[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ56010.1

[Show Plain Result]


## Summary of Sequence Search
    1::389
  597::841     7e-09  29% 1276 aa  PHY2_SYNY3 RecName: Full=Phytochrome-like protein cph2;AltName:
  581::805     2e-07  27%  827 aa  Y4LL_RHISN RecName: Full=Uncharacterized protein y4lL;
  587::733     2e-06  30%  735 aa  Y3085_AZOC5 RecName: Full=Uncharacterized protein AZC_3085;
   15::89      1e-04  45%  715 aa  PNP_THEEB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   33::88      1e-04  46%  716 aa  PNP_SYNP6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   33::88      1e-04  46%  716 aa  PNP_SYNE7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   22::96      3e-04  39%  702 aa  PNP_HALHL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   21::89      5e-04  48%  718 aa  PNP_CYAP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   36::88      6e-04  47%  717 aa  PNP_TRIEI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   43::88      6e-04  50%  716 aa  PNP_ACAM1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   22::89      8e-04  44%  718 aa  PNP_SYNY3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   43::89      8e-04  47%  721 aa  PNP_PROMS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
    1::389

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxRSGDHGAVSPQTSFSDDTRVGVLPTASLSVVLRPIIDLDSGAVLAVEAVVPVDRRSGADVAVLTELL
PHY2_SYNY3      ---RPQDSAPMLDRLTLESDLRQA-LTNQEFVLYFQPQVALDTGKLLGVEALVPRLGQVAPDVFILINHL
Y4LL_RHISN      -------------------------LAKGELEVRYQPLANLRTGQITTFEALAPHPERGQVSVAEETGLI
Y3085_AZOC5     ----------------------------------------------------------------------
PNP_THEEB       ------------------------------IKVVLQKFAPQAAGSILI----------SSGETAVLV---
PNP_SYNP6       ----------------------------------------------------------SSGDTAVLVAAT
PNP_SYNE7       ----------------------------------------------------------SSGDTAVLVAAT
PNP_HALHL       --------------------------------------VTLETGGVARADGAVLVDM---ADTVVLVTVV
PNP_CYAP7       ---------------------------------------------LLAPQAGGSVLIQSG-DTAVLV---
PNP_TRIEI       -------------------------------------------------------------DTAVLVTAT
PNP_ACAM1       ----------------------------------------------------------------------
PNP_SYNY3       ----------------------------------------------LAPQAGGSVLIQSG-DTAVLVTAT
PNP_PROMS       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GRVARETAARESFLPLVLPFPARLLTAGQEPLGFLRDTLQRSGRQPRDVTLMVDADLCFLPRDHLVAALA
PHY2_SYNY3      GQWVLETACRETGLRMAVNISARQFQ-DEKWLNSVLECLKRTGMPPEDLELEITESLMMEDIKGTVVLLH
Y4LL_RHISN      GPLG-EWILRQACTEAVKWPPYVSVAVNLSPLQFVRNSLEDTGLDASRLQLEITESVLLEECDSNLQTLK
Y3085_AZOC5     ----------------------------------VRQTMAFHGLPPQCVCFELTESAILNQPEIAIETLS
PNP_THEEB       --TANRAAAREGFLPLVVDYEERLYAAGRIPGGFLR----REGRPPEKAILI------------------
PNP_SYNP6       RSTAREGI---DFLPLTVDYEERMYAAGRIPGGFLR----REGRPPERATL-------------------
PNP_SYNE7       RSTAREGI---DFLPLTVDYEERMYAAGRIPGGFLR----REGRPPERATL-------------------
PNP_HALHL       GR--KDPAAARDFLPLTVNYQERTYAAGRIPGGFFK----REGRPSEKETL-------------------
PNP_CYAP7       --TATKAASREGFLPLTVDYEERLYAAGRIPGGFLR----REGRPPEKAILI------------------
PNP_TRIEI       TAKGREGI---DFLPLLVDYEERLYAGGKIPGGFLR----REGRPPEKVTL-------------------
PNP_ACAM1       ---ATRSSGREGFLPLLVDYEERLYAAGRVPGGFLR----REGRPPEKATL-------------------
PNP_SYNY3       RAKGRDGI---DFLPLTVDYEGRLYAAGRIPGGFLR----REGRPPEKATLI------------------
PNP_PROMS       ---ATKTAKKEDFLPLICDYEEKLFAAGRIPGGFMR----REGRPPERATLI------------------


