[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ56050.1

[Show Plain Result]


## Summary of Sequence Search
    1::335
    1::336     e-138  73%  336 aa  G3P_STRCO RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::339     e-119  65%  339 aa  G3P_MYCTU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::339     e-119  65%  339 aa  G3P_MYCBO RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::339     e-119  65%  339 aa  G3P_MYCAV RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::332     e-114  67%  335 aa  G3P_BACST RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::330     e-112  62%  335 aa  G3P1_BACSU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::334     e-111  60%  334 aa  G3P_CORGL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::334     e-111  61%  342 aa  G3P_AQUAE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::339     e-110  61%  339 aa  G3P_MYCLE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
   22::333     e-107  64%  333 aa  G3P_STRAE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
   21::332     e-104  61%  335 aa  G3P_BACME RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    3::330     e-103  59%  333 aa  G3P_THEMA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
   20::331     e-100  60%  334 aa  G3P1_BACCE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::326     2e-99  58%  331 aa  G3P_THEAQ RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    3::335     2e-99  53%  337 aa  G3P2_SYNY3 RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    2::332     4e-99  54%  337 aa  G3P2_ANASP RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
   77::405     7e-98  52%  414 aa  G3PA_CHOCR RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
   79::413     7e-97  52%  416 aa  G3PA_GRAVE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    3::331     2e-96  53%  332 aa  G3P_STRAU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    2::332     3e-95  53%  337 aa  G3P2_ANAVT RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::327     8e-94  55%  336 aa  G3PP_RALEH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    1::327     8e-94  55%  336 aa  G3PC_RALEH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    1::333     2e-93  57%  336 aa  G3P_BACCO RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
   67::398     5e-90  49%  401 aa  G3PA_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::334     1e-89  50%  340 aa  G3P2_BACSU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::330     2e-88  54%  333 aa  G3P2_RHOSH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    4::331     5e-88  52%  343 aa  G3P1_ANAVT RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    4::331     1e-87  52%  343 aa  G3P1_ANASP RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::333     2e-87  50%  335 aa  G3P_CHLMU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::332     3e-87  54%  335 aa  G3P_XANFL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::331     5e-87  54%  335 aa  G3P_BORBU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
   82::416     3e-86  50%  447 aa  G3PB_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::333     3e-86  49%  335 aa  G3P_CHLPN RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::324     6e-86  52%  334 aa  G3P_PSEAE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    3::323     2e-85  54%  334 aa  G3P_CLOPA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::330     4e-85  49%  332 aa  G3P_RALSO RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    3::323     8e-85  53%  334 aa  G3P_CLOAB RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::331     1e-84  51%  338 aa  G3P_PARBA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::337     1e-84  50%  337 aa  G3P_ZYMMO RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::325     1e-84  55%  336 aa  G3P_STRP3 RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::330     3e-84  50%  338 aa  G3P_NEUCR RecName: Full=Glyceraldehyde 3-phosphate-dehydrogenase;  
    1::332     3e-84  50%  334 aa  G3P_CHLTR RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
   85::419     7e-84  49%  451 aa  G3PB_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    5::331     9e-84  52%  337 aa  G3P_MONAN RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::326     2e-83  50%  331 aa  G3P1_ESCF3 RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::330     3e-83  49%  337 aa  G3P_COCPO RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    2::334     3e-83  51%  339 aa  G3P1_SYNY3 RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::326     3e-83  50%  331 aa  G3P1_SHIFL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::326     3e-83  49%  331 aa  G3P1_SALTY RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase; 
    1::326     3e-83  49%  331 aa  G3P1_SALTI RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase; 
    1::326     3e-83  50%  331 aa  G3P1_ECOLI RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::326     3e-83  50%  331 aa  G3P1_ECOL6 RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::326     3e-83  50%  331 aa  G3P1_ECO57 RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::330     6e-83  50%  337 aa  G3P_AJECA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::330     8e-83  50%  331 aa  G3P_CANAL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::330     1e-82  49%  338 aa  G3P_SORMA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::329     1e-82  48%  341 aa  G3P2_STAEQ RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::330     2e-82  49%  337 aa  G3P_COCIM RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::329     2e-82  48%  341 aa  G3P2_STAES RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
