -------------------------------------------------PMQKRLGGIWELFMPIMKEGD
GLGB_NOCFA      ----------------TLDGSGTSFAVWAPNARGVTVIGDFDGWSGNTAPMRALGSGVWEVFVPDVGSGT
GLGB_MYCPA      ----------------TADGTGVSFAVWAPNAKGISLIGEFNGWTGTEAPMRVLGSSVWELFWPDFPIGG
GLGB_CRYNE      ---------------------GVRYREWASNATEARLIGEFNNWSHTANPMTKSPFGVWECYVPPVSPG-
GLGB1_XANCP     ---------------------GTRFAVWAPNASRVAVVGDFNSWDARRHPMRRHQAGVWELFVPDVGPGA
GLGB1_XANC8     ---------------------GTRFAVWAPNASRVAVVGDFNSWDARRHPMRRHQAGVWELFVPDVGPGA
GLGB_YARLI      ----------------------------------------------------------------------
GLGB_NEIDE      ----------------------------------------------------------------------
GLGB_SALRD      ---------HSYEMGAHPNQRGTWFGVWAPNADRVEVTGDFNDWRFGADVLDRREGGLWEGYVRGAQPGD
GLGB_NITOC      ---------------------------------------------------------VWELFIPGLKPGT
GLGB_RALSO      ------------------DVAGVRFAVWAPNARRVSVVGDFNQWDGRRHPMRLRHGTVWELFVPAAGPGS
GLGB_MYCTU      ----------------TADGSGVSFAVWAPNAKGVSLIFNGWNGHEAPMRVLGPSG-VWELFWPDFPCDG
GLGB_MYCTA      ----------------TADGSGVSFAVWAPNAKGVSLIFNGWNGHEAPMRVLGPSG-VWELFWPDFPCDG
GLGB_MYCBP      ----------------TADGSGVSFAVWAPNAKGVSLIFNGWNGHEAPMRVLGPSG-VWELFWPDFPCDG
GLGB_MYCBO      ----------------TADGSGVSFAVWAPNAKGVSLIFNGWNGHEAPMRVLGPSG-VWELFWPDFPCDG
GLGB_BUTFI      ----------------------------------------------------------------------
GLGB_BURVG      ---------------------------------------------------------VWELFVPGIGPGE
GLGB_ACTP2      --------------------SGVHFSVWAPNARRVSVVGDFNDGRVNPMRFHAESG-IWDIFLPNVEKGA
GLGB2_XANOM     ---------------------GTRFAVWAPNASRVAVVGDFNSWDARRHPLRHQSG-VWELFVPDVGPGA
GLGB_PROM9      -------------------------------------------------PMQKRLGGIWELFMPTMEEGD
GLGB1_XANOR     ---------------------GTRFAVWAPNASRVAVVGDFNSWDARRHPLRHQSG-VWELFVPDVGPGA
GLGB_HAEIN      -------------LGAHFDGSGVNFRLWAPNARRVSIVGDFNDGRRHPMRFHSKSG-VWELFLPKASLGQ
GLGB_CELJU      ---------------------------------------------------------LWELFIPGVQPGD
GLGB_ACTPJ      --------------------SGVHFSVWAPNARRVSVVGDFNDGRVNPMRFHAESG-IWDIFLPNVEKGA
GLGB_ACTP7      --------------------SGVHFSVWAPNARRVSVVGDFNDGRVNPMRFHAESG-IWDIFLPNVEKGA
GLGB_RHOBA      ---------------------GVNFAVWAPNARSVQV-VGDFNGWDGRGHVAQESTGIWELFLPGATVGQ
GLGB_MYCUA      ----------------TADGHGVSFAVWAPNAEGVSLIFNGWSGSEAPMRVLGSSG-VWELFWPDFPADG
GLGB_METFK      ----------------------------------------------------------------------
GLGB_METCA      ----------------------------------------------------------------------
GLGB_CHLPN      ------------------------------------------------------DQGIWELFVPGLGEGI
GLGB_ALHEH      ----------------------------------------------------------------------
GLGB_PSEU2      ----------------------------------------------------------------------
GLGB_ORYSJ      ----------------------------------------------------------------------
GLGB_LACPL      ---------------------------------------------------------IWQGQVPNVHAGQ
GLGB_HAEIG      -------------LGAHFDGSGVNFRLWAPNARRVSIVGDFNDGRRHPMRFHSKSG-VWELFLPKASLGQ
GLGB_BURTA      -----------------HDGEGTAFALWAPNASCVSVVSFNGWDARVHAMRKRIECGVWELFVPGVGCGA
GLGB2_XANCP     -----------------------------------------------RHPMRQRSGGIWELVLPRVETGA
GLGB2_XANC8     -----------------------------------------------RHPMRQRSGGIWELVLPRVETGA
GLGB_PROMA      -----------------------------DLVEGVMFCLWAPNARSVSVPMQKRLGGIWELFIPHIKKGD
GLGB_MAIZE      ----------------------------------------------------------------------
GLGB_JANSC      ----------------------------------------------------------------------
GLGB_HAEI8      -------------LGAHFDGSGVNFRLWAPNARRVSIVGDFNDGRRHPMRFHPKSG-VWELFLPKASLGQ
GLGB2_XANAC     ------------------DVPGVRFALWAPHAQRVAV-VGDFNGWDVRRPMRQRIGGFWELFLPRVDAGA
GLGB_TRIEI      -------------------------------------------------------GHVWELFIPDIGPGE
GLGB_PHOPR      ----------------------------------------------------------------------
GLGB_OCEIH      ---------------------GYRFAVWAPNA--LKVCVVGDNWEENSHPLEKTDEGLWGGFIADIPPAT
GLGB_DESDG      ---------------------------------------------------------IWAGFVAGMEYGR
GLGB_BURCH      -------------LGATPDTDGVRFAVWAPSAQRVSVVGDFNDGRRHPMRLRRPSG-VWELFVPGIGAGE
GLGB_BURCA      -------------LGATPDTDGVRFAVWAPSAQRVSVVGDFNDGRRHPMRLRRPSG-VWELFVPGIGAGE
GLGB_AQUAE      ----------------------------------------------------------------------
GLGB2_XANOR     -----------------------------------------------RHPMRQRIGGFWELFLPRVEAGP
GLGB1_XANOM     -----------------------------------------------RHPMRQRIGGFWELFLPRVEAGP
GLGB_STRAU      --------------------AGTRFTVWAPNALGVRVTGDFSYWDAVAYPMRSLGASVWELFLPGVAEGA
GLGB_PSEA6      ----------------------------------------------------------------------
GLGB_PASMU      ----------------------------------------------------------------------
GLGB_HAES2      --------------------AGVNFRLWAPNAKRVSVVGDFNYWDGRRHPMRHQSSGIWELFLPKVSLGQ
GLGB_HAES1      --------------------AGVNFRLWAPNAKRVSVVGDFNYWDGRRHPMRHQSSGIWELFLPKVSLGQ
GLGB_FUSNN      ----------------------------------------------------------------------
GLGB_FELCA      ----------------------------------------------------------------------
GLGB_EMENI      ----------------------------------------------------------------------
GLGB_CORJK      -------------LGAHVVDGGVAFSVWAPHAAGVSVIGDFNGWNANQHPLRALGSSIWELWIPSVSAGA
GLGB_ASPOR      ----------------------------------------------------------------------
GLGB_ASHGO      ----------------------------------------------------------------------
GLGB_RHIME      ----------------------------------------------------------------------
GLGB_PICTO      ----------------------------------------------------------------------
GLGB_DEIGD      -------------------------------------------------PMQRLDFGFWGAFVPSARPGQ
GLGB_DEBHA      ----------------------------------------------------------------------
GLGB_SYNJB      ----------------TVDGKGVHFAVWAPNARNVSVIFNHWDGRQHQMKRLGESG-IWAVFIPGIGPGA
GLGB_BURCM      ---------------------------------------------------------VWELFVPGIGAGE
GLGB1_XANC5     ---------------------GTRFAVWAPNASRVAVVGDFNSWDARRHPMRRHQAGVWELFVPDVGPGA
GLGB_BURXL      ------------------------------------------DGRRHPMRLRHQAG-VWELFVPRVGPGT
GLGB_LEIXX      ----------------------------------------------------------------------
GLGB_LACS1      ----------------------------------------------------------------------
GLGB_BACSU      --------------------SGYEFCVWAPHASEVRVAGFNSWSGEEHVMHRVNDNGIWTLFIPGIGEKE
GLGB2_CLOPE     ----------------------------------------------------------------------
NEPU_BACST      ----------------------------------------------------------------------
GLGB_PROM5      ----------------------------------------------------------------------
GLGB_PROM4      -------------------------------------------------PMQKRMGGIWELFIPGLKEGA
GLGB_MANSM      ----------------------------------------------------------------------
GLGB_FRASC      ------------PGGATV--TGVSFAVWAPSARGVRLVGDFDDGRAFPMRSLGRSG-IWELFVPGAGTGA
GLGB_CHLTR      ----------------------------------------------------------------------
GLGB_CHLTA      ----------------------------------------------------------------------
GLGB_ACTSZ      ----------------------------------------------------------------------
GLGB2_XANC5     ----------------------------------------------------------------------
GLGB_SYNJA      ----------AHPISV--DGQGVHFAVWAPNARNVSVIFNHWDGRQHQMKRLGESG-IWAVFIPGVGPGA
GLGB_ROSDO      ----------------------------------------------------------------------
GLGB2_RHIL3     ------------------------------------------DGRRNPMRLRPSAG-VWELFIPRLAPGE
GLGB2_RHIEC     ------------------------------------------DGRRNPMRLRQSAG-VWELFMPRLAPGE
GLGB2_CLOPS     ----------------------------------------------------------------------
GLGB_MYCSS      ----------------------------------------------------------------------
GLGB_MYCSK      ----------------------------------------------------------------------
GLGB_HORSE      ----------------------------------------------------------------------
GLGB_CHLTB      ----------------------------------------------------------------------
GLGB_CHLT2      ----------------------------------------------------------------------
GLGB_MYCSJ      ----------------------------------------------------------------------
GLGB_MOUSE      ----------------------------------------------------------------------
GLGB_BACST      ----------------------------------------------------------------------
GLGB_AGRT5      ----------------------------------------------------------------------
GLGB_SYNPW      -------------------------------------------------PMQQRLGGIWELFVPGLAEGQ
GLGB_HUMAN      ----------------------------------------------------------------------
GLGB_GRABC      ----------------------------------------------------------------------
GLGB_GLOIN      ----------------------------------------------------------------------
GLGB1_RHIEC     ----------------------------------------------------------------------
GLGB_STRR6      ---------------------GYTFRVWAPNAQAVHLVGDFTNWIENQIPMVRNDFGVWEVFTNMAQEGH
GLGB_STRP2      ---------------------GYTFRVWAPNAQAVHLVGDFTNWIENQIPMVRNDFGVWEVFTNMAQEGH
GLGB_STRA3      ----------------------------------------------------------------------
GLGB_CITK8      ----------------------------------------------------------------------
GLGB_YEAST      ----------------------------------------------------------------------
GLGB_SOLTU      ----------------------------------------------------------------------
GLGB_RHIRD      ----------------------------------------------------------------------
GLGB_PROMT      -------------------------------------------------PMQKRLGGIWELFIPGLSEGD
GLGB_MESSB      ----------AHPMAC--DGDGTRFAVWAPNASRVSVVFNNWDGRRHQMRLHPGIG-VWEIFVPGAKPGN
GLGB_MARAV      ----------------------------------------------------------------------
GLGB_KLULA      ----------------------------------------------------------------------
GLGB_CLOP1      ----------------------------------------------------------------------
GLGB_CHLCV      ----------------------------------------------------------------------
GLGB1_RHIL3     ----------------------------------------------------------------------
AMY3_DICT6      ----------------------------------------------------------------------
GLGB_STRPN      ---------------------GYTFRVWAPNAQAVHLVGDFTNWIENQIPMVRNDFGVWEVFTNMAQEGH
GLGB_RALEJ      ----------------------------------------------------------------------
TREZ_MYCTU      ----------------------------------------------------------------------
GLGB_NOVAD      ---------------------GVHFAVWAPNARLVSVVGDFNDWDHRRHPMRRRDIGVWEIFIPDIGEHR
GLGB_CHLMU      ----------------------------------------------------------------------
GLGB_CHLAB      ----------------------------------------------------------------------
GLGB_STRA5      ----------------------------------------------------------------------
GLGB_STRA1      ----------------------------------------------------------------------
GLGB_RALEH      ----------------------------------------------------------------------
GLGB_PROM1      -------------------------------------------------PMQKRLGGIWELFIPGLSEGD
GLGB_COREF      ---------------------GTAFAVWAPNAIGVAVIGFNGWNASQHAMRSLGGSGIWELFIPNIGPGE
CDAS_THEP3      ----------------------------------------------------------------------
CDAS_BACSH      ----------------------------------------------------------------------
GLGB_SACD2      ----------------------------------------------------------------------
GLGB_GLOVI      ----------------------------------------------------------------------
GLGB_THIDA      ---------------------------------------------------------VWELFIPGLEAGH
GLGB_SYNSC      --------------------------------TGVMFCLWAPNALSVSVPMQQRVGGIWELFVPGLEEGH
GLGB_SHIBS      ----------------TMDGTGTRFSVWAPNARRVSVVGQFNDGRRHPMRLRKESG-IWELFIPGAHNGQ
GLGB_SALAR      ----------------TMDGTGTRFSVWAPNARRVSVVGQFNDGRRHPMRLRKESG-IWELFIPGAHNGQ
GLGB_KLEP7      ----------------------------------------------------------------------
GLGB_SYNPX      --------------------SGVMFCLWAPHALSVSILGDLNSWDGRHHPMQQRLGGIWELFIPGLAEGS
GLGB_SHEB9      ----------------------------------------------------------------------
GLGB_SHEB8      ----------------------------------------------------------------------