                         +         .         .         .         .         *         .:210
query           RVREMGFRYAFDTARVSPDLLVETAPFLFRIEGSLTSGLPDQEQCAAIVDGMTRIARGAGTFPLASGVTS
PHY2_SYNY3      RLREEGVQVAIDTGYSSLSILKQLPIHRLKIDKSFVNDLLNEGADTAIIQYVIDLANGLNLETVAEGIES
Y4LL_RHISN      EIRQLGVIVAIDDFGTGYSSLLRTFPFKIKVDRSFIADLPKSKESLAIVRAVAAIGRSLGIITTVEGVER
Y3085_AZOC5     RLRALGCTTAIDTGYSSLSYLQRLPMDVLKIDRSFVLDMVDNSRSREIVRVMIEMAHGLGMSVVAEGVET
PNP_THEEB       ----------------------------------------------------------------------
PNP_SYNP6       ----------------------------------------------------------------------
PNP_SYNE7       ----------------------------------------------------------------------
PNP_HALHL       ----------------------------------------------------------------------
PNP_CYAP7       ----------------------------------------------------------------------
PNP_TRIEI       ----------------------------------------------------------------------
PNP_ACAM1       ----------------------------------------------------------------------
PNP_SYNY3       ----------------------------------------------------------------------
PNP_PROMS       ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IAQLTALRTVGVRMAQGPLFAGDDWAPGDRVTQIPALSLEPLAPxxxxxxxxxxxxxxxxxxxxxxxxxx
PHY2_SYNY3      EAQLQRLQKMGCHLGQG-----------------------------------------------------
Y4LL_RHISN      QDQLDTIKAEGFDEAQGYLFGG------------------------------------------------
Y3085_AZOC5     TGALQILRQMGCDRAQGFLFGRA--MPGDVAGTLP----ETLAP--------------------------
PNP_THEEB       ----------------------------------------------------------------------
PNP_SYNP6       ----------------------------------------------------------------------
PNP_SYNE7       ----------------------------------------------------------------------
PNP_HALHL       ----------------------------------------------------------------------
PNP_CYAP7       ----------------------------------------------------------------------
PNP_TRIEI       ----------------------------------------------------------------------
PNP_ACAM1       ----------------------------------------------------------------------
PNP_SYNY3       ----------------------------------------------------------------------
PNP_PROMS       ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PHY2_SYNY3      ----------------------------------------------------------------------
Y4LL_RHISN      ----------------------------------------------------------------------
Y3085_AZOC5     ----------------------------------------------------------------------
PNP_THEEB       ----------------------------------------------------------------------
PNP_SYNP6       ----------------------------------------------------------------------
PNP_SYNE7       ----------------------------------------------------------------------
PNP_HALHL       ----------------------------------------------------------------------
PNP_CYAP7       ----------------------------------------------------------------------
PNP_TRIEI       ----------------------------------------------------------------------
PNP_ACAM1       ----------------------------------------------------------------------
PNP_SYNY3       ----------------------------------------------------------------------
PNP_PROMS       ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PHY2_SYNY3      ---------------------------------------
Y4LL_RHISN      ---------------------------------------
Y3085_AZOC5     ---------------------------------------
PNP_THEEB       ---------------------------------------
PNP_SYNP6       ---------------------------------------
PNP_SYNE7       ---------------------------------------
PNP_HALHL       ---------------------------------------
PNP_CYAP7       ---------------------------------------
PNP_TRIEI       ---------------------------------------
PNP_ACAM1       ---------------------------------------
PNP_SYNY3       ---------------------------------------
PNP_PROMS       ---------------------------------------