   38::367     3e-82  49%  374 aa  G3PA_CHLRE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::325     7e-82  52%  336 aa  G3P1_STAES RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::325     7e-82  52%  336 aa  G3P1_STAEQ RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::330     9e-82  50%  337 aa  G3P_PODAN RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    6::333     1e-81  48%  335 aa  G3P_HALVA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::330     1e-81  50%  335 aa  G3P_DEBHA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::330     2e-81  51%  333 aa  G3P_PICPA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    3::332     2e-81  50%  338 aa  G3P_ASPOR RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::333     2e-81  48%  337 aa  G3P1_GIALA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    7::331     3e-81  53%  337 aa  G3P_MYCPN RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
   68::397     3e-81  46%  403 aa  G3PA_MAIZE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::330     6e-81  49%  336 aa  G3P_EMENI RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::330     6e-81  49%  337 aa  G3P_CLAPU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    5::329     6e-81  50%  341 aa  G3PC_CHLRE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    1::325     2e-80  53%  336 aa  G3P_STRPY RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::325     2e-80  53%  336 aa  G3P_STRP8 RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::325     2e-80  53%  336 aa  G3P_STRP6 RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::325     2e-80  53%  336 aa  G3P_STRP1 RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    4::328     3e-80  49%  338 aa  G3P_COLGL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    4::353     3e-80  49%  361 aa  G3PG_CRIFA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    4::327     4e-80  49%  337 aa  G3P_COLLN RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::352     4e-80  48%  359 aa  G3PG_TRYCR RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    2::328     4e-80  50%  329 aa  G3P1_KLULA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    2::331     5e-80  50%  331 aa  G3P_ASHGO RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
   62::394     5e-80  46%  396 aa  G3PA_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::325     5e-80  50%  336 aa  G3P1_STAAW RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::325     5e-80  50%  336 aa  G3P1_STAAU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::325     5e-80  50%  336 aa  G3P1_STAAS RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::325     5e-80  50%  336 aa  G3P1_STAAR RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::325     5e-80  50%  336 aa  G3P1_STAAN RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::325     5e-80  50%  336 aa  G3P1_STAAM RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::325     5e-80  50%  336 aa  G3P1_STAAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    2::332     6e-80  47%  333 aa  G3P_BACFR RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::326     6e-80  49%  331 aa  G3PC_TRYBB RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    2::329     6e-80  49%  332 aa  G3P1_YEAST RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    4::353     1e-79  49%  361 aa  G3PG_LEIME RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    2::331     1e-79  50%  331 aa  G3P2_KLULA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    2::329     3e-79  50%  332 aa  G3P3_YEAST RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    4::328     3e-79  49%  338 aa  G3P2_TRIKO RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    2::331     3e-79  50%  331 aa  G3P2_KLUMA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    6::339     3e-79  50%  341 aa  G3P1_CAEEL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
   86::420     5e-79  47%  451 aa  G3PB_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B,
    1::329     5e-79  49%  336 aa  G3P1_TRIKO RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    2::328     5e-79  49%  329 aa  G3P1_KLUMA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::325     7e-79  52%  336 aa  G3P_STREQ RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    6::339     7e-79  50%  341 aa  G3P4_CAEEL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    2::331     7e-79  50%  331 aa  G3P3_KLUMA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    2::331     1e-78  50%  333 aa  G3P_CRIGR RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    2::329     1e-78  49%  332 aa  G3P2_YEAST RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    2::332     1e-78  50%  332 aa  G3P2_CANGA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    2::332     2e-78  50%  333 aa  G3P_ZYGRO RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
   55::390     2e-78  46%  438 aa  G3PB_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    2::326     2e-78  50%  333 aa  G3P_COTJA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    6::339     2e-78  50%  341 aa  G3P3_CAEEL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::336     2e-78  46%  337 aa  G3P3_ANAVT RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    6::339     2e-78  50%  341 aa  G3P2_CAEEL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    6::339     3e-78  50%  341 aa  G3P3_CAEBR RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::348     3e-78  49%  359 aa  G3PG_TRYBB RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    6::339     3e-78  49%  341 aa  G3P2_CAEBR RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    2::329     4e-78  48%  338 aa  G3P2_AGABI RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    2::329     4e-78  49%  332 aa  G3P1_CANGA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