GLGB_SHEB5      ----------------------------------------------------------------------
GLGB_SHEB2      ----------------------------------------------------------------------
GLGB_RHOS1      ---------------------GVSFAVWAPNARRVSVVGAFNAWDGRRHPMRKRIGGVWELFVPGLHTGD
GLGB_FRAP2      ----------------------------------------------------------------------
GLGB_ENT38      ----------------------------------------------------------------------
GLGB_ECOL6      ----------------TMDGTGTRFSVWAPNARRVSVVGQFNDGRRHPMRLRKESG-IWELFIPGAHNGQ
GLGB_SHISS      ----------------TMDGTGTRFSVWAPNARRVSVVGQFNDGRRHPMRLRKESG-IWELFIPGAHNGQ
GLGB_SHIFL      ----------------TMDGTGTRFSVWAPNARRVSVVGQFNDGRRHPMRLRKESG-IWELFIPGAHNGQ
GLGB_SHIF8      ----------------TMDGTGTRFSVWAPNARRVSVVGQFNDGRRHPMRLRKESG-IWELFIPGAHNGQ
GLGB_SHIDS      ----------------TMDGTGTRFSVWAPNARRVSVVGQFNDGRRHPMRLRKESG-IWELFIPGAHNGQ
GLGB_PROMS      ----------------------------------------------------------------------
GLGB_PROM2      ----------------------------------------------------------------------
GLGB_PROM0      ----------------------------------------------------------------------
GLGB_ECOUT      ----------------TMDGTGTRFSVWAPNARRVSVVGQFNDGRRHPMRLRKESG-IWELFIPGAHNGQ
GLGB_ECOLI      ----------------TMDGTGTRFSVWAPNARRVSVVGQFNDGRRHPMRLRKESG-IWELFIPGAHNGQ
GLGB_ECOLC      ----------------TMDGTGTRFSVWAPNARRVSVVGQFNDGRRHPMRLRKESG-IWELFIPGAHNGQ
GLGB_ECOL5      ----------------TMDGTGTRFSVWAPNARRVSVVGQFNDGRRHPMRLRKESG-IWELFIPGAHNGQ
GLGB_ECOK1      ----------------TMDGTGTRFSVWAPNARRVSVVGQFNDGRRHPMRLRKESG-IWELFIPGAHNGQ
GLGB_ECOHS      ----------------TMDGTGTRFSVWAPNARRVSVVGQFNDGRRHPMRLRKESG-IWELFIPGAHNGQ
GLGB_ECO24      ----------------TMDGTGTRFSVWAPNARRVSVVGQFNDGRRHPMRLRKESG-IWELFIPGAHNGQ
GLGB_CORDI      ------------------DVEGTAFAVWAPNASGVAVIGDFCGWNPSQYPMRSLGSTIWELFIPNIGVGT
GLGB1_CLOPE     ----------------------------------------------------------------------
GLGB_RHOS4      ---------------------GVSFAVWAPNARRVSVVGAFNAWDGRRHPMRKRIGGVWELFVPGLHTGD
GLGB_HALOH      ----------------------------------------------------------------------
GLGB_CANGA      ----------------------------------------------------------------------
GLGB1_CLOPS     ----------------------------------------------------------------------
GLGB_STRMU      ----------------------------------------------------------------------
GLGB_SALTI      ----------------TMDGTGTRFSVWAPNARRVSVVGQFNDGRRHPMRLRKESG-IWELFIPGAHNGQ
GLGB_SALPB      ----------------TMDGTGTRFSVWAPNARRVSVVGQFNDGRRHPMRLRKESG-IWELFIPGAHNGQ
GLGB_SALCH      ----------------TMDGTGTRFSVWAPNARRVSVVGQFNDGRRHPMRLRKESG-IWELFIPGAHNGQ
GLGB_FRATW      ----------------------------------------------------------------------
GLGB_FRATT      ----------------------------------------------------------------------
GLGB_FRATN      ----------------------------------------------------------------------
GLGB_FRATM      ----------------------------------------------------------------------
GLGB_FRAT1      ----------------------------------------------------------------------
GLGB_ECO57      ----------------TMDGTGTRFSVWAPNARRVSVVGQFNDGRRHPMRLRKESG-IWELFIPGAHNGQ
GLGB_CHLFF      ----------------------------------------------------------------------
GLGB_SYNS9      ----------------------------------------------------------------------
GLGB_STRSV      --------------------SGYSFRVWAPNAQSVHLIGDFTNWYEEQIPMVRNEAGVWEVFTELPKEGD
GLGB_SALTY      ----------------TMDGTGTRFSVWAPNARRVSVVGQFNDGRRHPMRLRKESG-IWELFIPGAHNGQ
GLGB_FRATO      ----------------------------------------------------------------------
GLGB_FRATH      ----------------------------------------------------------------------
GLGB_FRATF      ----------------------------------------------------------------------
GLGB_CORGL      ----------------------------------------------------------------------
MGTA_THEMA      ----------------------------------------------------------------------
GLGB_STRGC      ----------------------------------------------------------------------
GLGB_RHOPB      -----------------------------------------------RHPMRVRGSGYWELFVPRALAGD
GLGB_PROMM      ----------------------------------------------------------------------
GLGB_PROM3      ----------------------------------------------------------------------
GLGB_THEEB      ----------------TVDGEGVYFAVWAPNARNVSVIGDFNHWDGRKHQMARRGNGIWELFIPGLSVGE
GLGB_NITHX      ----------------------------------------------------------------------
GLGB_SYNS3      -------------------------------------------------PMQQRLGGIWELFVPELEEGH
GLGB_SHEON      ----------------------------------------------------------------------
GLGB_SALPA      ----------------TMDGTGTRFSVWAPNARRVSVVGQFNDGRRHPMRLRKESG-IWELFIPGAHNGQ
GLGB_BIFLO      ---------------------------------------------------------VWEIFIPGIGAGE
AMYM_BACAD      ----------------------------------------------------------------------
MGTA_THENE      ----------------------------------------------------------------------
GLGB_RHOP2      ----------------------------------------------------------------------
GLGB_SHEPC      ----------------------------------------------------------------------
GLGB_RHOPA      ----------------------------------------------------------------------
GLGB_SYNP6      ----------------------------------------------------------------------
GLGB_SYNE7      ----------------------------------------------------------------------
GLGB_SHESR      ----------------------------------------------------------------------
GLGB_SHESM      ----------------------------------------------------------------------
GLGB_LACAC      ----------------------------------------------------------------------
GLGB_DESHY      ----------------------------------------------------------------------
CDGT_BACST      ----------------------------------------------------------------------
O16G2_BACSU     ----------------------------------------------------------------------
GLGB_SYNY3      ----------------TVDGKGVYFAVWAPNARNVSI-LGDFNNWDGRLQMRKRNNMVWELFIPELGVGT
GLGB_SHEFN      ----------------------------------------------------------------------
GLGB_NITWN      ----------------------------------------------------------------------
GLGB_SHESW      ----------------------------------------------------------------------
GLGB_RHOPS      ----------------------------------------------------------------------
GLGB_RHOP5      ----------------------------------------------------------------------
GLGB_BURPS      ----------------------------------------------------------------------
GLGB_BURP6      ----------------------------------------------------------------------
GLGB_BURP1      ----------------------------------------------------------------------
GLGB_BURP0      ----------------------------------------------------------------------
GLGB_ANAVT      ----------------------------------------------------------------------
GLGB_BURS3      ----------------------------------------------------------------------
GLGB_BACWK      ----------------------------------------------------------------------
NEPU2_THEVU     ----------------------------------------------------------------------
AMY_BACSU       ----------------------------------------------------------------------
AMYB_PAEPO      ----------------------------------------------------------------------
GLGB_BRASB      -----------------------------------------------RHPMRVRGNGYWELFIPRAKAGD
GLGB_BRAJA      ----------------------------------------------------------------------
GLGB_BORPA      ---------------ASVDGAGTRFALWAPNARRVAVVFNGWDGRRHAMRLRYPAG-VWELFLPDVGPGA
GLGB_ANASP      ----------------------------------------------------------------------
GLGB_BORBR      ---------------ASVDGAGTRFALWAPNARRVAVVFNGWDGRRHAMRLRYPAG-VWELFLPDVGPGA
GLGB_BACCN      ----------------------------------------------------------------------
GLGB_BORPE      ---------------ASVDGAGTRFALWAPNARRVAVVFNGWDGRRHAMRLRYPAG-VWELFLPDVGPGA
GLGB_BACCZ      ----------------------------------------------------------------------
GLGB_BACCR      ----------------------------------------------------------------------
GLGB_BACCQ      ----------------------------------------------------------------------
GLGB_BACC4      ----------------------------------------------------------------------
GLGB_BACC1      ----------------------------------------------------------------------
GLGB_BACAN      ----------------------------------------------------------------------
GLGB_BACAC      ----------------------------------------------------------------------
GLGB_BACAA      ----------------------------------------------------------------------
GLGB_BACHK      ----------------------------------------------------------------------
GLGB_BACC3      ----------------------------------------------------------------------
GLGB_BACC0      ----------------------------------------------------------------------
GLGB_BACC7      ----------------------------------------------------------------------
GLGB_BACC2      ----------------------------------------------------------------------
CDGT_BACS8      ----------------------------------------------------------------------
CDGT_BACS2      ----------------------------------------------------------------------
CDGT_BACS0      ----------------------------------------------------------------------
CDGT2_BACCI     ----------------------------------------------------------------------
AMY2_DICT6      ----------------------------------------------------------------------
CDGT_THETU      ----------------------------------------------------------------------
AGL_PEDPE       ----------------------------------------------------------------------
O16G1_BACSU     ----------------------------------------------------------------------
CDGT_BACS3      ----------------------------------------------------------------------
CDGT_BAC11      ----------------------------------------------------------------------
APU_THEP3       ----------------------------------------------------------------------
AMY1_DEBOC      ----------------------------------------------------------------------
AMYM_BACST      ----------------------------------------------------------------------
AMY2A_ORYSJ     ----------------------------------------------------------------------
AMY2A_ORYSI     ----------------------------------------------------------------------
MDE5_SCHPO      ----------------------------------------------------------------------
AMY3E_ORYSJ     ----------------------------------------------------------------------
AMY3A_ORYSJ     ----------------------------------------------------------------------
AMY_ASPSH       ----------------------------------------------------------------------
AMYB_ASPAW      ----------------------------------------------------------------------
AMYA_ASPAW      ----------------------------------------------------------------------
AMYA3_ASPOR     ----------------------------------------------------------------------
AMYA1_ASPOR     ----------------------------------------------------------------------
AMY_STRLI       ----------------------------------------------------------------------
CDGT_BACLI      ----------------------------------------------------------------------
AMY_STRHY       ----------------------------------------------------------------------
AMY2_HORVU      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RYGYRVHGPYDPERGLRCNPNKLLVDPYAKAIDGQIHWHESLFDYHFADPGRVNNHDSAPYVPTCVVVSP
GLGX_MYCTU      RYGFRVHGPFDPAAGHRCDPSKLLLDPYGKSFHGDFTFGQALYSYNAVDPDSTPPMDSLGHTMTSVVINP
GLGX_MYCBO      RYGFRVHGPFDPAAGHRCDPSKLLLDPYGKSFHGDFTFGQALYSYNAVDPDSTPPMDSLGHTMTSVVINP
GLGX_ENT38      RYGFRVHGPWQPEYGLRFNPAKLLIDPCALRVDGDVKDDPLFLDGEQQPDPR----DSAAIAPRSVVVSD
GLGX_SERP5      RYGYRVHGPFDPAQGLRFNPNKLLLDPAARAVEGPV----ADDPYLHGGYDRPDRHDSAELMPKCVVIDE
GLGX_SHIDS      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLYAGH----NEPDYRDNAAIAPKCVVVVD
GLGX_ECO81      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGH----NEPDYRDNAAIVPKCVVVVD
GLGX_SHIBS      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGH----NEPDYRDNAAIAPKCVVVVD
GLGX_ECOLU      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGH----NEPDYRDNAAIAPKCVVVVD
