[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ55991.1

[Show Plain Result]


## Summary of Sequence Search
    1::252
   18::153     6e-16  37%  200 aa  CBIZ_METMA RecName: Full=Adenosylcobinamide amidohydrolase;        
    1::252

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAASSVLGGGLGPRDYVINAQVDGDYRRTDPD
CBIZ_METMA      ---------------------------------------AVSTGLNGGRARVEYIFNKQVPRTFNPPSPE


                         .         .         *         .         .         .         .:140
query           NHLEELATHFGMTGTGVGLLTAANVSEACFADDHGVEVLATVGLGRPTWAAADPALDEARLPGEETRPGT
CBIZ_METMA      EFIREEARKDGIETASLGLLTAVNMEYLQVIEDDYMTAFITAGVSNCSEFRA--------------KAGT


                         +         .         .         .         .         *         .:210
query           INIVVAVPAPMSDTALVNLVATATEAKVQALFDSGYACTGTASDAVCVAxxxxxxxxxxxxxxxxxxxxx
CBIZ_METMA      INIILVSKARLSETALFGAIITATEAKGLALLEKGYNFLGTNTDAVIVA---------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CBIZ_METMA      ------------------------------------------