   71::403     6e-78  45%  405 aa  G3PA_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A,
    1::336     6e-78  46%  337 aa  G3P3_ANASP RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::330     8e-78  48%  337 aa  G3P_CRYPA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
   77::406     8e-78  51%  409 aa  G3PT_MACFA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    2::331     1e-77  49%  333 aa  G3P_MUSPF RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    2::326     1e-77  50%  333 aa  G3P_COLLI RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    2::326     2e-77  50%  333 aa  G3P_CHICK RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    2::326     2e-77  50%  333 aa  G3P_SPECI RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::332     2e-77  47%  334 aa  G3P_PICCI RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::331     2e-77  45%  343 aa  E4PD_PSEHT RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    2::331     3e-77  49%  333 aa  G3P_RAT RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;    
    2::331     3e-77  49%  333 aa  G3P_MOUSE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::330     4e-77  48%  336 aa  G3P_ASPNG RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    2::326     6e-77  48%  333 aa  G3P_TRISI RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    2::331     6e-77  49%  333 aa  G3P_CANFA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    6::333     6e-77  48%  335 aa  G3PT_DANRE RecName: Full=Glyceraldehyde 3-phosphate dehydrogenase,
    1::330     8e-77  50%  335 aa  G3P_PICAN RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
   58::389     8e-77  45%  392 aa  G3PA_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::327     8e-77  48%  337 aa  G3P1_RHIRA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    2::326     1e-76  49%  333 aa  G3P_RABIT RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    2::331     1e-76  49%  333 aa  G3P_FELCA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    7::333     1e-76  49%  340 aa  G3PC_PINSY RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
  108::437     2e-76  46%  440 aa  G3PT_MOUSE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    2::326     3e-76  49%  333 aa  G3P_PIG RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;    
    1::331     4e-76  47%  338 aa  G3P_YARLI RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    5::333     5e-76  49%  339 aa  G3P_ONCVO RecName: Full=Glyceraldehyde 3-phosphate-dehydrogenase;  
    2::326     7e-76  49%  333 aa  G3P_BOVIN RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    4::333     2e-75  48%  335 aa  G3P_PONAB RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    4::333     2e-75  48%  335 aa  G3P_HUMAN RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
   76::405     2e-75  46%  408 aa  G3PT_HUMAN RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    1::330     2e-75  48%  337 aa  G3P_OMPOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::327     3e-75  47%  337 aa  G3P_PHANO RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    2::325     3e-75  48%  333 aa  G3P_HOMAM RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::328     3e-75  48%  335 aa  G3PC_GRAVE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    1::327     4e-75  47%  337 aa  G3P_COCHE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::330     5e-75  46%  338 aa  G3P_TRIAT RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
   65::392     5e-75  49%  395 aa  G3PT_BOVIN RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
   25::324     5e-75  52%  333 aa  G3P3_ECOLI RecName: Full=Putative glyceraldehyde-3-phosphate
    1::327     5e-75  48%  338 aa  G3P2_RHIRA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    2::325     8e-75  46%  331 aa  G3PC_LEIME RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
   25::324     8e-75  52%  333 aa  G3P3_ECO57 RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    7::331     1e-74  48%  337 aa  G3P_MYCGE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::327     1e-74  46%  337 aa  G3P_CURLU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    5::331     1e-74  51%  338 aa  G3PC_RANAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    1::333     2e-74  46%  338 aa  G3P_PHARH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::331     2e-74  43%  333 aa  G3P_BUCBP RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::326     3e-74  48%  337 aa  G3P_LACLA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    2::325     5e-74  48%  333 aa  G3P_PANVR RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    2::331     5e-74  48%  333 aa  G3P_DANRE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    2::356     7e-74  49%  363 aa  G3P1_JACOR RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    2::326     1e-73  47%  333 aa  G3P_XENLA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    6::328     1e-73  46%  335 aa  G3P_ONCMY RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    4::331     1e-73  45%  338 aa  G3P_ERYGR RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