GLGX_ECOLI      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGH----NEPDYRDNAAIAPKCVVVVD
GLGX_ECODH      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGH----NEPDYRDNAAIAPKCVVVVD
GLGX_ECOBW      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGH----NEPDYRDNAAIAPKCVVVVD
GLGX_ECO8A      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGH----NEPDYRDNAAIAPKCVVVVD
GLGX_ECO5E      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGH----NEPDYRDNAAIAPKCVVVVD
GLGX_ECO57      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGH----NEPDYRDNAAIAPKCVVVVD
GLGX_ECO7I      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGH----NEPDYRDNAAIAPKCVVVVD
GLGX_SHIB3      RYGYRVHGPWQPADGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGH----NEPDYRDNAAIAPKCVVVVD
GLGX_ECOSE      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGH----NEPDYRDNAAIAPKCVVVVD
GLGX_ECOLC      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGH----NEPDYRDNAAIAPKCVVVVD
GLGX_ECOHS      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGH----NEPDYRDNAAIAPKCVVVVD
GLGX_ECO27      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGH----NEPDYRDNAAIAPKCVVVVD
GLGX_ERWT9      RYGYRVHGPWQPQQGLRFNPAKLLLDPCARGIEGEVT-DNPCFQSGEEQPDTL---DSGPLAPKGVVLAD
GLGX_ECO55      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIEGEFKDNPLLHAGH----NEPDYRDNAAIAPKCVVVVD
GLGX_ECO24      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGH----NEPDYRDNAAIAPKCVVVVD
GLGX_SHIFL      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGH----NEPDYRDNAAIAPKCVVVVD
GLGX_SHIF8      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGH----NEPDYRDNAAIAPKCVVVVD
GLGX_ECOSM      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGH----NEPDYRDNAAIAPKCVVVVD
GLGX_ECOL5      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGH----NEPDYRDNAAIAPKCVVVVD
GLGX_ECOL6      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGH----NEPDYRDNASIAPKCVVVVD
GLGX_ECOUT      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGH----NEPDYRDNASIAPKCVVVVD
GLGX_ECOK1      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGH----NEPDYRDNASIAPKCVVVVD
GLGX_ECO45      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGH----NEPDYRDNASIAPKCVVVVD
GLGX_SHISS      RYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIEGEFKDNPLLHAGH----NEPDYRDNAAIAPKCVVVVD
GLGX_ESCF3      RYGYRVHGPWQPAAGHRFNPAKLLIDPCARRVEGDLH-DNPLFHAGYETP---DSRDNATIAPKCVVVSD
GLGX_KLEP7      RYGYRVHGPWDPAQGHRFNPAKLLIDPSAHRVEGDLPDDERLHGGMWQPDRR----DSAAVAPKSQVVDL
GLGX_KLEP3      RYGYRVHGPWDPAQGHRFNPAKLLLDPCAYRVEGDLPDDERLHGGMWEPDHR----DSAAIAPKSQVVDL
GLGX_SALPB      RYGYRVHGPWQPAQGHRFNPAKLLLDPYARRVEGELKDHPLLHGGHDEPDYR----DNAAVAPKSVVISD
GLGX_SALPK      RYGYRVHGPWQPAQGHRFNPAKLLLDPYARRVEGELKDHPLLHGGHDEPDYR----DNAAVAPKSVVISD
GLGX_SALPA      RYGYRVHGPWQPAQGHRFNPAKLLLDPYARRVEGELKDHPLLHGGHDEPDYR----DNAAVAPKSVVISD
GLGX_SALTY      RYGYRVHGPWQPAQGHRFNPAKLLLDPYARRVEGELKDHPLLHGGHDEPDYR----DNAAVAPKSVVISD
GLGX_SALPC      RYGYRVHGPWQPAQGHRFNPAKLLLDPYARRVEGELKDHPLLHGGHDEPDYR----DNAAVAPKSVVISD
GLGX_SALNS      RYGYRVHGPWQPAQGHRFNPAKLLLDPYARRVEGELKDHPLLHGGHDEPDYR----DNAAVAPKSVVISD
GLGX_SALHS      RYGYRVHGPWQPAQGHRFNPAKLLLDPYARRVEGELKDHPLLHGGHDEPDYR----DNAAVAPKSVVISD
GLGX_SALDC      RYGYRVHGPWQPAQGHRFNPAKLLLDPYARRVEGELKDHPLLHGGHDEPDYR----DNAAVAPKSVVISD
GLGX_SALCH      RYGYRVHGPWQPAQGHRFNPAKLLLDPYARRVEGELKDHPLLHGGHDEPDYR----DNAAVAPKSVVISD
GLGX_SALSV      RYGYRVHGPWQPAQGHRFNPAKLLLDPYARRVEGELKDHPLLHGGHDEPDYR----DNAAVAPKSVIISD
GLGX_SALEP      RYGYRVHGPWQPAQGHRFNPVKLLLDPYARRVEGELKDHPLLHGGHDEPDYR----DNAAVAPKSVVISD
GLGX_SALA4      RYGYRVHGPWQPAQGHRFNPAKLLLDPYARRVEGELKDHPLLHGGHDEPDYR----DNAAVAPKSVIISD
GLGX_SALTI      RYGYRVHGPWQPAQGHRFNPAKLLLDPYARQVEGELKDHPLLHGGHDEPDYR----DNAAVAPKSVVISD
GLGX_YERE8      RYGYRVSGPFNPQQGHRFNPHKLLIDPYARALDRKVGDDPSLQ----GGVSQPDYRDSAAVAPKCIVVHE
GLGX_SALG2      RYGYRVHGPWQPVQGHRFNPAKLLLDPYARRVEGELKDHPLLHGGHDEPDYR----DNAAVAPKSVVISD
GLGX_CITK8      RYGYRVHGPWQPAQGHRFNPAKLLIDPCARRVEGELK-DNPLLHGGYDEP---DHRDNAAVALKCVVTAD
GLGX_PECCP      RYGFRVDGPFEPSQGLRFNPHKLLLDPCARQLDGWVVDDDCLQ----GGIDQRDERDSADIMAKCVVTAE
GLGX_YERPB      RYGYRVSGPFDPSRGHRFNPHKLLIDPRARALEGKVG-DDPRFTGGVSQP---DVRDSAAALPKCLVIHE
GLGX_YERPY      RYGYRVSGPFDPSRGHRFNPHKLLIDPRTRALEGKVG-DDPRFTGGVSQP---DVRDSAAALPKCLVIHE
GLGX_YERPS      RYGYRVSGPFDPSRGHRFNPHKLLIDPRTRALEGKVG-DDPRFTGGVSQP---DVRDSAAALPKCLVIHE
GLGX_ERWCT      RYGFRVDGPFEPSQGLRFNPHKLLLDPCARQLDGWVVDDASLQ----GGIDQRDERDSAEIMAKCVVTAE
GLGX_ENTS8      RYGYRVHGPWNPAQGHRFNPAKLLLDPCARGVEGDVIDDPRLYG-GIDTPDPRDNRDA---MPKSVVMDD
GLGX_YERP3      RYGYRVSGPFDPSRGHRFNPHKLLIDPRTRALEGKVG-DDPRFTGGVSQP---DVRDSAAALPKCLVIHE
GLGX_YERPG      RYGYRVSGPFEPSRGHRFNPHKLLIDPRTRALEGKVG-DDPRFTGGVSQP---DVRDSAAALPKCLVIHE
GLGX_YERPP      RYGYRVSGPFEPSRGHRFNPHKLLIDPRTRALEGKVG-DDPRFTGGVSQP---DVRDSAAALPKCLVIHE
GLGX_YERPN      RYGYRVSGPFEPSRGHRFNPHKLLIDPRTRALEGKVG-DDPRFTGGVSQP---DVRDSAAALPKCLVIHE
GLGX_YERPE      RYGYRVSGPFEPSRGHRFNPHKLLIDPRTRALEGKVG-DDPRFTGGVSQP---DVRDSAAALPKCLVIHE
GLGX_YERPA      RYGYRVSGPFEPSRGHRFNPHKLLIDPRTRALEGKVG-DDPRFTGGVSQP---DVRDSAAALPKCLVIHE
GLGX_ERWCH      CYGYRVDGAFDPSRGQRFNANKLLLDPCARQMDGWVVDDQRLHGYHQPDPS-----DSAEVMPPSVVVDE
GLGX_HAEIN      EYAFRIHGEF-------ANPQKLILDPYAKAVNGKLSSEESRSWFLLSD-----NRDNAHLAPRAVVISE
ISOA3_ARATH     LYGYRVDGPGEWQQGHRFDRSILLLDPYAKLVKGHSSFGDS--SQKFAQFYGTYDFESSP----------
ISOA1_ARATH     LYGYRFDGKFSPEEGHYYDSSNILLDPYAKAIISRDEF------------GVLGPDDNCWPQMACMVPTE
ISOA_FLASP      YYGYRAWGPNWPNAGNRFNPNKLLLDPYAREISQDPNTATCADGTIYATGAAHRNKDSGLCASKGIALAA
ISOA_PSEUM      YYGYRAWGPNWPANGDRFNPNKLLLDPYAQEVSQDPLNPSNQNGNVFASGASYRTTDSGIYAPKGVVLVP
ISOA_PSEAY      YYGYRAWGPNWPANGDRFNPNKLLLDPYAQEVSQDPLNPSNQNGNVFASGASYRTTDSGIYAPKGVVLVP
ISOA2_ARATH     RYGYRCKETAHSKEDVDVEGEPIVLDPYATVVGKSV---------------------SQKYLGS-LSKSP
PULA_THEMA      FYLYQLEN---------YGKIRTTVDPYSKAV-------------------YANSKKSA--VVNLARTNP
PULA_BACSU      ---------------------------YAVTVTGDLHGYEYLFCIQYAKAVTVNGEKG-------VVLRP
PULA1_ARATH     YYVYKVSVYHPSTMKLECYAN----DPYARGLDGRKTFLVNLDSDDLKPEGWDNLADKKPCLRS------
PULA_KLEPN      ----------------------------------------------------------------------
PULA_KLEAE      ----------------------------------------------------------------------
GLGB_RHOMR      TYKYRIHGFYQADK----------TDPYAFAMESPIEGLASIIDYTWHDD--------------------
GLGB_DECAR      LYRFEITNRHTGDKLIKS-------DPYGRGFELR--------------PG------SAAYVPPSMHVWG
GLGB2_STRCO     RYKFEIHSRY--------GHRFLKADPMARAAE-------------------------EPPNTASVVTAS
TREZ_RHIS1      ----------------------------------------------------------------------
BBMA1_BACSU     ----------------------------------------------------------------------
TREZ_ARTSQ      ----------------------------------------------------------------------
TREZ_BREHE      -------------------------------------------------PAGVHNH-SRTYNP------P
GLGB_ERWCH      LYKFEI---------IDCYGNVLVKDPYA-----------------FESQMRPDTASVVSRLPPALPVDE
BBMA2_BACSU     ----------------------------------------------------------------------
GLGB_VIBVU      SYKFEMKGPKGEGLPHKADPWGFYAEQYPS----------------FASV----TYDHARY---------
TREZ_ARTRM      ----------------------------------------------------------------------
GLGB_MYXXD      RYKFEIR----PGQG---GPNVLKADPFAFRTE--------------VPPATASVHDLARYT--------
GLGB_VIBVY      SYKFEMKGPKGEGLPHKADPWGFYAEQYPS----------------FASV----TYDHARY---------
GLGB_RHILO      PYKYEIIGP----DGVRL---PLKADPFA--------FKSELRXXXXXXXXXXXXHD-------------
GLGB_BACLD      LYKY--------EMITAANETKLKADPYA--FFSEVRPKTASVTYQLAG---------------------
GLGB_NITEC      LYKYEIRNPYATRYELR--PNNAALTP----VESRYEWQDN--DWMVQRAG-------------------
GLGB_VIBPA      ----------------------------------------------------------------------
GLGB_PSEF5      AYKYEILGP----QGIL----PLKADPMALAT-------------------QLPPDTASRVAPPLTIDWQ
GLGB_PSEAE      ----------------------------------------------------------------------
GLGB_YERPS      LYKFEI---------IDCHGQRLKADPYA--------------------------FEAQMRPETASLISP
GLGB_YERPP      LYKFEI---------IDCHGQRLKADPYA--------------------------FEAQMRPETASLISP
GLGB_YERPN      LYKFEI---------IDCHGQRLKADPYA--------------------------FEAQMRPETASLISP
GLGB_YERPE      LYKFEI---------IDCHGQRLKADPYA--------------------------FEAQMRPETASLISP
GLGB_YERPA      LYKFEI---------IDCHGQRLKADPYA--------------------------FEAQMRPETASLISP
GLGB_YERP3      LYKFEI---------IDCHGQRLKADPYA--------------------------FEAQMRPETASLISP
GLGB_NITEU      IYKYEIRNRISGEILLK-------TDPYATTYEL-----------------RPNNAALTPIEQKYDWKDD
GLGB1_STRCO     LYKFEITRP-DGSRTFRA-------DPLARRTE-------------------------VPPATSSVVHAS
GLGB_YERE8      LYKFEIHGQV-----------RLKADPYA-----------------FKAQMRPETASLISPLPDVVENTP
GLGB_THICR      IYKFEI-------RNYQTDQLLVKTDPYAKAMEFRPQTGSIVYDSTFQWQDR-----------DWLAARA
GLGB_RHORT      LYKYELLGPDGS-----LLPAK--ADPYAFQAEKPPHTASGLGTYAWND-GRWMS-ERADRVATSAPVS-
GLGB1_STRAW     LYKFEITRP-DGSKTLRADP--------------------------------VARRTEAPPRTSSIVHAS
GLGB_RUBXD      LYKYEIKDAGGSLLPLKADPYGFFAEQYPGT--ASIVWDLSRHRWEDGEWMERRGSRNAPDAPMA-----
GLGB_PSESM      VYKYEILGAHGI-LPLKSDPMALLPPDTASKISAPLK-----FEWHDQDQSRAGRHD---------VAAP
GLGB_MAGSA      ----------------------------------------------------------------------
GLGB_ERWCT      LYKYEMIDSHGSVR--------LKADPYA-----------------FEAQMRPDTASLITPLPEKVPTNE
GLGB_PSEA7      ----------------------------------------------------------------------
GLGB_NITMU      ----------------------------------------------------------------------
GLGB_AZOSE      VYKYSIV----------CQDGRVAADPFAQYAEGSRAWHRWADDAWMAGRARANALDA-----------P
GLGB_VIBF1      ----------------------------------------------------------------------
GLGB_SYNR3      HYKYEIH----TQQG-HCYEK---ADPYGEVRPAQASVVASLKGYQWGDDAWLKQRDNRNPLEQPVSVYE
GLGB_VIBCH      QYKFELKGPHG--EGL---PHK--ADPWGFYAEQYPSFASVTYDHR-----RYQWQDTA-----------
GLGB_PARUW      KYKFEIH----TQQGERI----LKSDPYALSSE-----------LRPATASKIANIERFQWQDQAWMEQR
GLGB_RHOSR      LYKFRVHGPDGSVRDK--------ADPMAFATE------------------------VPPATASRVSVST
GLGB_RHOFD      GYKYRIHGSYGVDKA----------DPFA----------------FYAEP---------PPATASRVWSL
GLGB_PSEPF      LYKYEILGAH----GIL----PLKADPMALAT-------------------------SLPPDTASKVASP
GLGB_PSE14      VYKYEILGAHGI-LPLKSDPMALLPPDTASKVSAQFEWNDQEWLR-----SRTGRHDVA--APLSIYELH
GLGB_PROAC      LYKFRIQDQWGT-------------------------WHEKV------DP-MARYSEQAPQNASIVTETH
GLGB_DESVH      ----------------------------------------------------------------------
GLGB2_STRAW     LYKFEITRP-DGTHTVRADPRRAEVPPATASIVTES-------SYAWADGAWMAARGERP-----VHESP
GLGB_SERP5      LYKYEIIDCY--------GNTQLKADPYA-----------------FEAQMRPDTASLVTPLPEVVENTP
GLGB_DESVV      ----------------------------------------------------------------------
GLGB_PSEPK      ----------------------------------------------------------------------
GLGB_DICDI      ----------------------------------------------------------------------
GLGB_BACCL      LYKYEIITP--DGRVL------LKADPYAFYSELRPHTASIVYDYEWND-------------------SP
GLGB_DEIRA      RYKFRVTGA----GGQTVDKT----DPYGTFFEASIIWQQ---DFEWTDAGWLEQRARRGQ---------
GLGB1_XANAC     HYKYQLRGPHGHELPAKADPRRAELAPGTASIVADPTPHQWSDDGWMATRARRQAHDAP-----------
GLGB_THEFY      RYKYQVLGA-----------------------DGV--WREK------ADP--VAFATQAPPETASVVFTS
GLGB_PROMP      AYKYEI----------RTQEGHIYADPYGRPQNGSIVSKLNNFDWE--DSSWITNRDSSSQINKPISVY-
GLGB_NOCFA      KYKYRVHGA-----------------------DGRVVDH--------ADP--LAFATELPPATASVVTGS
GLGB_MYCPA      LYKFKVHGADGTERA----------DPMAFATEVPPHTASTLSSYTWGDA--------------------
GLGB_CRYNE      ----------------------------VCAIP-----HDSMVKISMTLPGG----ESIDRIPTWITISP
GLGB1_XANCP     HYKYQLRGPHGHELPAKADPRRAELAPGTASIVADPTPHQWSDDGWMATRARRQAHDAP-----------
GLGB1_XANC8     HYKYQLRGPHGHELPAKADPRRAELAPGTASIVADPTPHQWSDDGWMATRARRQAHDAP-----------
GLGB_YARLI      ----------------------------------------------------------------------
GLGB_NEIDE      ----------------------------------------------------------------------
GLGB_SALRD      KYKYHLRA--GGEWFDRTDPYAFRMEPPAQTYEGLSALITDLDTYTWGDDAWMTTREGPSGIPLSIYEVH
GLGB_NITOC      LYKYELR-----------NRNR-----------GSIHLKSDPYGQRF---------EQRPHTASIVAAKT
GLGB_RALSO      RYKFELVGA----------DGHLLVK---------------------ADP--VARRTEAPPATASVVADP
GLGB_MYCTU      LYKFRVHGA----DGVVTDR----ADPFATEVPPQTASRVTSSDYTWGDD--------------------
GLGB_MYCTA      LYKFRVHGA----DGVVTDR----ADPFATEVPPQTASRVTSSDYTWGDD--------------------