  100::429     1e-73  45%  432 aa  G3PT_RAT RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    1::332     2e-73  45%  341 aa  G3P2_STAAR RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    2::326     6e-73  45%  337 aa  G3P_LYOSH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::328     6e-73  46%  335 aa  G3P_DICDI RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::329     6e-73  45%  332 aa  G3P_BUCAP RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    5::338     6e-73  47%  339 aa  G3P_BRUMA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    5::328     6e-73  46%  336 aa  G3P1_SCHPO RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::332     7e-73  45%  341 aa  G3P2_STAAW RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::332     7e-73  45%  341 aa  G3P2_STAAS RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::332     7e-73  45%  341 aa  G3P2_STAAN RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::332     7e-73  45%  341 aa  G3P2_STAAM RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::332     7e-73  45%  341 aa  G3P2_STAAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    5::324     7e-73  47%  324 aa  G3P1_GLORO RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::346     2e-72  47%  350 aa  G3P_TREPA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    5::331     1e-71  45%  338 aa  G3P_SCLSC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    4::331     1e-71  47%  337 aa  G3PX_HORVU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    1::331     1e-71  45%  339 aa  G3P_CRYNE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::303     2e-71  48%  303 aa  G3P_KLEPN RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::318     3e-71  45%  332 aa  G3P_BUCAI RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    5::333     4e-71  46%  335 aa  G3P2_SCHPO RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    4::331     7e-71  48%  337 aa  G3PD_MAIZE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    4::331     7e-71  48%  337 aa  G3PC_MAIZE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    1::328     7e-71  42%  348 aa  E4PD_SALG2 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     9e-71  42%  348 aa  E4PD_SALSV RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::312     1e-70  49%  312 aa  G3P_MESAU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::328     1e-70  42%  348 aa  E4PD_SALTY RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     1e-70  42%  348 aa  E4PD_SALTI RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     1e-70  42%  348 aa  E4PD_SALPC RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     1e-70  42%  348 aa  E4PD_SALPB RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     1e-70  42%  348 aa  E4PD_SALNS RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     1e-70  42%  348 aa  E4PD_SALHS RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     1e-70  42%  348 aa  E4PD_SALEP RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     1e-70  42%  348 aa  E4PD_SALDC RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     1e-70  42%  348 aa  E4PD_SALCH RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     1e-70  42%  348 aa  E4PD_SALA4 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::329     2e-70  47%  338 aa  G3P_LACDE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    5::338     2e-70  48%  338 aa  G3PC_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    1::331     3e-70  46%  332 aa  G3P_PHYIN RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::326     4e-70  46%  336 aa  G3P_RHIMI RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    4::331     4e-70  48%  360 aa  G3P_ATRNU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::314     4e-70  44%  314 aa  G3PA_SCEVA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::328     4e-70  42%  348 aa  E4PD_SALPK RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     4e-70  42%  348 aa  E4PD_SALPA RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     4e-70  42%  342 aa  E4PD_SALAR RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    2::332     4e-70  42%  336 aa  E4PD_ALTMD RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    4::335     6e-70  48%  337 aa  G3PE_MAIZE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    6::332     6e-70  47%  338 aa  G3PC_SINAL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    1::328     6e-70  42%  339 aa  E4PD_ESCF3 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    7::340     8e-70  47%  340 aa  G3PC_GINBI RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    1::328     8e-70  42%  339 aa  E4PD_SHISS RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     8e-70  42%  339 aa  E4PD_SHIFL RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     8e-70  42%  339 aa  E4PD_SHIF8 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     8e-70  42%  339 aa  E4PD_SHIBS RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     8e-70  42%  339 aa  E4PD_SHIB3 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     8e-70  42%  339 aa  E4PD_ECOUT RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     8e-70  42%  339 aa  E4PD_ECOSM RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     8e-70  42%  339 aa  E4PD_ECOSE RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     8e-70  42%  339 aa  E4PD_ECOLU RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     8e-70  42%  339 aa  E4PD_ECOLI RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     8e-70  42%  339 aa  E4PD_ECOLC RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     8e-70  42%  339 aa  E4PD_ECOL6 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     8e-70  42%  339 aa  E4PD_ECOL5 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     8e-70  42%  339 aa  E4PD_ECOHS RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     8e-70  42%  339 aa  E4PD_ECODH RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     8e-70  42%  339 aa  E4PD_ECOBW RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     8e-70  42%  339 aa  E4PD_ECO8A RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     8e-70  42%  339 aa  E4PD_ECO81 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     8e-70  42%  339 aa  E4PD_ECO5E RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     8e-70  42%  339 aa  E4PD_ECO57 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     8e-70  42%  339 aa  E4PD_ECO55 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     8e-70  42%  339 aa  E4PD_ECO27 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     8e-70  42%  339 aa  E4PD_ECO24 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     1e-69  42%  339 aa  E4PD_SHIDS RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::330     1e-69  43%  337 aa  G3P_CRYCU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    7::333     1e-69  47%  340 aa  G3PC_TAXBA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    1::327     2e-69  45%  337 aa  G3P_LENED RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
   26::331     2e-69  47%  339 aa  G3P_HAEIN RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    4::331     2e-69  46%  337 aa  G3PC_ORYSJ RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    4::331     2e-69  46%  337 aa  G3PC_ORYSI RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    1::328     2e-69  41%  339 aa  E4PD_PROMH RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::334     2e-69  47%  336 aa  G3PC_PETCR RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    1::328     3e-69  44%  336 aa  G3P_ECHMU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    3::332     3e-69  47%  339 aa  G3P3_RHIRA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::328     3e-69  42%  339 aa  E4PD_ECOK1 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     3e-69  42%  339 aa  E4PD_ECO7I RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     3e-69  42%  339 aa  E4PD_ECO45 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::327     5e-69  43%  337 aa  G3P_SCHCO RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    4::330     5e-69  47%  338 aa  G3PC_DIACA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    1::328     5e-69  41%  338 aa  E4PD_TOLAT RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    4::330     6e-69  48%  337 aa  G3PC_MESCR RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    1::328     6e-69  42%  342 aa  E4PD_KLEP7 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::327     8e-69  44%  337 aa  G3P_PHACH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    3::330     8e-69  45%  333 aa  G3P_GLOMM RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::328     8e-69  42%  342 aa  E4PD_KLEP3 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     8e-69  41%  339 aa  E4PD_CITK8 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    2::327     1e-68  41%  338 aa  E4PD_SHESR RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    2::327     1e-68  41%  338 aa  E4PD_SHESM RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    2::328     2e-68  43%  335 aa  G3P_PLESA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    4::330     2e-68  48%  337 aa  G3PC_ANTMA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    2::327     2e-68  41%  338 aa  E4PD_SHESA RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    2::327     2e-68  41%  338 aa  E4PD_SHEB2 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    2::327     3e-68  41%  338 aa  E4PD_SHEON RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     3e-68  41%  339 aa  E4PD_ENTS8 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    4::335     4e-68  46%  337 aa  G3PC_PETHY RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    2::330     4e-68  41%  336 aa  E4PD_AERHH RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    7::332     5e-68  47%  342 aa  G3PC_PHYPA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    5::328     9e-68  44%  335 aa  G3PC_CHOCR RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    1::328     2e-67  41%  339 aa  E4PD_ENT38 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    2::330     2e-67  41%  336 aa  E4PD_AERS4 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
   10::294     4e-67  47%  294 aa  G3P_SERMA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::335     4e-67  40%  338 aa  E4PD_ERWCT RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    5::329     6e-67  45%  338 aa  G3P_SCHMA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
   10::294     6e-67  47%  294 aa  G3P1_ESCFE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    2::327     6e-67  40%  338 aa  E4PD_SHESW RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    2::327     6e-67  40%  338 aa  E4PD_SHEPW RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    2::327     6e-67  40%  338 aa  E4PD_SHEPC RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    3::294     8e-67  50%  294 aa  G3P_ESCHE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    2::334     1e-66  40%  342 aa  E4PD_PSEA6 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
   30::328     1e-66  45%  337 aa  G3P_USTMA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::312     1e-66  46%  312 aa  G3PC_SCEVA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    3::330     1e-66  44%  332 aa  G3P2_DROME RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::335     1e-66  39%  338 aa  E4PD_PECCP RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
   10::294     2e-66  47%  294 aa  G3P1_ESCVU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase; 