GLGB_MYCBP      LYKFRVHGA----DGVVTDR----ADPFATEVPPQTASRVTSSDYTWGDD--------------------
GLGB_MYCBO      LYKFRVHGA----DGVVTDR----ADPFATEVPPQTASRVTSSDYTWGDD--------------------
GLGB_BUTFI      ----------------------------------------------------------------------
GLGB_BURVG      HYKYELHKADPCARATEAPPRTASVVADTAALDG-FGWHDAGWIDARPDAGR------------------
GLGB_ACTP2      LYKFEI---------LDSNGNRLKSDPYA-----------------FASQFRPDTASVVTGLPEKIEVDA
GLGB2_XANOM     HYKYQLRGPHGHELPAKADP----VARRAELAPGTASIVADPTPYQWSDDG-------------------
GLGB_PROM9      TYKYEIR----TQQGHIYEK----ADPYGRPQNGSIV--SKLKNFNWNDNAWITNRDSSSQINKPISVY-
GLGB1_XANOR     HYKYQLRGPHGHELPAKADP----VARRAELAPGTASIVADPTPYQWSDDG-------------------
GLGB_HAEIN      LYKFEL---------IDCHGNRLKADPFA-----------------FSSQLRPDTASQVSALPNVVEMTE
GLGB_CELJU      LYKFEI-------RNRQTGAVFLKSDPYGQSFESSIITADSAFAWQDADWMEHRAH--------------
GLGB_ACTPJ      LYKFEI---------LDSNGNRLKSDPYA-----------------FASQFRPDTASVVTGLPEKIEVDA
GLGB_ACTP7      LYKFEI---------LDSNGNRLKSDPYA-----------------FASQFRPDTASVVTGLPEKIEVDA
GLGB_RHOBA      KYKFRIHGHWMD----KCDPMAFAAEPLTANIITDINWNDS-----------------------------
GLGB_MYCUA      LYKFRVHGA-DGVVSERADPFA-----FGTEVPPQTASRVTVSDYSWGDG--------------------
GLGB_METFK      ----------------------------------------------------------------------
GLGB_METCA      ----------------------------------------------------------------------
GLGB_CHLPN      RYKWEI---------VTQSGNVIVTDPYGKSFD------------------------PPPQGTARVADSE
GLGB_ALHEH      ----------------------------------------------------------------------
GLGB_PSEU2      ----------------------------------------------------------------------
GLGB_ORYSJ      ----------------------------------------------------------------------
GLGB_LACPL      LYKFQITTP--------TGQVQLKIDPFAQQFERKPGDAAVV-----VEPMTMRWHDSL-----------
GLGB_HAEIG      LYKFEL---------IDCHGNRLKADPFA-----------------FSSQLRPDTASQVSALPNVVEMTE
GLGB_BURTA      LYKFALR--------TRDGDRLLKADPYARRTEA---------------PPRTASRICAPSA--------
GLGB2_XANCP     RYKYAII-----------------------TADGRVLLK--------ADP--VARQSELPPATASVVASA
GLGB2_XANC8     RYKYAII-----------------------TADGRVLLK--------ADP--VARQSELPPATASVVASA
GLGB_PROMA      LYKYEIRS----QEG-HCYEK---ADPYGEVRPAQSSIVSTLDSYKWKDQKWMTQRDKTDQLPISVYEMH
GLGB_MAIZE      ----------------------------------------------------------------------
GLGB_JANSC      ----------------------------------------------------------------------
GLGB_HAEI8      LYKFEL---------IDCYGNRLKADPYA-----------------FSSQLRPDTASQISALPNVVEMTE
GLGB2_XANAC     RYKYAVTAA-DGRVLLKADP----VARQTELXXXXXXXXXXXXXFAWTDAAWMANRDPA------AVPGP
GLGB_TRIEI      SYKYEVKNPYGYQQEVRPKTASIVVDLDSYTWNDQ-EWMEK------------RRHTDPLTQPISVYECH
GLGB_PHOPR      ----------------------------------------------------------------------
GLGB_OCEIH      SYKYHICSSEDT--------SILKADPFATQAERR------------------------PKTASVIPAAN
GLGB_DESDG      LYKFAVQGADGTVR--------LKTDPYALYCEGTASFTWSLDSYAWNDAAWMQRRREA-----------
GLGB_BURCH      RYKYELCAADG-----RVLPHK--ADPCARATEAPPRTASVVADFAWHDDGWMHRHDDRYRVP-------
GLGB_BURCA      RYKYELCAADG-----RVLPHK--ADPCARATEAPPRTASVVADFAWHDDGWMHRHDDRYRVP-------
GLGB_AQUAE      ----------------------------------------------------------------------
GLGB2_XANOR     RYKYAV-----------------------TAADGRVLLK--------ADP--VARQTELP--PATASVVP
GLGB1_XANOM     RYKYAV-----------------------TAADGRVLLK--------ADP--VARQTELP--PATASVVP
GLGB_STRAU      LYKYEITRP-DGGRTLRADPMARYAEPPANATASRYEWQDA-----------------------------
GLGB_PSEA6      ----------------------------------------------------------------------
GLGB_PASMU      ----------------------------------------------------------------------
GLGB_HAES2      LYKFEL---------LDCNQLRLKADPYA-----------------FSSQLRPDTASQIGALPEIVSMTE
GLGB_HAES1      LYKFEL---------LDCNQLRLKADPYA-----------------FSSQLRPDTASQIGALPEIVSMTE
GLGB_FUSNN      -----------------------------------------------------------PQTASIVNGKP
GLGB_FELCA      ----------------------------------------------------------------------
GLGB_EMENI      ----------------------------------------------------------------------
GLGB_CORJK      HYKFSI----TTGDGVRLDK----ADPMAR----------------LAEP--------APATASIVVADS
GLGB_ASPOR      ----------------------------------------------------------------------
GLGB_ASHGO      ----------------------------------------------------------------------
GLGB_RHIME      ----------------------------------------------------------------------
GLGB_PICTO      ----------------------------------------------------------------------
GLGB_DEIGD      RYKFRVTGA----DGRTVDK----MDPYGAFTEVRPNTASIIWPLAFEWT------DDA-----------
GLGB_DEBHA      ----------------------------------------------------------------------
GLGB_SYNJB      IYKYEVKDPYGFQQEVRPKTGSIVADLNTYT------WHDQAWLEKRADPLR------SPISVYEVHLGS
GLGB_BURCM      HYKYELRAPHDPARATEAPPRTASVVADTAALDA-FAWHDDGW-LHARPP--------------------
GLGB1_XANC5     HYKYQLRGPHGHELPAKADPRRAELAPGTASIVADPTPHQWSDDGWMATRARRQAHDAP-----------
GLGB_BURXL      RYKYELLSRDGHPLPLKADPCAMQTEPGTASIVAHV---DEVEQFPWSDHEWIQSR--------------
GLGB_LEIXX      ----------------------------------------------------------------------
GLGB_LACS1      ----------------------------------------------------------------------
GLGB_BACSU      RYKYEIVTNNGEIR--------LKADPYA--IYSEVRPNTASLTYDLEGYSXXXXXXXXXXXAKTLYEKP
GLGB2_CLOPE     ----------------------------------------------------------------------
NEPU_BACST      ----------------------------------------------------------------------
GLGB_PROM5      ----------------------------------------------------------------------
GLGB_PROM4      LYKYEIR-----TQNGHCYEKS---DPYGEVRPAQSSKVSRIDNFKWSDQEWITKRDSSNPLDQPISV--
GLGB_MANSM      ----------------------------------------------------------------------
GLGB_FRASC      RYKYEILG-----------------------FDGI--WRQK------ADP--LAFHTEVPPATASVVFAS
GLGB_CHLTR      ----------------------------------------------------------------------
GLGB_CHLTA      ----------------------------------------------------------------------
GLGB_ACTSZ      ----------------------------------------------------------------------
GLGB2_XANC5     ----------------------------------------------------------------------
GLGB_SYNJA      VYKYEVKDPYGFQQEVRPKTGSIVADLHTYT------WHDQ-----------------------------
GLGB_ROSDO      ----------------------------------------------------------------------
GLGB2_RHIL3     RYKFEI---VDAEG--TCLPQK--ADPVARA------------------------SEAAPSTASIVASST
GLGB2_RHIEC     RYKFEIIDPHG-----NCLPQK--ADPVARA------------------------SEAAPSTASIVASST
GLGB2_CLOPS     ----------------------------------------------------------------------
GLGB_MYCSS      ----------------------------------------------------------------------
GLGB_MYCSK      ----------------------------------------------------------------------
GLGB_HORSE      ----------------------------------------------------------------------
GLGB_CHLTB      ----------------------------------------------------------------------
GLGB_CHLT2      ----------------------------------------------------------------------
GLGB_MYCSJ      ----------------------------------------------------------------------
GLGB_MOUSE      ----------------------------------------------------------------------
GLGB_BACST      ----------------------------------------------------------------------
GLGB_AGRT5      ----------------------------------------------------------------------
GLGB_SYNPW      LYKYEIRDPYGFQHEVRPDTSSVV-----SHLDG----------FHWTDTDWIQKRDSSNPLDQPIAVY-
GLGB_HUMAN      ----------------------------------------------------------------------
GLGB_GRABC      ----------------------------------------------------------------------
GLGB_GLOIN      ----------------------------------------------------------------------
GLGB1_RHIEC     ----------------------------------------------------------------------
GLGB_STRR6      IYKYHV---------TRQNGHQLMIDPFAVRYEAR------------PGTGAIVTELPEKKWKDGLWLAR
GLGB_STRP2      IYKYHV---------TRQNGHQLMIDPFAVRYEAR------------PGTGAIVTELPEKKWKDGLWLAR
GLGB_STRA3      ----------------------------------------------------------------------
GLGB_CITK8      ----------------------------------------------------------------------
GLGB_YEAST      ----------------------------------------------------------------------
GLGB_SOLTU      ----------------------------------------------------------------------
GLGB_RHIRD      ----------------------------------------------------------------------
GLGB_PROMT      LYKYEIR----TEKG-HCYEK---ADPYGEVRPAKSSVISKIDSFQWSDQSWISNRDNRDPLEQPISVYE
GLGB_MESSB      LYKYEIIGRNGELLPPKADPVGFRAEATASVVNGQMEWGDGEWVEH-----RIGKNDRKAPIS-------
GLGB_MARAV      ----------------------------------------------------------------------
GLGB_KLULA      ----------------------------------------------------------------------
GLGB_CLOP1      ----------------------------------------------------------------------
GLGB_CHLCV      --------------------------------------------------------DIPPQVTSRVINSD
GLGB1_RHIL3     ----------------------------------------------------------------------
AMY3_DICT6      ----------------------------------------------------------------------
GLGB_STRPN      IYKYHV---------TRQNGHQLMIDPFAVRYEAR------------PGTGAIVTELPEKKWKDGLWLAR
GLGB_RALEJ      ------------------------------------------------------------------VSAP
TREZ_MYCTU      ----------------------------------------------------------------------
GLGB_NOVAD      AYKYRIVGH---DGGVL----PLKADPYALAAEFR------------PSTASLTAHPVKMXXXXXXXXXX
GLGB_CHLMU      ----------------------------------------------------------------------
GLGB_CHLAB      --------------------------------------------------------DVPPHAPSRVVDSD
GLGB_STRA5      ----------------------------------------------------------------------
GLGB_STRA1      ----------------------------------------------------------------------
GLGB_RALEH      ----------------------------------------------------------------------
GLGB_PROM1      LYKYEIR----TEKG-HCYEK---ADPYGEVRPAKSSVISKIDSFQWNDQSWISNRDNRDPLEQPISVYE
GLGB_COREF      VYKFAIQ--------TREGHRRDKADPMARLAE-------------------------LPPATGSIVVES
CDAS_THEP3      ----------------------------------------------------------------------
CDAS_BACSH      ----------------------------------------------------------------------
GLGB_SACD2      ----------------------------------------------------------------------
GLGB_GLOVI      ----------------------------------------------------------------------
GLGB_THIDA      AYKYEILGRHG-ERVTK-------TDPYARQM--------------FLRPETTSRPDERPYAAEWLAART
GLGB_SYNSC      LYKYEI-----------------------RTQDG--HCYQKADPYGF-------QHEVRPDNSSVVARLN
GLGB_SHIBS      LYKYEM---IDANGNLR-----LKSDPYA-----------------FEAQMRPETASLICGLPEKVVQTE
GLGB_SALAR      LYKFEL---------LDANGNRIKADPYA-----------------FEAQMRPETASMICGLPEKVTQSE
GLGB_KLEP7      ----------------------------------------------------------------------
GLGB_SYNPX      LYKYEI-----------------------RTQDG--HCYQKADPYGF-------QHEVRPDNSSVVARLD
GLGB_SHEB9      ----------------------------------------------------------------------
GLGB_SHEB8      ----------------------------------------------------------------------
GLGB_SHEB5      ----------------------------------------------------------------------
GLGB_SHEB2      ----------------------------------------------------------------------
GLGB_RHOS1      LYKYEILGPSGERLPLKSDPLSFAQEATASVVHGEAEWH---------DAGWMQERES------------
GLGB_FRAP2      ----------------------------------------------------------------------
GLGB_ENT38      ----------------------------------------------------------------------
GLGB_ECOL6      LYKYEM---IDANGNLR-----LKSDPYA-----------------FEAQMRPETASLICSLPEKVVQTE
GLGB_SHISS      LYKYEM---IDANGNLR-----LKSDPYA-----------------FEAQMRPETASLICGLPEKVVQTE
GLGB_SHIFL      LYKYEM---IDANGNLR-----LKSDPYA-----------------FEAQMRPETASLICGLPEKVVQTE
GLGB_SHIF8      LYKYEM---IDANGNLR-----LKSDPYA-----------------FEAQMRPETASLICGLPEKVVQTE
GLGB_SHIDS      LYKYEM---IDANGNLR-----LKSDPYA-----------------FEAQMRPETASLICGLPEKVVQTE
GLGB_PROMS      ----------------------------------------------------------------------
GLGB_PROM2      ----------------------------------------------------------------------