    2::327     2e-66  40%  339 aa  E4PD_SHEFN RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    2::333     2e-66  44%  337 aa  G3P1_AGABI RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    2::327     3e-66  40%  342 aa  E4PD_SHEDO RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     3e-66  41%  348 aa  E4PD_ERWT9 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
   10::294     4e-66  47%  294 aa  G3P_CITFR RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    2::327     4e-66  39%  339 aa  E4PD_SHEHH RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    3::261     5e-66  55%  264 aa  G3P_BORHE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    2::327     5e-66  39%  339 aa  E4PD_SHEPA RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::319     7e-66  48%  326 aa  G3PC_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    1::315     1e-65  46%  322 aa  G3P_SHEEP RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
   10::294     2e-65  46%  294 aa  G3P_ENTAE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    3::330     3e-65  43%  332 aa  G3P_DROHY RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
   10::294     4e-65  46%  294 aa  G3P_SEROD RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    2::327     4e-65  44%  338 aa  E4PD_SHEAM RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     6e-65  39%  338 aa  E4PD_YERE8 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
   30::330     1e-64  48%  339 aa  G3P_MASBA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    2::327     1e-64  39%  338 aa  E4PD_SHELP RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
   10::294     3e-64  46%  294 aa  G3P_ESCBL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    4::331     4e-64  45%  337 aa  G3PC_CRAPL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
   29::335     5e-64  48%  341 aa  G3PC_MAGLI RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    2::332     5e-64  41%  341 aa  E4PD_VIBCH RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    2::332     5e-64  41%  341 aa  E4PD_VIBC3 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     6e-64  40%  339 aa  E4PD_PHOLL RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    2::332     8e-64  40%  339 aa  E4PD_ALISL RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     2e-63  39%  338 aa  E4PD_YERPS RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     2e-63  39%  338 aa  E4PD_YERPN RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     2e-63  39%  338 aa  E4PD_YERPE RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     2e-63  39%  338 aa  E4PD_YERPA RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::328     2e-63  40%  341 aa  E4PD_EDWI9 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
   29::332     3e-63  46%  338 aa  G3PC_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    6::275     4e-63  48%  290 aa  G3P_LACDT RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    2::332     5e-63  40%  345 aa  E4PD_VIBHB RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    2::332     9e-63  39%  339 aa  E4PD_VIBFM RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    6::333     2e-62  39%  341 aa  E4PD_IDILO RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    3::330     2e-62  42%  332 aa  G3P1_DROME RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    2::332     2e-62  39%  345 aa  E4PD_VIBPA RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    3::330     3e-62  42%  332 aa  G3P2_DROPS RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    2::332     3e-62  40%  339 aa  E4PD_VIBF1 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::329     4e-62  37%  339 aa  E4PD_COLP3 RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    2::337     2e-61  40%  346 aa  E4PD_VIBVY RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    2::337     2e-61  40%  346 aa  E4PD_VIBVU RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
    1::329     7e-60  41%  332 aa  G3P_HELPY RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::328     3e-59  37%  371 aa  E4PD_PSYIN RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
   52::374     4e-59  42%  386 aa  G3PA_GUITH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    3::274     8e-59  44%  289 aa  G3P_AMAMU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::333     2e-58  40%  360 aa  E4PD_PHOPR RecName: Full=D-erythrose-4-phosphate dehydrogenase;    
   11::299     3e-58  46%  305 aa  G3PC_HORVU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    1::329     4e-58  40%  332 aa  G3P_HELPJ RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    2::234     1e-56  53%  234 aa  G3P_MELGA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    5::277     3e-54  44%  291 aa  G3P_BOLED RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    3::231     4e-52  46%  233 aa  G3PA_SINAL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::304     1e-51  41%  304 aa  G3P2_DROSU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase
    1::117     1e-23  52%  123 aa  G3P_CAVPO RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    4::160     2e-05  31%  343 aa  G3P_AERPE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    2::233     7e-05  26%  339 aa  G3P_METHJ RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    2::229     9e-05  26%  354 aa  G3P_HALMA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::32      1e-04  62%   34 aa  G3P2_JACOR RecName: Full=Glyceraldehyde-3-phosphate
   66::151     3e-04  31%  344 aa  DHAS_CORFL RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    2::155     6e-04  25%  344 aa  G3P_PYRAR RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    2::231     7e-04  28%  335 aa  G3P_HALSA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    2::231     7e-04  28%  335 aa  G3P_HALS3 RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase;  
    1::335

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTIRVGVNGFGRIGRNFWRAVQAAGGSDVEIVAVNDLTDKATLAHLLKYDTVLGTLPGEVEVGEDSITVG
G3P_STRCO       MTIRVGINGFGRIGRNYFRALLEQG-ADIEIVAVNDLGDTATTAHLLKYDTILGRLKAEVSHTEDTITVD
G3P_MYCTU       MTVRVGINGFGRIGRNFYRALQEQGTADVEVVAANDITDNSTLAHLLKFDSILGRLPCDVGLGDDTIVVG
G3P_MYCBO       MTVRVGINGFGRIGRNFYRALQEQGTADVEVVAANDITDNSTLAHLLKFDSILGRLPCDVGLGDDTIVVG
G3P_MYCAV       MTVRVGINGFGRIGRNFYRALQEQGTADIEVVAVNDITDNSTLAHLLKFDSILGRLPYDVSLGEDTIVVG
G3P_BACST       MAVKVGINGFGRIGRNVFRA--ALKNPDIEVVAVNDLTDANTLAHLLKYDSVHGRLDAEXXXXXXXXXXX
G3P1_BACSU      MAVKVGINGFGRIGRNVFRA--ALNNPEVEVVAVNDLTDANMLAHLLQYDSVHGKLDAEVSVDGNNLVVN
G3P_CORGL       MTIRVGINGFGRIGRNFFRAVLERS-DDLEVVAVNDLTDNKTLSTLLKFDSIMGRLGQEVEYDDDSITVG
G3P_AQUAE       MAIKVGINGFGRIGRSFFRA--SWGREEIEIVAINDLTDAKHLAHLLKYDSVHGIFKGSVEAKDDSIVVD
G3P_MYCLE       MTVRVGINGFGRIGRNFYRALQEHGIADVQVVAINDITDNSTLAYLLKFDSILGRLPHDVSLEEDTIVVG
G3P_STRAE       ----------------------AARSSELEIVAVNDLGDVPTMAHLLAYDSILGRFPEEVTAEPGAIRVG
G3P_BACME       ----------------------ALKNDNVEVVAINDLTDANMLAHLLKYDSVHGKLDAEVVVDGSNLVVN
G3P_THEMA       ---RVAINGFGRIGRLVYRIIYERKNPDIEVVAINDLTDTKTLAHLLKYDSVHKKFPGKVEYTENSLIVD
G3P1_BACCE      ----------------------ALNNSEVEVVAINDLTDAKTLAHLLKYDTVHGTLNAEVSANENSIVVN
G3P_THEAQ       --MKVGINGFGRIGRQVFRILHSRG---VEVALINDLTDNKTLAHLLKYDSIYHRFPGEVAYDDQYLYVD
G3P2_SYNY3      ---RVAINGFGRIGRNFLRCWLGRTDSQLEVVGINDTSDPRTNAHLLRYDSMLGKLDADISADENSITVN
G3P2_ANASP      --IRVAINGFGRIGRNFARCWLGRENTNIELVAVNDTSDPRTNAHLLKYDSMLGKLKNDITADDNSITVN
G3PA_CHOCR      MKVRVAINGFGRIGRNFIRCWAGRSDSNMEVVCINDTSGVKTASHLLKYDSILGTFDADVSAGEDTISVN
G3PA_GRAVE      MKVRVAINGFGRIGRNFIRCWAGRTDSNMDVVCINDTSGVKTASHLLKYDSILGTFDSDVVAGEDSITVD
G3P_STRAU       ---RIAINGFGRIGRNVLRALLERD-SDLDVVAVNDLTEPATLARLLAYDTTSGRLGRPVTVEGNVLVVD
G3P2_ANAVT      --IRVAINGFGRIGRNFARCWLGRENSNIELVAVNDTSDPRTNAHLLKYDSMLGKLKNDITADDNSITVN
G3PP_RALEH      MTIKVAINGYGRIGRNVLRAHYEGGKRDLEIVAINDLGNAATNAHLTQYDTVHGRFPGEVSVDGDAFRVN
G3PC_RALEH      MTIKVAINGYGRIGRNVLRAHYEGGKRDIEIVAINDLGNAATNAHLTQYDTVHGRFPGEVSVDGDAFRVN
G3P_BACCO       MAVKVGINGFGRIGRNVFRA--AVKNPDIEVVAVNDLTANADLAHLLKYDSVHGRLDAEVVVN-DGVSVN
G3PA_SPIOL      --LKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKTGDSAISVD
G3P2_BACSU      MKVKVAINGFGRIGRMVFR--KAMLDDQIQVVAINASYSAETLAHLIKYDTIHGRYDKEVVAGEDSLIVN
G3P2_RHOSH      MTIRVAINGFGRIGRNVLRAIVESGRTDIEVVAINDLGQVETNAHLLRFDSVHGRFPAKVTSGDDWIDVG
G3P1_ANAVT      --LKVGINGFGRIGRLVLRA--GINNPNIEFVGINDLVPPDNLAYLLKYDSTHGKLRSQVEAKDDGIVID
G3P1_ANASP      --LKVGINGFGRIGRLVLRA--GINNPNIEFVGINDLVPPDNLAYLLKYDSTHGRLRSQVETKDDGIVID
G3P_CHLMU       --MRIVINGFGRIGRLVLRQILKRN-APIEVVAINDLVSGDLLTYLFKYDSTHGSFASQATFSDGCLVVG
G3P_XANFL       MSVKVAINGFGRIGRNVLRAIIESGRTDIEVVAINDLGPVETNAHLFRFDSVHGRFPGEVKVAGDTIDVG
G3P_BORBU       --MKLAINGFGRIGRNVFKIAFERG---IDIVAINDLTDPKTLAHLLKYDSTFGVYNKKVESRDGAIVVD
G3PB_ARATH      --LKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHLLKYDSMLGTFKAEVKVDNETISVD
G3P_CHLPN       --MKVVINGFGRIGRLVLRQILKRNSS-VEVLAINDLVPGDALTYLFKFDSTHGRFPEDVRCEADHLIVG
G3P_PSEAE       MTIRLAINGFGRIGRNVLRALYTGHYRELQVVAINDLGDAAVNAHLFQYDSVHGHFPGEVEHDAESLRVM
G3P_CLOPA       ---KVAINGFXXXXXXXXXXXXEVPG--LEVVAINDLTDAKMLAHLFKYDSSQGRFNGEIEVKEGAFVVN
G3P_RALSO       MTIKIGINGFGRIGRMVFRAA-IANFKDIEVVAINDLLEPDYLAYMLKYDSVHGRFDGEVSVDGNTLVVN
G3P_CLOAB       ---KIAINGFXXXXXXXXXXXXEVPG--LEVVAINDLTDAKMLAHLFKYDSSQGRFNGEIEVKEGAFVVN
G3P_PARBA       MVVKVGINGFGRIGRIVFR--NAVEHDDVEIVAVNDFIETKYAAYMLKYDSTHGQFKGDIQSSSNNLTVN
G3P_ZYMMO       MAVKVAINGFGRIGRLAARAILSRPDSGLELVTINDLGSVEGNAFLFKRDSAHGTYPGTVTTEGNDMVID
G3P_STRP3       MVVKVGINGFGRIGRLAFRRIQNIEG--VEVTRINDLTDPNMLAHLLKYDTTQGRFDGTVEVKEGGFEVN
G3P_NEUCR       MVVKVGINGFGRIGRIVFR--NAIEHDDIHIVAVNDFIEPKYAAYMLRYDTTHGNFKGTIEVDGADLVVN
G3P_CHLTR       --MRIVINGFGRIGRLVLRQILKRN-SPIEVVAINDLVAGDLLTYLFKYDSTHGSFAPQATFSDGCLVMG
G3PB_SPIOL      --LKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHLLKYDSILGTFKADVKIDNETFSID
G3P_MONAN       ---KVGINGFGRIGRIVFRAIEHEG---VDIVAVNDFIEVHYAAYMLKYDSTHGRFNGTVEFDGNTLIVN
G3P1_ESCF3      MTIKVGINGFGRIGRIVFRAAQKR--SDIEIVAINDLLDADYMAYMLKYDSTHGRFDGTVEVKDGHLIVN
G3P_COCPO       MVVKVGINGFGRIGRIVFR--NAVEHPEVEIVAVNDFIETHYAAYMLKYDSTHGRFKGDVKFSENGLDVD
G3P1_SYNY3      --LKIGINGFGRIGRLVARIAMA--NPQVTLVGINDLVPASNLAYLFKYDSTHGSYGGTVVAKEEGIVID
G3P1_SHIFL      MTIKVGINGFGRIGRIVFRAAQKR--SDIEIVAINDLLDADYMAYMLKYDSTHGRFDGTVEVKDGHLIVN
G3P1_SALTY      MTIKVGINGFGRIGRIVFRAAQKR--SDIEIVAINDLLDAEYMAYMLKYDSTHGRFDGTVEVKDGHLIVN
G3P1_SALTI      MTIKVGINGFGRIGRIVFRAAQKR--SDIEIVAINDLLDAEYMAYMLKYDSTHGRFDGTVEVKDGHLIVN
G3P1_ECOLI      MTIKVGINGFGRIGRIVFRAAQKR--SDIEIVAINDLLDADYMAYMLKYDSTHGRFDGTVEVKDGHLIVN
G3P1_ECOL6      MTIKVGINGFGRIGRIVFRAAQKR--SDIEIVAINDLLDADYMAYMLKYDSTHGRFDGTVEVKDGHLIVN
G3P1_ECO57      MTIKVGINGFGRIGRIVFRAAQKR--SDIEIVAINDLLDADYMAYMLKYDSTHGRFDGTVEVKDGHLIVN
G3P_AJECA       MVVKVGINGFGRIGRIVFR--NAIEHGEVNVVAVNDFIETHYAAYMLKYDSTHGQFKGTIDVNSNGLTVN
G3P_CANAL       MAIKIGINGFGRIGRLVLRV--ALGRKDIEVVAVNDAPDYA--AYMFKYDSTHGRYKGEVTASGDDLVID
G3P_SORMA       MVVKVGINGFGRIGRIVFR--NAIEHDDIQIVAVNDFIEPKYAEYMLRYDSTHGNFKGTIAVEGSDLVVN
G3P2_STAEQ      MATNIAINGMGRIGRMVLRI--ALNNKNLNVKAINASYPPETIAHLLNYDTTHGVYDKKVEPIESGIKVN
G3P_COCIM       MVVKVGINGFGRIGRIVFR--NAVEHPEVEIVAVNDFIETHYAAYMLKYDSTHGRFKGDVKFSDNGLDVD
G3P2_STAES      MATNIAINGMGRIGRMVLRI--ALNNKNLNVKAINASYPPETIAHLLNYDTTHGVYDKKVEPIESGIKVN
G3PA_CHLRE      --IRVAINGFGRIGRNFLRCWHGRQNTLLDVVAINDSGGVKQASHLLKYDSTLGTFAADVKIVDDSISVD
G3P1_STAES      MAIKVAINGFGRIGRLAFRRIQDVEG--LEVVAVNDLTDDDMLAHLLKYDTMQGRFTGEVEVIEGGFRVN
G3P1_STAEQ      MAIKVAINGFGRIGRLAFRRIQDVEG--LEVVAVNDLTDDDMLAHLLKYDTMQGRFTGEVEVIEGGFRVN