GLGB_PROM0      ----------------------------------------------------------------------
GLGB_ECOUT      LYKYEM---IDANGNLR-----LKSDPYA-----------------FEAQMRPETASLICGLPEKVVQTE
GLGB_ECOLI      LYKYEM---IDANGNLR-----LKSDPYA-----------------FEAQMRPETASLICGLPEKVVQTE
GLGB_ECOLC      LYKYEM---IDANGNLR-----LKSDPYA-----------------FEAQMRPETASLICGLPEKVVQTE
GLGB_ECOL5      LYKYEM---IDANGNLR-----LKSDPYA-----------------FEAQMRPETASLICGLPEKVVQTE
GLGB_ECOK1      LYKYEM---IDANGNLR-----LKSDPYA-----------------FEAQMRPETASLICGLPEKVVQTE
GLGB_ECOHS      LYKYEM---IDANGNLR-----LKSDPYA-----------------FEAQMRPETASLICGLPEKVVQTE
GLGB_ECO24      LYKYEM---IDANGNLR-----LKSDPYA-----------------FEAQMRPETASLICGLPEKVVQTE
GLGB_CORDI      VYKFAIH----THEGHRLDK----ADPMAKRAE------------------------VAPATGS-IIASS
GLGB1_CLOPE     ----------------------------------------------------------------------
GLGB_RHOS4      LYKYELLGPSGERLPLKSDPLSFAQEATASVVHGEAEWH---------DAGWMQERES------------
GLGB_HALOH      ----------------------------------------------------------------------
GLGB_CANGA      ----------------------------------------------------------------------
GLGB1_CLOPS     ----------------------------------------------------------------------
GLGB_STRMU      ----------------------------------------------------------------------
GLGB_SALTI      LYKFEL---------LDANGNRIKADPYA-----------------FEAQMRPETASMICGLPEKVTPSE
GLGB_SALPB      LYKFEL---------LDANGNRIKADPYA-----------------FEAQMRPETASMICGLPEKVTPSE
GLGB_SALCH      LYKFEL---------LDANGNRIKADPYA-----------------FEAQMRPETASMICGLPEKVTPSE
GLGB_FRATW      ----------------------------------------------------------------------
GLGB_FRATT      ----------------------------------------------------------------------
GLGB_FRATN      ----------------------------------------------------------------------
GLGB_FRATM      ----------------------------------------------------------------------
GLGB_FRAT1      ----------------------------------------------------------------------
GLGB_ECO57      LYKYEM---IDANGNLR-----LKSDPYA-----------------FEAQMRPETASLICGLPEKVVQTE
GLGB_CHLFF      ----------------------------------------------------------------------
GLGB_SYNS9      ----------------------------------------------------------------------
GLGB_STRSV      IYKYNIKRSSGQEI--------LKIDPLAIYLEER------------PGTGAVIRTISEKKWKDGLWLAR
GLGB_SALTY      LYKFEL---------LDANGNRIKADPYA-----------------FEAQMRPETASMICGLPEKVTP--
GLGB_FRATO      ----------------------------------------------------------------------
GLGB_FRATH      ----------------------------------------------------------------------
GLGB_FRATF      ----------------------------------------------------------------------
GLGB_CORGL      ----------------------------------------------------------------------
MGTA_THEMA      ----------------------------------------------------------------------
GLGB_STRGC      ----------------------------------------------------------------------
GLGB_RHOPB      HYKFDIIGPHGQQLPLKSDPLAFAAEMRPDTASVVV------------DPARLSHPRPAPPAINALT-SP
GLGB_PROMM      ----------------------------------------------------------------------
GLGB_PROM3      ----------------------------------------------------------------------
GLGB_THEEB      RYKYEI-----------------------KNQEGHIYEKSDPYGFY---------QEPRPKTASIVTDLN
GLGB_NITHX      ----------------------------------------------------------------------
GLGB_SYNS3      FYKYEI-----------------------RTQDG--HCYQKADPYGF-------QHEVRPDTSSIVSHLD
GLGB_SHEON      ----------------------------------------------------------------------
GLGB_SALPA      LYKFEL---------LDANGNRIKADPYA-----------------FEAQMRPETASMICGLPEKVTPSE
GLGB_BIFLO      TYKFQI-------------------------LNANYTWEMK------ADPME-RQHEVPPSTASIVTEST
AMYM_BACAD      ----------------------------------------------------------------------
MGTA_THENE      ----------------------------------------------------------------------
GLGB_RHOP2      ----------------------------------------------------------------------
GLGB_SHEPC      ----------------------------------------------------------------------
GLGB_RHOPA      ----------------------------------------------------------------------
GLGB_SYNP6      ----------------------------------------------------------------------
GLGB_SYNE7      ----------------------------------------------------------------------
GLGB_SHESR      ----------------------------------------------------------------------
GLGB_SHESM      ----------------------------------------------------------------------
GLGB_LACAC      ----------------------------------------------------------------------
GLGB_DESHY      ----------------------------------------------------------------------
CDGT_BACST      ----------------------------------------------------------------------
O16G2_BACSU     ----------------------------------------------------------------------
GLGB_SYNY3      SYKYEIKNPYGFYQEVRPKTASIVAD-----LDGY-QWH----DEDWLEARRTSDPLSKP-------VSV
GLGB_SHEFN      ---------------LRHHPASGLWDIFIAEVEPEQHYKYAISDMHGSDPYAVAMQPS-PHNASKIPHVE
GLGB_NITWN      ----------------------------------------------------------------------
GLGB_SHESW      ----------------------------------------------------------------------
GLGB_RHOPS      ----------------------------------------------------------------------
GLGB_RHOP5      ----------------------------------------------------------------------
GLGB_BURPS      ----------------------------------------------------------------------
GLGB_BURP6      ----------------------------------------------------------------------
GLGB_BURP1      ----------------------------------------------------------------------
GLGB_BURP0      ----------------------------------------------------------------------
GLGB_ANAVT      ----------------------------------------------------------------------
GLGB_BURS3      ----------------------------------------------------------------------
GLGB_BACWK      ----------------------------------------------------------------------
NEPU2_THEVU     ----------------------------------------------------------------------
AMY_BACSU       ----------------------------------------------------------------------
AMYB_PAEPO      ----------------------------------------------------------------------
GLGB_BRASB      HYKFDIIGPQGEHLPLKSDPMAFAAEMRPKT--ASIVVDETRLPRPRPAPSDINKLD-------------
GLGB_BRAJA      ----------------------------------------------------------------------
GLGB_BORPA      RYKFQVLGAD--------GHTVLKADPLARQAE--------------APPATASIPDERPFAWTDEAWME
GLGB_ANASP      ----------------------------------------------------------------------
GLGB_BORBR      RYKFQVLGAD--------GHTVLKADPLARQAE--------------APPATASIPDERPFAWTDEAWME
GLGB_BACCN      ----------------------------------------------------------------------
GLGB_BORPE      RYKFQVLGAD--------GHTVLKADPLARQAE--------------APPATASIPDERPFAWTDKAWME
GLGB_BACCZ      ----------------------------------------------------------------------
GLGB_BACCR      ----------------------------------------------------------------------
GLGB_BACCQ      ----------------------------------------------------------------------
GLGB_BACC4      ----------------------------------------------------------------------
GLGB_BACC1      ----------------------------------------------------------------------
GLGB_BACAN      ----------------------------------------------------------------------
GLGB_BACAC      ----------------------------------------------------------------------
GLGB_BACAA      ----------------------------------------------------------------------
GLGB_BACHK      ----------------------------------------------------------------------
GLGB_BACC3      ----------------------------------------------------------------------
GLGB_BACC0      ----------------------------------------------------------------------
GLGB_BACC7      ----------------------------------------------------------------------
GLGB_BACC2      ----------------------------------------------------------------------
CDGT_BACS8      ----------------------------------------------------------------------
CDGT_BACS2      ----------------------------------------------------------------------
CDGT_BACS0      ----------------------------------------------------------------------
CDGT2_BACCI     ----------------------------------------------------------------------
AMY2_DICT6      ----------------------------------------------------------------------
CDGT_THETU      ----------------------------------------------------------------------
AGL_PEDPE       ----------------------------------------------------------------------
O16G1_BACSU     ----------------------------------------------------------------------
CDGT_BACS3      ----------------------------------------------------------------------
CDGT_BAC11      ----------------------------------------------------------------------
APU_THEP3       ----------------------------------------------------------------------
AMY1_DEBOC      ----------------------------------------------------------------------
AMYM_BACST      ----------------------------------------------------------------------
AMY2A_ORYSJ     ----------------------------------------------------------------------
AMY2A_ORYSI     ----------------------------------------------------------------------
MDE5_SCHPO      ----------------------------------------------------------------------
AMY3E_ORYSJ     ----------------------------------------------------------------------
AMY3A_ORYSJ     ----------------------------------------------------------------------
AMY_ASPSH       ----------------------------------------------------------------------
AMYB_ASPAW      ----------------------------------------------------------------------
AMYA_ASPAW      ----------------------------------------------------------------------
AMYA3_ASPOR     ----------------------------------------------------------------------
AMYA1_ASPOR     ----------------------------------------------------------------------
AMY_STRLI       ----------------------------------------------------------------------
CDGT_BACLI      ----------------------------------------------------------------------
AMY_STRHY       ----------------------------------------------------------------------
AMY2_HORVU      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           FFDWGAEQHPNIPYHETVIYEAHVRGMTIRHPDVPPPLRGTYAGMAHPAIIEHLLSLGVTAVELMPIHHF
GLGX_MYCTU      FFDWAYDRSPRTPYHETVIYEAHVKGMTQTHPSIPPELRGTYAGLAHPVIIDHLNELNVTAVELMPVHQF
GLGX_MYCBO      FFDWAYDRSPRTPYHETVIYEAHVKGMTQTHPSIPPELRGTYAGLAHPVIIDHLNELNVTAVELMPVHQF
GLGX_ENT38      VYDWEGDSSPDIPWGNTVIYEAHVKGLTYLHPAIPKEIRGTYKALGHPVMIAYLKHLGITSLELLPIWHF
GLGX_SERP5      AYDWQDDCPPATPWGKTVIYEAHVRGLTLQHPEIPQVLRGSFAALGHPVMIAYFKRLGITALELLPVQQH
GLGX_SHIDS      HYDWEDDAPPRTPWGSTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_ECO81      HYDWEDDAPPRTPWGSTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_SHIBS      HYDWEDDAPPRTPWDSTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_ECOLU      HYDWEDDAPPRTPWGSTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_ECOLI      HYDWEDDAPPRTPWGSTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_ECODH      HYDWEDDAPPRTPWGSTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_ECOBW      HYDWEDDAPPRTPWGSTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_ECO8A      HYDWEDDAPPRTPWGSTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_ECO5E      HYDWEDDAPPRTPWGSTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_ECO57      HYDWEDDAPPRTPWGSTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_ECO7I      HYDWEDDAPPRTPWGSTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_SHIB3      HYDWEDDAPPRTPWGSTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_ECOSE      HYDWEDDAPPRTPWGSTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_ECOLC      HYDWEDDAPPRTPWGSTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_ECOHS      HYDWEDDAPPRTPWGSTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_ECO27      HYDWEDDAPPRTPWGSTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_ERWT9      DFDWEDDTWPRVPWGSTVIYEAHVRGLTQLHPGIPAEMRGTYAALGHPVMIDYFQRLGITSLQLLPVACF
GLGX_ECO55      HYDWEDDAPPRTPWGSTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_ECO24      HYDWEDDAPPRTPWGSTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_SHIFL      HYDWEDDAPPRTPWGSTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_SHIF8      HYDWEDDAPPRTPWGSTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_ECOSM      HYDWEDDAPPRTPWGSTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_ECOL5      HYDWEDDAPPRTPWGSTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_ECOL6      HYDWEDDAPPRTPWGSTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_ECOUT      HYDWEDDAPPRMPWGCTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_ECOK1      HYDWEDDAPPRMPWGCTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_ECO45      HYDWEDDAPPRMPWGCTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_SHISS      HYDWEDDAPPRTPWGSTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQF
GLGX_ESCF3      SYNWEDDAPPRTPWGNTVIYEAHVKGLTYQHPEIPAEIRGRYKALGHPVMINYFKRLGITALELMPVIHF
GLGX_KLEP7      RYDWRGDKPPRTPWGETVIYEAHVKGLTLLNPQLPEAIRGTYKALGHPAMIAYFKSLGISALELLPVAQF
GLGX_KLEP3      HYDWRGDKPPRTPWGETVIYEAHVKGLTLLHPQLPEAIRGTYKALGHPVMIAYFKSLGISALELLPVAQF
GLGX_SALPB      HYDWEDDAAPRTPWGKTVIYEAHVKGLTYLHPELPQEIRGTYKALGHPVMVAYFKQLGITALELLPVAQF
GLGX_SALPK      HYDWEDDAAPRTPWGKTVIYEAHVKGLTYLHPELPQEIRGTYKALGHPVMVAYFKQLGITALELLPVAQF
GLGX_SALPA      HYDWEDDAAPRTPWGKTVIYEAHVKGLTYLHPELPQEIRGTYKALGHPVMVAYFKQLGITALELLPVAQF
GLGX_SALTY      HYDWEDDAAPRTPWGKTVIYEAHVKGLTYLHPELPQEIRGTYKALGHPVMVAYFKQLGITALELLPVAQF
GLGX_SALPC      HYDWEDDAAPRTPWGKTVIYEAHVKGLTYLHPELPQEIRGTYKALGHPVMVAYFKQLGITALELLPVAQF
GLGX_SALNS      HYDWEDDAAPRTPWGKTVIYEAHVKGLTYLHPELPQEIRGTYKALGHPVMVAYFKQLGITALELLPVAQF
GLGX_SALHS      HYDWEDDAAPRTPWGKTVIYEAHVKGLTYLHPELPQEIRGTYKALGHPVMVAYFKQLGITALELLPVAQF
GLGX_SALDC      HYDWEDDAAPRTPWGKTVIYEAHVKGLTYLHPELPQEIRGTYKALGHPVMVAYFKQLGITALELLPVAQF
GLGX_SALCH      HYDWEDDAAPRTPWGKTVIYEAHVKGLTYLHPELPQEIRGTYKALGHPVMVAYFKQLGITALELLPVAQF
GLGX_SALSV      HYDWEDDAAPRTPWGKTVIYEAHVKGLTYLHPELPQEIRGTYKALGHPVMVAYFKQLGITALELLPVAQF
GLGX_SALEP      HYDWEDDAAPRTPWGKTVIYEAHVKGLTYLHPELPQEIRGTYKALGHPVMVAYFKQLGITALELLPVAQF
GLGX_SALA4      HYDWEDDAAPRTPWGKTVIYEAHVKGLTYLHPELPQEIRGTYKALGHPVMVAYFKQLGITALELLPVAQF
GLGX_SALTI      HYDWEDDAAPRTPWGKTVIYEAHVKGLTYLHPELPQEIRGTYKALGHPVMVAYFKQLGITALELLPVAQF
GLGX_YERE8      EYDWQGDRRPTIPWGNTVIYEAHVRGLTQLHPDIPADLRGTYAGLAHPAMIQYLQKLGITTLELLPVQFH
GLGX_SALG2      HYDWEDDAAPRTPWGKTVIYEAHVKGLTYLHPELPQEIRGTYKALGHPVMVAYFKQLGITALELLPVAQF
GLGX_CITK8      RYDWEDDAAPRTPWGNTVIYEAHVKGLTYLHPAIPSEIRGTWKALGHPVMIAYFKQLGITALELLPVAHF
GLGX_PECCP      DYDWQDDQHPHTLWHQTVIYEAHVRGLTQLHPDIPEDIRGSYAALGHPVMIDYLTSLGVTALELLPVQQH
GLGX_YERPB      EYDWQGDKPPAIPWGNTVVYEAHVRGLTQLHPDIPPELRGTYAALAHPALIEHLKTLGITTLELLPVQFH
GLGX_YERPY      EYDWQGDKPPAIPWGNTVIYEAHVRGLTQLHPDIPPELRGTYAALAHPALIEHLKTLGITTLELLPVQFH
GLGX_YERPS      EYDWQGDKPPAIPWGNTVIYEAHVRGLTQLHPDIPPELRGTYAALAHPALIEHLKTLGITTLELLPVQFH
GLGX_ERWCT      DYDWQDDQHPQTPWNQTVIYEAHVRGLTQLHPDIPEDIRGSYAALGHPVMIDYLTSLGITALELLPVQQH
GLGX_ENTS8      RYDWEDDAPPNIAWGETVIYEAHVRGLTRLHPDIPPALRGTYAALGHPAMIAWFQRLGITALELQPVAKF
GLGX_YERP3      EYDWQGDKPPAIPWGNTVIYEAHVRGLTQLHPDIPPELRGTYAALAHPALIEHLKTLGITTLELLPVQFH
GLGX_YERPG      EYDWQGDKPPAIPWGNTVIYEAHVRGLTQLHPDIPPELRGTYAALAHPALIEHLKTLGITTLELLPVQFH
GLGX_YERPP      EYDWQGDKPPAIPWGNTVIYEAHVRGLTQLHPDIPPELRGTYAALAHPALIEHLKTLGITTLELLPVQFH
GLGX_YERPN      EYDWQGDKPPAIPWGNTVIYEAHVRGLTQLHPDIPPELRGTYAALAHPALIEHLKTLGITTLELLPVQFH
GLGX_YERPE      EYDWQGDKPPAIPWGNTVIYEAHVRGLTQLHPDIPPELRGTYAALAHPALIEHLKTLGITTLELLPVQFH
GLGX_YERPA      EYDWQGDKPPAIPWGNTVIYEAHVRGLTQLHPDIPPELRGTYAALAHPALIEHLKTLGITTLELLPVQFH
GLGX_ERWCH      HYDWQGDRLPRTPWSQTVLYEAHVRGLTRRHPGIPAAIRGTYAALAHPVMLDYLTQLGVTALELMPVQQH
GLGX_HAEIN      EFDWENDTSPNTPWAETIVYELHVKGFSQLNEKIPAALRGTYTGLAHPVNLAYLKELGVTAVELLPVNFH
ISOA3_ARATH     -FDWGDDKFPNIPEKDLVIYEMNVRAFTADESSMDPAIGGSYLGFIEK--IPHLQDLGINAVELLPVFEF
ISOA1_ARATH     EFDWEGDMHLKLPQKDLVIYEMHVRGFT-RHESSKIEFPGTYQGVAEK--LDHLKELGINCIELMPCHEF
ISOA_FLASP      DAT-SVGSKPTRALKDEVIYEVHVRGLTRNDDSVPAA--EXXXXXXXXXXXXXXXXXXXXXXEFLPVQET
ISOA_PSEUM      STQ-STGTKPTRAQKDDVIYEVHVRGFTEQDTSIPAQYRGTYYGAGLKA--SYLASLGVTAVEFLPVQET
ISOA_PSEAY      STQ-STGTKPTRAQKDDVIYEVHVRGFTEQDTSIPAQYRGTYYGAGLKA--SYLASLGVTAVEFLPVQET
ISOA2_ARATH     SFDWGEDVSPNIPLEKLLVYRLNVKGFTQRSSKLPSNVAGTFSGVAEK--VSHLKTLGTNAVLLEPIFSF
PULA_THEMA      E-GWENDRGPKIEYEDAIIYEIHIADITLENSGVKN--KGLYLGLTEENTLSHLVELGVTHVHILPFFDF
PULA_BACSU      DMKWTAPLKPFSHPVDAVIYETHLRDFSI-HENSGMINKGKYLALTETDTLAYVKELGVTHVELLPVNDF
PULA1_ARATH     -------------FSDISIYELHVRDFSANDETVEPENRGGYAGVKH---LQKLVDAGLTHLHLLPTFQF
PULA_KLEPN      ----------------------------------------------------------------------
PULA_KLEAE      ----------------------------------------------------------------------
GLGB_RHOMR      --EWMRRRKPASLYEPVSIYEVHLGSWRHKRPGES----FSYREIAEP-LADYVQEMGFTHVELLPVM--
GLGB_DECAR      DADW-LQQRAGWDWQQAPIYEVHP-GSWMRHPDGKPYLWGELA----ERLIPYALAQGYTHLELLPI---
GLGB2_STRCO     RYEWGDAQRADTPVHEAPVYEVHL-------PSWRPGL--TYRELAEPAYVK---DLGFTHVELMPVHPY
TREZ_RHIS1      ----------------SVIYELHIGTFT------PEGTLDAAAGK-----LDYLAGLGIDFIELLPVNAF
BBMA1_BACSU     -----------------------------KDPDVNDFFGGDLQGIVDK--LDYLEDLGVNGIYLTPIFSA
TREZ_ARTSQ      -YSWQDDAWQGRELQGAVIYELHLGTFT---PE------GTLEAAAGK--LDYLAGLGVDFIELLPVNAF
TREZ_BREHE      PYRWQDSRWRGKELQGTLIYQLHVGTST---PD------GTLDAAGEK--LSYLVDLGIDFIELLPVNGF
GLGB_ERWCH      -----ARQHANELQSPISIYEVHL-GSWRRHTHNNFWL--SYRELADQ-LVPYVKEMGFTHVELMPVHK-
BBMA2_BACSU     --------------------------------------------------LDYLEDLGVNGIYLTPIFSA
GLGB_VIBVU      --QWQDAQWQTRPVTEKSFYELHA-GSWKRNE------QGEFLNYRELALVPYLVDMGYTHVELMPVS--
TREZ_ARTRM      -YAWGDDGWRGRDLTGAVIYELHVGTFT---PE----------GTLDSAILDHLVRLGVDAVELLPVNAF
GLGB_MYXXD      ---WGRAQRRDVHHQPWSVYEVHLGSWRRVVEDGDRPM--TYRELA-PALAEYIKFTGFTHIELLPV---
GLGB_VIBVY      --QWQDAQWQTRPVTEKSFYELHA-GSWKRNE------QGEFLNYRELALVPYLVDMGYTHVELMPVS--
GLGB_RHILO      ---WGDEAHRNYPRREAVIYEVHAGSWQL-HDD------GTFLSWDELALIPYVVETGFTHIEFMPIHPY
GLGB_BACLD      -YQWGDRKWQKKKQQKAVIYELHI-GSWKKKAD---GRFFTYRELSE-TVIPYVKEHGFTHIELMP----
GLGB_NITEC      -WDW---------LHAPVIYELHV-GSWKRHPD------GSFYSYQELALIPYLQEMGYSHVELLPIS--
GLGB_VIBPA      -------------------------------------------------LVPYLVDMGYTHVELMPVS--
GLGB_PSEF5      DQEWGERQRVDAPLS---IYELHAGSWQCEVDDLGEVARQYSWAELAERLIPYVKDLGFTHIELMPIM--
GLGB_PSEAE      --DWLARRAERQGYAAPLIYEVHAGSW--RHRDGRPPHWSELA----EELIPYVRQLGFTHIELMPVM--
GLGB_YERPS      LPDVAARQKANDLCSPVSIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVEYVKYMGFTHVELLPIN--
GLGB_YERPP      LPDVAARQKANDLCSPVSIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVEYVKYMGFTHVELLPIN--
GLGB_YERPN      LPDVAARQKANDLCSPVSIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVEYVKYMGFTHVELLPIN--
GLGB_YERPE      LPDVAARQKANDLCSPVSIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVEYVKYMGFTHVELLPIN--
GLGB_YERPA      LPDVAARQKANDLCSPVSIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVEYVKYMGFTHVELLPIN--
GLGB_YERP3      LPDVAARQKANDLCSPVSIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVEYVKYMGFTHVELLPIN--
GLGB_NITEU      --DWIARRKGWDWLHAPLIYELHV-GSWKRHPD------GRFYSYHELALIPYLQDMGYSHVELLPIS--
GLGB1_STRCO     DYTWGDEERADAPAHEAPVYEVHL-------PSWRPGL--TYRQLAEQ-LPAYVADLGFTHVELMPV---
GLGB_YERE8      -----ARQKANDLRSPISIYEVHL-GSWRRHTDNNFWL--SYGELA-DQLVEYVKYMGFTHVELLPIN--
GLGB_THICR      HFDWQAS-----PIN---IYEVHLGSWQRDHD-------GFFLNYKEIALVEYVKWMGYTHIELLPIS--
GLGB_RHORT      ------------------IYEVHLGSW--RHGGGDRSL--SYREMAEQ-LIPYVKEMGFTHIELLPVSEF
GLGB1_STRAW     HYAWADEARGERPVHESPVYEVHL-------PSWRPGL--TYRQLAEQ-LPAYVADLGFTHVELLPV---
GLGB_RUBXD      ------------------IYEVHL-GSWRRRPDGS---HLTYRELAEE-LVPYVAGLGYTHVELLPPM--
GLGB_PSESM      LS----------------IYELHAGSWQMEQNDEGQWRQYNWRELAD-RLIPYVKELGFTHIELMPIM--
GLGB_MAGSA      ------------------IYEVHLGSWRRVPEDCNRPL--SYLEMADQ-LGDYVADLGFTHVEFLPIH--
GLGB_ERWCT      -----ARREANSLRSPISIYEVHL-GSWRRHTDNNFWL--SYQELANQ-LIDYVQYMGFTHVELMPIN--
GLGB_PSEA7      --DWLARRAERQGYAAPLIYEVHAGSW--RHRDGRPPRWSELA----EELIPYVRQLGFSHIELMPVM--
GLGB_NITMU      ------------------IYEVHA-GSWKRHAN------GSF--YSYRELADHLLEMGYTHIELLPIS--
GLGB_AZOSE      FS----------------IYELHL-GSWRRAQDGALP---GYREIA-PQLAAYVVEWGFTHVELMP----
GLGB_VIBF1      ----------------------------------------TYRELAEQ-LIPYILDMGYTHIELMPVS--
GLGB_SYNR3      -MHMGSWMHGS--WDEPYIEADGTPRAPVPAADLKPGARLTYPELA-DRVIPYVKARGFTHIELMP----
GLGB_VIBCH      ---W--QQRPVTEKRKQALYELHV-GSWKRGEN------GEFLNYRELALVPYLVEMGYTHVELMPV---
GLGB_PARUW      ----KAKNWTSLPMN---IYEVHLGSWKKKDSNSEFL---NYRELAHE-LTAYCLDMGFTHIELLPIQ--
GLGB_RHOSR      YAEWLAQRAATEPAQSPMVYEVHLASWR-------PGLN--YREMAEQLAV-HLTETGFTHVELLPV---
GLGB_RHOFD      EHDWKDDQWKNALDAPMSIYEIHLGSWRRQDGHFLD-----YRELAH-SLADYVIEMGFTHVELMPV---
GLGB_PSEPF      LIDWQDQQQHNAPLS---IYELHAGSWQCELDDLGEVARQTWPELAE-RLIPYVKELGFTHIELMPIM--
GLGB_PSE14      AGSWQMEQHEDGQWRQYNWRELADR------------------------LIPYVKELGFTHIELMPIM--
GLGB_PROAC      YEEWIARREASRAHAEPMVYEVHLGGW--RH------------GLSYRELADQLVSYGYTHVEFMPLHPF
GLGB_DESVH      ---WMAERRQGLPLERPVIYEVHLGSWRRRHGDGHPFL--TYDELGDQ-LIPYATGLGFTHLELLPV---
GLGB2_STRAW     FS----------------VYEVHL-------PSWRPGL--TYRQLAEQ-LPAYVADLGFTHVELLPV---
GLGB_SERP5      -----QRQRANDFDRPISIYEVHL-GSWRRHTDDNFWL--SYGELA-VQLIDYVKDMGFTHIELLPIN--
GLGB_DESVV      ---WMAERRQGLPLERPVIYEVHLGSWRRRHGDGHPFL--TYDELGDQ-LIPYATGMGFTHLELLPV---
GLGB_PSEPK      -------------------------------------------------LVPYVQELGFTHIELLPIM--
GLGB_DICDI      ---------------ELRIYEAHV-GMSSELPEI-----STYSKFKD-TVLPMVKELGYNCIQLMAVM--
GLGB_BACCL      ---WQRKKRRKRIYDQPVIYELHF-GSWKKKPD---GRFYTYREMADE-LIPYVLERGFTHIELLP----
GLGB_DEIRA      -----ALEDP------ISIYECHV-GSWARRDD------GNYRDLAH-RLGEYVTYMGYTHVELLGVM--
GLGB1_XANAC     ----------------MSIYEIHA-GSWLREAGVDLD----WDGLAD-RLIPYVADMGFTHVELMPV---
GLGB_THEFY      RYTWQDDEWLT----QRAAADLHRKPMSIYEVHLGSWRPGLSYRELADQLVDYVRELGFTHVEFLPV---
GLGB_PROMP      ------EMHLGSWMHDSIENKYIEKNGQTRSPVPAADLKPGTRFLTYPELTEKLIPYGFTHIELMPIS--
GLGB_NOCFA      DYTWQDAQRSTDPTRSPMVYEVHLGSWR--------PGLG-YRELAEQ-LADYVRAAGYTHVELLPV---
GLGB_MYCPA      --DWMTQRAARNPVFEPMTYEVHLGSWR-------PGL--SYRQLARE-LTDYVVEHGFTHVELLPV---
GLGB_CRYNE      IYDWNPPKHSTRPVEGLKIYEAHV-GIS------SPNMRVTTYKEFEVDVLPKIKQLGYNCIQMMAIM--
GLGB1_XANCP     ----------------MSIYEIHA-GSWLREEG----LDLDWDGLAD-RLIPYVADMGFTHVELMPV---
GLGB1_XANC8     ----------------MSIYEIHA-GSWLREEG----LDLDWDGLAD-RLIPYVADMGFTHVELMPV---
GLGB_YARLI      ------------------IYEAHV-GISSSEPRV-----GTYKEFTKN-ILPRIHKLGYNVIQLMAIM--
GLGB_NEIDE      ------------------IYEVHL-GSWRRNPENNYWL--TYTQLADE-LVNYVKDMGFTHIELLPLSEY
GLGB_SALRD      LGSWRHEEH----------------GASLSYREVAEPLA------------DHVQNLGFTHVEFLP----
GLGB_NITOC      NYLWQMEQRKQFDWHQPIVYEVHL-GSWQRGEN------GAFLNYRQLALVDYVLKTGFTHIELLPV---
GLGB_RALSO      LFRWSARQRPDAPI---AIYEVHA-GSWLR--DVEDGGRSLDWDALGERLIPYVAGLGFTHVELLPV---
GLGB_MYCTU      --DWMAGRALRNPVNEAMTYEVHLGSWR-------PGL--SYRQLARE-LTDYIVDQGFTHVELLPV---
GLGB_MYCTA      --DWMAGRALRNPVNEAMTYEVHLGSWR-------PGL--SYRQLARE-LTDYIVDQGFTHVELLPV---
GLGB_MYCBP      --DWMAGRALRNPVNEAMTYEVHLGSWR-------PGL--SYRQLARE-LTDYIVDQGFTHVELLPV---
GLGB_MYCBO      --DWMAGRALRNPVNEAMTYEVHLGSWR-------PGL--SYRQLARE-LTDYIVDQGFTHVELLPV---
GLGB_BUTFI      ------------------IYECHI-GSWMKHPDGTEDGFYTYRQFAD-RIVEYLKEMKYTHIELIGI---
GLGB_BURVG      --------RFRVPWS---IYEVHAESWQ----RVPEEMSATWDELAE-RLIPYVKGMGFTHVEFMPISEY
GLGB_ACTP2      KL-----RHANDPDQPISIYEVHL-GSWRRHLENNYWLN--YEEIANE-LIPYVKDMGFTHIELLPITEY
GLGB2_XANOM     ---WMATRARRQAHDAPMVYEMHA-GSWLREEGVDLD----WDGLAD-RLIPYVADMGFTHVELMPV---
GLGB_PROM9      ------EMHLGSWLHESTDNKYIEDNGNPRNPVPAADLKPGTRLLTYPELTEKLIPYGFTHIELMPIS--
GLGB1_XANOR     ---WMATRARRQAHDAPMVYEMHA-GSWLREEGVDLD----WDGLADH-LIPYVADMGFTHVELMPV---
GLGB_HAEIN      -----ARKKANQGNQPISIYEVHLGSW---RRNLENNFWLDYDQIADE-LIPYVKEMGFTHIEFLPLSEF
GLGB_CELJU      -WDWQASP--------LSIYEVHLGSWR----------RGSYRELAHQ-LADYVKYMGFTHVEILPVS--
GLGB_ACTPJ      KL-----RHANEPDQPISIYEVHL-GSWRRHLENNYWLN--YEEIANE-LIPYVKDMGFTHIELLPITEY
GLGB_ACTP7      KL-----RHANDPDQPISIYEVHL-GSWRRHLENNYWLN--YEEIANE-LIPYVKDMGFTHIELLPITEY
GLGB_RHOBA      --DWLQQRAEMDPMHTPMVYEVHLGSWQ----KGPGRTHGDYRDLAK-RLVDYCHRMNFTHVELMPIS--
GLGB_MYCUA      --DWMTERAQRNPVFEPMTYEVHLGSWR-------PGL--SYRQLA-TELTDYVVAHKFTHVELLPV---
GLGB_METFK      -----------------------------------------YRELAHQ-LVPYMQEMGYTHIELLPVS--
GLGB_METCA      -----------------------------------------YRDLAHE-LVDYVKSAGFSHIELMPV---
GLGB_CHLPN      SYSWSMERRSKQSEGPVTIYEVHLGSWQWQEGR---PL--SYSEMAH-RLASYCKEMHYTHVELLPI---
GLGB_ALHEH      -----------------------------------------YRTLAH-RLVDHVLATGFTHIELLPI---
GLGB_PSEU2      -------------------------------------------------LIPYVKELGFTHIELMPIM--
GLGB_ORYSJ      -------KHPRPPKPDAPIYEAHV-GMSGEEPEV-----STYREFADN-VLPRIRANNYNTVQLMAIM--
GLGB_LACPL      ---WLARRKKSRAANRPIIYEVHL-GSWRRHLD------GSYYTYAELALIPYVKQRGYTHIELMPVM--
GLGB_HAEIG      -----ARKKANQGNQPISIYEVHLGSW---RRNLENNFWLDYDQIADE-LIPYVKEMGFTHIEFLPLSEF
GLGB_BURTA      -FGWRDDAXXXXXXXXXXIYEVHLDSWR-RHPD---GRAYSYDELAD-ALIPYVAALGFTHVELLPIAEY
GLGB2_XANCP     DAEWMARRSAAAEPAPLSIYEVHAASWRRDGHDQPLDWVSLAA-----QLIPYVQELGFTHIELLPI---
GLGB2_XANC8     DAEWMARRSAAAEPAPLSIYEVHAASWRRDGHDQPLDWVSLAA-----QLIPYVQELGFTHIELLPI---
GLGB_PROMA      LGSWMHSSNKT-PYIE--------KDGSTREPVPAADLKPETRFLTYPELTEKLIARGFTHIELMPIS--
GLGB_MAIZE      ------------------IYETHV-GMSS-----PEPKINTYVNF-RDEVLPRIKKLGYNAVQIMAIQ--
GLGB_JANSC      ------------------IYEVHLGSWRRKWDDGGRPLSYKEAAQDLVGYVRHM---GFTHIELMPISEF
GLGB_HAEI8      -----QRRQANQANQPISIYEVHLGSW---RRNLENNFWLDYDQIADE-LIPYVKEMGFTHIEFLPLSEF
GLGB2_XANAC     LS----------------IYEVHAASW--RRDGHNQPL--DWPTLAEQ-LIPYVQQLGFTHIELLPI---
GLGB_TRIEI      FGSWSAHEPAKLPNGET---EPVVQVSELR----PDARFLTYRELAD-RLVSYVKDLGYTHIEMLPV---
GLGB_PHOPR      ----------------------------------------TYRELAEQ-LIPYLSEMGYTHLELMPVS--
GLGB_OCEIH      GYQWSDDQNTYDPYSSPIIYEVHLGTWTLKKQFL------SYRELA-TQLIPYVKSLGYTHIELLPIN--
GLGB_DESDG      ----------GPPLQQPVIYELHAGSWMRRHGEGHPELAGT--------LIPYVRDAGFTHIELMPV---
GLGB_BURCH      ---WS-------------IYEVHPESWQ-RIPE-QMDRSATWDELAE-RLIPYVKGMGFTHVEFMPIAEY
GLGB_BURCA      ---WS-------------IYEVHPESWQ-RIPE-QMDRSATWDELAE-RLIPYVKGMGFTHVEFMPIAEY
GLGB_AQUAE      ----------------------------------------------------YVKEMGFTHVEFLPVM--
GLGB2_XANOR     GTDWMAKRDPSAVPAPLSIYEVHAASW--RRDGHNQPL--DWPTLAEQ-LIPYVQQLRFTHIELLPI---
GLGB1_XANOM     GTDWMAKRDPSAVPAPLSIYEVHAASW--RRDGHNQPL--DWPTLAEQ-LIPYVQQLRFTHIELLPI---
GLGB_STRAU      --EWMARRGALAPHQAPMVYELHLASWR-------PGLSYRQLAEQLPAYVKEL---GFTHVELMPV---
GLGB_PSEA6      -------------------------------------------------LIPYVKDMGYTHLELLPISEF
GLGB_PASMU      -------------------------------------------------LIPYVKEMGFTHIEFLPISEF
GLGB_HAES2      -----KRRKANQADQPISIYEVHLGSW---RRNLENNFWLDYDQIAEE-LIPYVKDMGFTHIELLPLSEF
GLGB_HAES1      -----KRRKANQADQPISIYEVHLGSW---RRNLENNFWLDYDQIAEE-LIPYVKDMGFTHIELLPLSEF
GLGB_FUSNN      KFRWADKRWLNIGYAKPIIYEVHL-GSWKKKED------GTYYNYKEIALVEYMLEMNYTHIEIMPIIEY
GLGB_FELCA      ------------------IYESHV-GISSYEGKIASYKHFTYN------VLPRIKDLGYNCIQMMAIM--
GLGB_EMENI      ------------------IYEAHVG---ISSPDTRVATYKEFTANMLPRI----KYLGYNAIQLMAIM--
GLGB_CORJK      DYAWGDDERAAVGVDETMIYEMHLKGRSYRELAVE--------------LVEYVQELGYTHVELMGVHPF
GLGB_ASPOR      ------------------IYEAHVG---ISSPETKVATYKEFTSNMLPRI----KYLGYNAIQLMAIM--
GLGB_ASHGO      ------------------IYEAHVGIST------PEPRVGSYSEFTKD-VLPRIRDLGYNAIQLMAIM--
GLGB_RHIME      -------------------------------------------------LIPYCVDMGFTHIEFLPISEY
GLGB_PICTO      -------------------------------------------------LIDHLKKTGFNCVEIMPVM--
GLGB_DEIGD      ---WMQKRTPGFD-RPISIYEVHV-GSWARRDD------GNYRELAH-RLADYVTFMGYTHVELLGVM--
GLGB_DEBHA      ------------------IYEAHVGIST------PEPKVGSYKNFT-TKVLPVIHKLGYNTIQLMAVM--
GLGB_SYNJB      WMHASAEDPP-------------AEGQSVLVDQKPNTRFLTYRELADK-LIPYVKELGFTHIELLPV---
GLGB_BURCM      -----ADQRFRMPWS---IYEVHAESWQRVPEDMD---RSANWDELAERLIPYVRGMGFTHVEFMPISEY
GLGB1_XANC5     ----------------MSIYEIHA-GSWLREXXXXXXXXXXXXXX-----IPYVADMGFTHVELMPVS--
GLGB_BURXL      ----AGKQTARSPIS---IYEVHAESW-LRVAEEGQ--RGLDWEELAERMIPYVKSMGFTHVEFMPI---
GLGB_LEIXX      -------------------------------------------------LIDYLGALGYTHVEFLP----
GLGB_LACS1      -------------------------------------------------LIPYVKKMGYTHIEFMP----
GLGB_BACSU      VF----------------IYELHL-GSWKKHSD---GRHYSYKELSQ-TLIPYIKKHGFTHIELLPVY--
GLGB2_CLOPE     -------------------------------------------------LVEYIKEMGYTHVEFMPIN--
NEPU_BACST      ---------------DTVWYQIFPERFANGNPSISPPTPTSFFGGDLQGIIDHLVDLGITGIYLTPIFRS
GLGB_PROM5      -----------------------------RHPVPAADLKPGTRFLTYPELTEKLIPYGFTHIELMPIS--
GLGB_PROM4      -YEMHLGSWLHAPSDEPFIEPNGNKRTAVPAADLKPGTRLLTYPELKQKLIKYVKERGFTHIELMPIS--
GLGB_MANSM      -------------------------------------------------LIPYVKEMGFTHIELLPISEY
GLGB_FRASC      DFTWNLDRRARTAWRTVSVYEVHLRGLSYRE--------------LAEELTAYVVENGFTHVEMLPV---
GLGB_CHLTR      -----------------------------------------------------------THVELLPV---
GLGB_CHLTA      -----------------------------------------------------------THVELLPV---
GLGB_ACTSZ      -------------------------------------------------LIPYVKEMGFTHIELLPISEF
GLGB2_XANC5     -------------------------------------------------LIPYVQQLGFTHIELLPI---
GLGB_SYNJA      --EWLEKRAATDPLRSPIVYEVHL-GSWMHASTEDPPADGTYRELADK-LIPYVKELGFTHIELLPV---
GLGB_ROSDO      ------------------IYEVHLGSWRRVPEDGNRPL--SYVELADQ-LVAYVKDMGFTHMEVMPVSEF
GLGB2_RHIL3     PFRWGRSRQDRLEGAFSV-YEVHV-GSWLR--DQKDGNRSLDWVELSQRLVPYVSDMGFTHIELLPIM--
GLGB2_RHIEC     RFRWSRQQRLEGPIS---VYEVHA-GSWLRENGG----RSLDWVELSQRLVPYVREMGFTHIELLPIM--
GLGB2_CLOPS     -------------------------------------------------LVEYIKEMGYTHVEFMPVN--
GLGB_MYCSS      -------------------------------------------------LTEYIVEHGFTHVEMLPV---
GLGB_MYCSK      -------------------------------------------------LTEYIVEHGFTHVEMLPV---
GLGB_HORSE      ------------------IYESHV-GISSHE--------GKIASYKHFTVLPRIKGLGYNCIQMMAIM--
GLGB_CHLTB      -----------------------------------------------------------THVELLPV---
GLGB_CHLT2      -----------------------------------------------------------THVELLPV---
GLGB_MYCSJ      -------------------------------------------------LTEYVVEHGFTHVEMLPV---
GLGB_MOUSE      ------------------IYESHV-GISSHE--------GKIASYKHSNVLPRIKDLGYNCIQLMAIM--
GLGB_BACST      ----------------------------------------TYQEMAEE-LIPYVLEHGFTHIELLP----
GLGB_AGRT5      ------------------IYEVHA-GSWQRRED------GTFLSWDELALIPYCTDMGFTHIEFLPIHPY
GLGB_SYNPW      ------EMHLGSWIHAAADEPFIEADGTPRAPVPAADLKPGARLLTYPELADRLIPYGFTHIELMPI---
GLGB_HUMAN      ------------------IYESHV-GISSHE--------GKVASYKHFTVLPRIKGLGYNCIQLMAIM--
GLGB_GRABC      -------------------------------------------------LIPYVQSLGFTHVEFLPVM--
GLGB_GLOIN      ------------------IYEAHV-GISTNEGRV-----GTYNEFTDN-VLKRIKDLGYNAIQLMAIM--
GLGB1_RHIEC     ------------------------------------------------SLIPYCVDMGFTHIEFLPIHPY
GLGB_STRR6      RKRWGFAERP------VNIYEVHA-GSWKRNPDGSPY---SFAQLKDE-LIPYLVEMNYTHIEFMP----
GLGB_STRP2      RKRWGFAERP------VNIYEVHA-GSWKRNPDGSPY---SFAQLKDE-LIPYLVEMNYTHIEFMP----
GLGB_STRA3      -------------------------------------------------LIPYLVEMNYTHVEFMP----
GLGB_CITK8      ------------------IYEVHL-GSWRRHTDNNFWL--SYRELADQ-LIPYVKWMGFTHLELLPVN--
GLGB_YEAST      --------HPRPKFSESVIYEAHV-GISSPEPKIT-----TYKEFTEK-VLPRIKYLGYDAIQLMAIM--
GLGB_SOLTU      ------------------IYEAHV-GMSSSEPRV-----NSYREFADD-VLPRIKANNYNTVQLMAIM--
GLGB_RHIRD      -------------------------------------------------LIPYCTDMGFTHIEFLPIHPY
GLGB_PROMT      MH-LGSWMHASSD--DPFINSNGEHRAPVPAADMKPGSRLTYKELANK-VIPYVKERGFTHIELMPIS--
GLGB_MESSB      ------------------IYEVHL-GSWRRHED------GRYLSYDELALLPYVKDLGFTHIECMPVS--
GLGB_MARAV      ----------------------------------------TYRELADQ-LVPYVLETGFTHIELLPV---
GLGB_KLULA      ------------------IYEAHVGIST------PEPKVGSYKEFTQN-VLPRIKDLGYDAIQLMAIM--
GLGB_CLOP1      -------------------------------------------------LVEYVKEMGYTHVEFMPIN--
GLGB_CHLCV      RYTWHMENRKNTKDQPLAIYEVHVGSWQW---DNGRPLG--YRELAK-RLAQYCKELHYTHVELLPI---
GLGB1_RHIL3     ------------------------------------------------SLIPYCADMGFTHIEFLPITEY
AMY3_DICT6      -------------YKNAIFYEVFVRSFADSDGDRVGDLNGLIDKL------DYFKNLNITALWLMPIFPS
GLGB_STRPN      RKRWGFEERP------VNIYEVHA-GSWKRNSDGSPY---SFAQLKDE-LIPYLVEMNYTHIEFMP----
GLGB_RALEJ      PFAWQDDEWMRLPYAAPLIYEVHV-GSWLRAAN--DPARGWE--VLADRLIPYVHELGFTHIELLPV---
TREZ_MYCTU      --------------------------------------------------LDYLVDLGIDFVELMPVNSF
GLGB_NOVAD      XXSVDARREP------MSIYEVHPGSWQKPHEEG----FHTWDELAD-RLIPYVAEMGFTHIEFLPVHPY
GLGB_CHLMU      -----------------------------------------------------------THVELLPV---
GLGB_CHLAB      RYTWHMEKRKHRGDQPLAIYEVHV-GSWQWHEGKPLGYRELAKKLA-----AYCKEMHYTHVELLPV---
GLGB_STRA5      -------------------------------------------------LIPYLVEMNYTHVEFMP----
GLGB_STRA1      -------------------------------------------------LIPYLVEMNYTHVEFMP----
GLGB_RALEH      --DWMARRGGADPYAAPMVYEVHALSWLRAANDTQ---RGWE--ILAERLVPYVQELGFTHIELLPI---
GLGB_PROM1      MH-LGSWMHASSD--DPFINSNGEHRAPVPAADMKPGSRLTYKELANK-VIPYVKERGFTHIELMPIS--
GLGB_COREF      DYQWQMDKRAEIDTATTPVYEVHLGSWRWGR---------SYAELA-TELVDYVADLGYTHVEFMPV---
CDAS_THEP3      --------------------------------------------------IDYLKDLGINAIYLTPI--F
CDAS_BACSH      ------------------------------------PSAGNFFGGDLQGVIDHLSDLGVNALYFNPLFAA
GLGB_SACD2      -------------------------------------------------LIPYVKSMGFTHIQLMPISEF
GLGB_GLOVI      ------------------IYEVHL-GSWMRVPEEGDRFL-SYTELADK-LIPYVKDLGFTHIELLPIL--
GLGB_THIDA      RFDW---QHRPMS-----VYEVHP-GSWRRRAD------GSFYSWREAELIPYVRDLGYTHIELLPV---
GLGB_SYNSC      GFQWSDQDSSNALDQPISVYEMHLGSWIHASADEPPPVPATYAELAD-RLIPYVKDRGFTHIEVMPI---
GLGB_SHIBS      ------ERKKANQFDASIIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHLELLPIN--
GLGB_SALAR      -----ERQKANQFDAPISIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHLELLPVN--
GLGB_KLEP7      ------------------IYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHLELLPVN--
GLGB_SYNPX      GFQWSQRRDSSNPLEQPIVYEMHL-GSWIHSPRAPVPAADTYAELA-ARLIPYVKERGFTHIELMPI---
GLGB_SHEB9      -------------------------------------------------LIPYVKEQGFTHIELMPISEF
GLGB_SHEB8      -------------------------------------------------LIPYVKEQGFTHIELMPISEF
GLGB_SHEB5      -------------------------------------------------LIPYVKEQGFTHIELMPISEF
GLGB_SHEB2      -------------------------------------------------LIPYVKEQGFTHIELMPISEF
GLGB_RHOS1      ------RQRRDAPIS---IYEVHAGSWR--------------QGLDYDALAEELSAMGFTHVEFLPIS--
GLGB_FRAP2      ----------------------------------------TYEEIAE-VLPKYVKDMGYTHVEFMPLH--
GLGB_ENT38      ------------------IYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHIELLPIN--
GLGB_ECOL6      ------ERKKANQFDAPIIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHLELLPIN--
GLGB_SHISS      ------ERKKANQFDAPIIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHLELLPIN--
GLGB_SHIFL      ------ERKKANQFDAPIIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHLELLPIN--
GLGB_SHIF8      ------ERKKANQFDAPIIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHLELLPIN--
GLGB_SHIDS      ------ERKKANQFDAPIIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHLELLPIN--
GLGB_PROMS      -------------------------------------------------LIPYVKERGFTHIELMPIS--
GLGB_PROM2      -------------------------------------------------LIPYVKDRGFTHIELMPIS--
GLGB_PROM0      -------------------------------------------------LIPYVKERGFTHIELMPIS--
GLGB_ECOUT      ------ERKKANQFDAPIIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHLELLPIN--
GLGB_ECOLI      ------ERKKANQFDAPIIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHLELLPIN--
GLGB_ECOLC      ------ERKKANQFDAPIIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHLELLPIN--
GLGB_ECOL5      ------ERKKANQFDAPIIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHLELLPIN--
GLGB_ECOK1      ------ERKKANQFDAPIIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHLELLPIN--
GLGB_ECOHS      ------ERKKANQFDAPIIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHLELLPIN--
GLGB_ECO24      ------ERKKANQFDAPIIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHLELLPIN--
GLGB_CORDI      SYTWNDDTHTDHDNTAMSVYEVHLGSWS----------QGQNYEELATNLVDYVKEMGYTHVEFLPV---
GLGB1_CLOPE     ---------------------------------------------------KYIKEMGYTHVEFMPLN--
GLGB_RHOS4      ------RQRRDAPIS---IYEVHAGSWR--------------QGLDYDALAEELSAMGFTHVEFLPIS--
GLGB_HALOH      ----------------------------------------TYRELANE-LVEYVKDMGYNYIELLPV---
GLGB_CANGA      ----------NLANDSIKIYEAHI-GISSPEPKVASYKEFTQN------VLPRIKHLGYDAIQLMAIM--
GLGB1_CLOPS     ---------------------------------------------------KYVKEMGYTHVEFMPLN--
GLGB_STRMU      -------------------------------------------------LVPYLVKMNYTHVEFMP----
GLGB_SALTI      -----ERQKANQFDAPISIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHLELLPVN--
GLGB_SALPB      -----ERQKANQFDAPISIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHLELLPVN--
GLGB_SALCH      -----ERQKANQFDAPISIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHLELLPVN--
GLGB_FRATW      ---------------------------------------------------QYIKEMGYTHVEFMPLH--
GLGB_FRATT      ---------------------------------------------------QYIKEMGYTHVEFMPLH--
GLGB_FRATN      ---------------------------------------------------QYIKEMGYTHVEFMPLH--
GLGB_FRATM      ---------------------------------------------------QYIKEMGYTHVEFMPLH--
GLGB_FRAT1      ---------------------------------------------------QYIKEMGYTHVEFMPLH--
GLGB_ECO57      ------ERKKANQFDAPIIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHLELLPLN--
GLGB_CHLFF      -----------------------------------------YRGLAE-RLAQYCKEMSYTHIELLPI---
GLGB_SYNS9      ----------------------------------------TYAELSD-RLIPYVKERGFTHIELMPI---
GLGB_STRSV      RKRWGFFSRP------VNIYEVHA-GSWKRNEDGSPY---SFAQLKED-LIPYLVEMNYTHVEFMP----
GLGB_SALTY      ----GEERQKANQFDAPIIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHLELLPVN--
GLGB_FRATO      ---------------------------------------------------QYIKEMGYTHVEFMPLH--
GLGB_FRATH      ---------------------------------------------------QYIKEMGYTHVEFMPLH--
GLGB_FRATF      ---------------------------------------------------QYIKEMGYTHVEFMPLH--
GLGB_CORGL      -------------------------------------------------LVDYVADLGYTHVEFLPV---
MGTA_THEMA      ---------------------------------------GDFRGLKNA--VSYLKELGIDFVWLMPVFSS
GLGB_STRGC      ------------------IYEVHA-GSWKRNEDGSPY---SFAQLKED-LIPYLVEMNYTHVEFMP----
GLGB_RHOPB      MS----------------IYEVHLGSW--RRKDDNQWLSYRELAEVLPAYVR---DLGFTHVEFLPVN--
GLGB_PROMM      ----------------------------------------TYPELADQ-LIPYVKDRGFTHIELMPIS--
GLGB_PROM3      ----------------------------------------TYPELADQ-LIPYVKDRGFTHIELMPIS--
GLGB_THEEB      SYEWGKRRHTDPLNQPISVYEVHLGSWLHASMEDPPPVQATYRELA-AKLIPYVKELGYTHIELLPV---
GLGB_NITHX      -------------------------------------------------------SLGFTHIELMPVN--
GLGB_SYNS3      GFQWNDDAWINSPLDQPIVYEMHLGSWIHASADDPPPVPATYPELAD-RLIPYVKEQGFSHIELMPI---
GLGB_SHEON      -------------------------------------------------LIPYVKEQGFTHIELMPVSEY
GLGB_SALPA      -----ERQKANQFDAPISIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHLELLPVN--
GLGB_BIFLO      YKAWMQHRRTTNPHDGPVIYEVHAQGLTYR--DLAKQL------------VDYVKQEGFTHVEFMP----
AMYM_BACAD      -----------------------------REPEIDNFFGGDLEGVIEH--IDYLKELGIGGIYFTPIFKA
MGTA_THENE      --------------------------------------------------ISYLKELGVDFVWLMPVFSS
GLGB_RHOP2      ------------------IYEVHLGSW--RRKDGEQWL--TYRELAEQ-LPAYVRDMGFTHVEFLPVS--
GLGB_SHEPC      -------------------------------------------------LIPYVKAQGFTHIELMPISEY
GLGB_RHOPA      ----------------------------------------------------YVRDMGFTHVEFLPVS--
GLGB_SYNP6      ----------------------------------------TYRELAD-RLIPYVLDLGYSHIELLPI---
GLGB_SYNE7      ----------------------------------------TYRELAD-RLIPYVLDLGYSHIELLPI---
GLGB_SHESR      -------------------------------------------------LIPYVKEQGFTHIELMPVSEY
GLGB_SHESM      -------------------------------------------------LIPYVKEQGFTHIELMPVSEY
GLGB_LACAC      -------------------------------------------------LIPYVKEQGFNYIEFLP----
GLGB_DESHY      -------------------------------------------------LIPYVKSLGYTHIEILP----
CDGT_BACST      ---------------------------------------GDWQGIINKINDGYLTDMGVTAIWISQPVEN
O16G2_BACSU     -------------WKDAVVYQIYPRSFQDSNGDGIGDLRGIISRL------DYIKELGADVIWICPIY--
GLGB_SYNY3      YLHLGSWLHTA---YDEPVKTLHGEGVPVEVSEWNTGARFLTYYELVDKLIPYVKELGYTHIELLPI---
GLGB_SHEFN      RYDWQDSQW----LADRASHQPHVQPMSIYEVQLASWRRKTDYSQLIAELVPYIKEMGFTHLQLMPISEY
GLGB_NITWN      ---------------------------------------------------DYVRELGFTHIELMPVN--
GLGB_SHESW      -------------------------------------------------LIPYVKAQSFTHIELMPISEY
GLGB_RHOPS      ----------------------------------------------------YVREMGFTHVEFLPVS--
GLGB_RHOP5      ----------------------------------------------------YVRDLGFTHVEFLPIN--
GLGB_BURPS      -------------------------------------------------LIPYAAGMGFSHVELTPIAEY
GLGB_BURP6      -------------------------------------------------LIPYAAGMGFSHVELTPIAEY
GLGB_BURP1      -------------------------------------------------LIPYAAGMGFSHVELTPIAEY
GLGB_BURP0      -------------------------------------------------LIPYAAGMGFSHVELTPIAEY
GLGB_ANAVT      ----------------------------------------TYRELAS-RLIPYVKELGYTHIELLPI---
GLGB_BURS3      -------------------------------------------------LIPYVQGMGFTHVEFMPIAEY
GLGB_BACWK      -----------------------------------------------PYVVEHQF----THIEIMP----
NEPU2_THEVU     ---------------EAVIYQIFPERFANGDPSNDPPGTEQWAKDARPGVIDYLEELGVTALYFTPIFAS
AMY_BACSU       ---------------------------------------------------------GYTAIQTSPINQ-
AMYB_PAEPO      --------------------------------------------------LDYIKNMGFTAIWITPVTMQ
GLGB_BRASB      --------------RPVSIYEVHLGSW--RRKDNNQWL--TYRELAEQ-LPAYARDMGFTHIEFLPVS--
GLGB_BRAJA      --------------------------------------------------------MGFTHLEFLPVS--
GLGB_BORPA      --QRAARQRCDAPIS---IYEVHAGSW---FDDAGAPRWQSLAAR----LPEYARSLGFTHIELLPV---
GLGB_ANASP      ----------------------------------------TYRELAS-RLIPYVKELGYTHIELLPI---
GLGB_BORBR      --QRAARQRCDAPIS---IYEVHAGSW---FDDAGAPRWQSLAAR----LPEYARSLGFTHIELLPV---
GLGB_BACCN      -----------------------------------------------------LYSYREMAEELIPYHHF
GLGB_BORPE      --QRAARQRCDAPIS---IYEVHAGSW---FDDAGAPRWQNLAAR----LPEYARSLGFTHIELLPV---
GLGB_BACCZ      -----------------------------------------------PYVVEHQF----THIEIMP----
GLGB_BACCR      -----------------------------------------------PYVVEHQF----THIEIMP----
GLGB_BACCQ      -----------------------------------------------PYVVEHQF----THIEIMP----
GLGB_BACC4      -----------------------------------------------PYVVEHQF----THIEIMP----
GLGB_BACC1      -----------------------------------------------PYVVEHQF----THIEIMP----
GLGB_BACAN      -----------------------------------------------PYVVEHQF----THIEIMP----
GLGB_BACAC      -----------------------------------------------PYVVEHQF----THIEIMP----
GLGB_BACAA      -----------------------------------------------PYVVEHQF----THIEIMP----
GLGB_BACHK      -----------------------------------------------PYVVEHQF----THIEIMP----
GLGB_BACC3      -----------------------------------------------PYVVEHQF----THIEIMP----
GLGB_BACC0      -----------------------------------------------PYVVEHQF----THIEIMP----
GLGB_BACC7      -----------------------------------------------PYVVEHQF----THIEIMP----
GLGB_BACC2      -----------------------------------------------PYVVEHQF----THIEIMP----
CDGT_BACS8      ---------------------------------------GDWQGIINKINDGYLTGMGVTAIWIQPVENI
CDGT_BACS2      ---------------------------------------GDWQGIIDKINDGYLTDLGITALWIQPVENV
CDGT_BACS0      ---------------------------------------GDWQGIINKINDGYLTGMGITAIWIQPVENI
CDGT2_BACCI     ---------------------------------------GDWQGIINKINDGYLTGMGVTAIWIQPVENI
AMY2_DICT6      --------------------------------------------------LDYIENLGINTIWISPIFKS
CDGT_THETU      ------------------------------HTSLKKYFGGDWQGIINKINDGYLTGMGVTAIWISQIYAV
AGL_PEDPE       -------------WQQAVVYQVYPRSFQDTNHDGIGDLKGITAHL------DYLKQLGIDVIWLNPIY--
O16G1_BACSU     ----------------------------------------------------------------------
CDGT_BACS3      ---------------------------------------GDWQGIINKINDGYLTGMGITAIWIQPVENI
CDGT_BAC11      ---------------------------------------GDWQGIINKINDGYLTGMGVTAIWIQPVENI
APU_THEP3       --------------------------------------------------LDYLKNLGISVIYLNPIFQS
AMY1_DEBOC      -----------------------------------------YCGGSYKGIIDYIQGMGFTAIWISPVVEQ
AMYM_BACST      --------------------------------------------------LPYLKQLGVTTIWLSPVLDN
AMY2A_ORYSJ     --------------------------------------------------VDDIVAAGVTHVWLPP----
AMY2A_ORYSI     --------------------------------------------------VDDIVAAGVTHVWLPP----
MDE5_SCHPO      --------------------------------------------------LDYIQGMGFTAIWISPIIKN
AMY3E_ORYSJ     --------------------------------------------------VEEIASTGATHVWLPP----
AMY3A_ORYSJ     -----------------------------------------------------IASAGVTHVWLPP----
AMY_ASPSH       ---------------------------------------GTWQGIIDK--LDYIQGMGFTAIWITPVTAQ
AMYB_ASPAW      ---------------------------------------GTWQGIIDK--LDYIQGMGFTAIWITPVTAQ
AMYA_ASPAW      ---------------------------------------GTWQGIIDK--LDYIQGMGFTAIWITPVTAQ
AMYA3_ASPOR     ---------------------------------------GTWQGIIDK--LDYIQGMGFTAIWITPVTAQ
AMYA1_ASPOR     ---------------------------------------GTWQGIIDK--LDYIQGMGFTAIWITPVTAQ
AMY_STRLI       --------------------------------------------------LDYIKGLGTTSIWMAPIFKN
CDGT_BACLI      ---------------------------------------GDWQGLVNKINDNYFSDLGVTALWIQPVENI
AMY_STRHY       ----------------------------------------------------------------------
AMY2_HORVU      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LPEHALVARGLTNYWGYNTLAFFAPHSGYAATGTRGHQVQEFKTMVKALHQAGIEVILDVVYNHTAEGDH
GLGX_MYCTU      LHDSRLLDLGLRNYWGYNTFGFFAPHHQYASTRQAGSAVAEFKTMVRSLHEAGIEVILDVVYNHTAEGNH
GLGX_MYCBO      LHDSRLLDLGLRNYWGYNTFGFFAPHHQYASTRQAGSAVAEFKTMVRSLHEAGIEVILDVVYNHTAEGNH
GLGX_ENT38      ASEPRLQRLGLTNYWGYNPLAMFALDPRYASHPERARD--EFRDAVKALHQAGIEVILDVVLNHSAELDL
GLGX_SERP5      SSEPRLQRLGLINYWGYNVLAPYAPDNRYSSLRTDMTPLREFRDAVKALHKAGIEVILDVVFNHSAELDT
GLGX_SHIDS      ASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETA--LHEFRDAIKALHKAGIEVILDIVLNHSAELDL
GLGX_ECO81      ASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETA--LDEFRDAIKALHKAGIEVILDIVLNHSAELDL
GLGX_SHIBS      ASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETA--LDEFRDAIKALHKAGIEVILDIVLNHSAELDL
GLGX_ECOLU      ASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETA--LDEFRDAIKALHKAGIEVILDIVLNHSAELDL
GLGX_ECOLI      ASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETA--LDEFRDAIKALHKAGIEVILDIVLNHSAELDL
GLGX_ECODH      ASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETA--LDEFRDAIKALHKAGIEVILDIVLNHSAELDL
GLGX_ECOBW      ASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETA--LDEFRDAIKALHKAGIEVILDIVLNHSAELDL
GLGX_ECO8A      ASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETA--LHEFRDAIKALHKAGIEVILDIVLNHSAELDL
GLGX_ECO5E      ASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETA--LHEFRDAIKALHKAGIEVILDIVLNHSAELDL
GLGX_ECO57      ASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETA--LHEFRDAIKALHKAGIEVILDIVLNHSAELDL
GLGX_ECO7I      ASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETA--LHEFRDAIKALHKAGIEVILDIVLNHSAELDL
GLGX_SHIB3      ASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETA--LDEFRDAIKALHKAGIEVILDIVLNHSAELDL
GLGX_ECOSE      ASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETA--LDEFRDAIKALHKAGIEVILDIVLNHSAELDL
GLGX_ECOLC      ASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETA--LDEFRDAIKALHKAGIEVILDIVLNHSAELDL
GLGX_ECOHS      ASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETA--LDEFRDAIKALHKAGIEVILDIVLNHSAELDL
GLGX_ECO27      ASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETA--LDEFRDAIKALHKAGIEVILDIVLNHSAELDL
GLGX_ERWT9      ASEPRLLRLGLSNYWGYNPLACYALESRYACGQ---NPREEFQQAVKTLHQAGIEVILDVVFNHSAELDE
GLGX_ECO55      ASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETA--LDEFRDAIKALHKAGIEVILDIVLNHSAELDL
GLGX_ECO24      ASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETA--LDEFRDAIKALHKAGIEVILDIVLNHSAELDL
GLGX_SHIFL      ASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETA--LDEFRDAIKALHKAGIEVILDIVLNHSAELDL
GLGX_SHIF8      ASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETA--LDEFRDAIKALHKAGIEVILDIVLNHSAELDL
GLGX_ECOSM      ASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETA--LDEFRDAIKALHKAGIEVILDIVLNHSAELDL
GLGX_ECOL5      ASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETA--LDEFRDAIKALHKAGIEVILDIVLNHSAELDL
GLGX_ECOL6      ASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETA--LDEFRDAIKALHKAGIE</