G3P_PODAN       MTVKVGINGFGRIGRIVFR--NAVEHPDVEIVAVNDFIEPKYAEYMLKYDSTHGVFKGTIQVSGSDLIVN
G3P_HALVA       --VRVGLNGFGRIGRNVFRA--SLHSDDVEIVGINDVMDDSEIDYFAQYDSVMGELEGASXXXXXXXXXX
G3P_DEBHA       MAITIGINGFGRIGRLVLRI--ALQRSDIKVVAVNDFIAPEYAAYMFKYDSTHGRYKGEVTSKDDSLVID
G3P_PICPA       MAITVGINGFGRIGRLVLRV--ALSRADIKVVAINDFIAPEYAAYMFKYDSTHKAYKGEVSASGNKINID
G3P_ASPOR       -TPKVGINGFGRIGRIVFRNAIASG--DVDVVAVNDFIETHYAAYMLKYDSTHGRFQGTIETYDEGLIVN
G3P1_GIALA      MPIRLGINGFGRIGRMALRASLNIDG--VQVVAINDFTDCEYMEYMLKYDTVHGRFDGTIAHSEDSITVN
G3P_MYCPN       -TIRVAINGFGRIGRLVFRALLSQ--KNIEIVAVNDLTHPDTLAHLLKYDSAHGEFKKKVVAKDNTLMID
G3PA_MAIZE      --LKVAINGFGRIGRNFLRCWHGRGASPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKVGDNAISVD
G3P_EMENI       MAPKVGINGFGRIGRIVFRNAIEAG--TVDVVAVNDFIETHYAAYMLKYDSQHGQFKGTIETYDEGLIVN
G3P_CLAPU       MAVKVGINGFGRIGRIVFR--NAVEHPEIEVVAVNDFIDPEYAAYMLKYDSSHGVFKGEIKKDADGLIVN
G3PC_CHLRE      --IKIGINGFGRIGRLVMRATMLR--PDIEVVAINDFIDAEYMAYMFKYDSVHKTWPGHVNGSKDGFLVE
G3P_STRPY       MVVKVGINGFGRIGRLAFRRIQNIEG--VEVTRINDLTDPNMLAHLLKYDTTQGRFDGTVEVKEGGFEVN
G3P_STRP8       MVVKVGINGFGRIGRLAFRRIQNIEG--VEVTRINDLTDPNMLAHLLKYDTTQGRFDGTVEVKEGGFEVN
G3P_STRP6       MVVKVGINGFGRIGRLAFRRIQNIEG--VEVTRINDLTDPNMLAHLLKYDTTQGRFDGTVEVKEGGFEVN
G3P_STRP1       MVVKVGINGFGRIGRLAFRRIQNIEG--VEVTRINDLTDPNMLAHLLKYDTTQGRFDGTVEVKEGGFEVN
G3P_COLGL       --IKVGINGFGRIGRIVFR--NAIEHPEVEIVAVNDFIETKYAAYMLKYDSTHGIFNGEIKQEGNDLVIN
G3PG_CRIFA      --IKVGINGFGRIGRMVFQSMCEDNGTELDVVAVVDMTDAEYFAYQMKFDTVHGRPKYTVEVAKSSVVNG
G3P_COLLN       --IKVGINGFGRIGRIVFR--NAVEHPDVEIVAVNDFIETKYAAYMLKYDSTHGIFNGEIAQDGNDLVIN
G3PG_TRYCR      MPIKVGINGFGRIGRMVFQALCEDGGTEIDVVAVVDMTDAEYFAYQMRYDTVHGKFKYEVTTTDDTLVVN
G3P1_KLULA      --VKVAINGFGRIGRLVLRI--ALQRKALEVVAVNDFISVDYAAYMFKYDSTHGRYKGEVTTSGNDLVID
G3P_ASHGO       --VKVAINGLGKIGRLVMRI--ALSRANVEVVAINDTVDYA--AYMFKYDSTHGKYAGDVQYEGNTLVID
G3PA_ARATH      --LKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADVKPGETAISVD
G3P1_STAAW      MAVKVAINGFGRIGRLAFRRIQEVEG--LEVVAVNDLTDDDMLAHLLKYDTMQGRFTGEVEVVDGGFRVN
G3P1_STAAU      MAVKVAINGFGRIGRLAFRRIQEVEG--LEVVAVNDLTDDDMLAHLLKYDTMQGRFTGEVEVVDGGFRVN
G3P1_STAAS      MAVKVAINGFGRIGRLAFRRIQEVEG--LEVVAVNDLTDDDMLAHLLKYDTMQGRFTGEVEVVDGGFRVN
G3P1_STAAR      MAVKVAINGFGRIGRLAFRRIQEVEG--LEVVAVNDLTDDDMLAHLLKYDTMQGRFTGEVEVVDGGFRVN
G3P1_STAAN      MAVKVAINGFGRIGRLAFRRIQEVEG--LEVVAVNDLTDDDMLAHLLKYDTMQGRFTGEVEVVDGGFRVN
G3P1_STAAM      MAVKVAINGFGRIGRLAFRRIQEVEG--LEVVAVNDLTDDDMLAHLLKYDTMQGRFTGEVEVVDGGFRVN
G3P1_STAAC      MAVKVAINGFGRIGRLAFRRIQEVEG--LEVVAVNDLTDDDMLAHLLKYDTMQGRFTGEVEVVDGGFRVN
G3P_BACFR       --IKVGINGFGRIGRMVFRAAVKNFGNDIQIVGINDLLDAEYLAYMLKYDSVHGRFEGEVAVEDGALIVN
G3PC_TRYBB      MVIRVGINGFGRIGRVVFRAAQRR--NDIEIVGINDLLDADYMAYMLKYDSTHGRFEGAVEVQGGALVVN
G3P1_YEAST      --IRIAINGFGRIGRLVLRL--ALQRKDIEVVAVNDFISNDYAAYMVKYDSTHGRYKGTVSHDDKHIIID
G3PG_LEIME      --IKVGINGFGRIGRMVFQAICDQGGTEIDVVAVVDMSTNAEFAYQMKHDTVHGRPKYTVEAVKSSLVVN
G3P2_KLULA      --VRVAINGFGRIGRLVLRI--ALSRPNVEVVAINDFISVDYAAYMFKYDSTHGRFAGEVSHDENSLIID
G3P3_YEAST      --VRVAINGFGRIGRLVMRI--ALSRPNVEVVALNDFITNDYAAYMFKYDSTHGRYAGEVSHDDKHIIVD
G3P2_TRIKO      --IKVGINGFGRIGRIVFR--NAVEHPDIEVVAVNDPFIETTYAYMLKYDSSHGLFKGEVEVDGKDLVVN
G3P2_KLUMA      --VRIAINGFGRIGRLVLRI--ALSRKNIEVVAINDTVDYA--AYMFKYDSTHGRFDGEVSHDGKSLIID
G3P1_CAEEL      ----VGINGFGRIGRLVLRA--AVEKDTVQVVAVNDFITIDYMVYLFKYDSTHGQFKGTVTYDGDFLIVS
G3PB_PEA        --LKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGTFKAEVKINNETITVD
G3P1_TRIKO      MVPKVGINGFGRIGRVVLRNALETGA--VEVVALNDFIEPHYAEYMFKYDSTHGRFKGDIKVDGKDLVID
G3P1_KLUMA      --VSIAINGFGRIGRLVLRI--ALERKNIDVVAINDFISVDYAAYMFKYDSTHGKYKGEVSHDGSNLIIN
G3P_STREQ       MVVKVGINGFGRIGRLAFRRIQNVEG--VEVTRINDLTDPNMLAHLLKYDTTQGRFDGTVEVKEGGFEVN
G3P4_CAEEL      ----VGINGFGRIGRLVLRA--AVEKDTVQVVAVNDFITIDYMVYLFKYDSTHGQFKGTVTYDGDFLIVS
G3P3_KLUMA      --VRIAINGFGRIGRLVLRI--ALSRKNIEVVAINDTVDYA--AYMFKYDSTHGRFDGEVSHDGKALIID
G3P_CRIGR       --VKVGVNGFGRIGRLVTRAAFTSG--KVEVVAINDFIDLNYMVYMFQYDSTHGKFKGTVKAENGKLVIN
G3P2_YEAST      --VRVAINGFGRIGRLVMRI--ALQRKNVEVVALNDFISNDYSAYMFKYDSTHGRYAGEVSHDDKHIIVD
G3P2_CANGA      --VRIAINGFGRIGRLVLRV--ALSRSNIEVVAVNDTTDYA--AYMFKYDSTHGRYAGEVTXXXXXXXXX
G3P_ZYGRO       --VNVSVNGFGRIGRLVTRI--AISRKDINLVAINDSTDYA--AYMFKYDSTHGRFDGEVSHDKDHIILN
G3PB_TOBAC      --LKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADVKVDNETISVD
G3P_COTJA       --VKVGVNGFGRIGRLVTRAAVLSG--KVQVVAINDFIDLNYMVYMFKYDSTHGHFKGTVKAENGKLVIN
G3P3_CAEEL      ----VGINGFGRIGRLVLRA--AVEKDSVNVVAVNDFISIDYMVYLFQYDSTHGRFKGTVAHEGDYLLVA
G3P3_ANAVT      MKIRVGINGFGRMGRLALRA--AWGWPELEFVHINEIKGGAVAAHLLKFDSVHGRWTPEVEAEGERVLID
G3P2_CAEEL      ----VGINGFGRIGRLVLRA--AVEKDSVNVVAVNDFISIDYMVYLFQYDSTHGRFKGTVAHEGDYLLVA
G3P3_CAEBR      ----VGINGFGRIGRLVLRA--AVEKDSVNVVAVNDFISIDYMVYLFQYDSTHGRFKGTVAHEGDYLLVA
G3PG_TRYBB      MTIKVGINGFGRIGRMVFQALCDDGGNEIDVVAVVDMTDARYFAYQMKYDSVHGKFKHSVSTTDDTLVVN
G3P2_CAEBR      ----VGINGFGRIGRLVLRA--AVEKDSVNVVAVNDFISIDYMVYLFQYDSTHGRFKGTVKHEGDYLIVA
G3P2_AGABI      --VKVGINGFGRIGRIVLR--NALQFQDIEVVAVNDFIDLEYMAYMFKYDSVHGRFKGTVEVKNGSFVVD
G3P1_CANGA      --VRVAINGFGRIGRIVLRIAMKRDGIDV--VAINDFITNDYAAYMFKYDSTHGRYDGEVTHDDKDLIID
G3PA_PEA        --LKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKVGTDGISVD
G3P3_ANASP      MKVRVGINGFGRMGRLALRA--AWDWPELEFVHINEIKGGAVAAHLLKFDSVHGRWTPEVEAEGERVLID
G3P_CRYPA       MVVKVGINGFGRIGRIVFR--NAHEHSDVEIVAVNDFIEPHYAAYMLKYDSQHGNFKGDVTVEGSDLVVG
G3PT_MACFA      --LTVGINGFGRIGRLVLRACMEKG---VKVVAVNDFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVVD
G3P_MUSPF       --VKVGVNGFGRIGRLVTRAAFNSG--KVDIVAINDFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVIN
G3P_COLLI       --VKVGVNGFGRIGRLVTRA--AILSAKVQVVAINDFIDLNYMVYMFKYDSTHGHFRGTVKAENGKLVIN
G3P_CHICK       --VKVGVNGFGRIGRLVTRAAVLSG--KVQVVAINDFIDLNYMVYMFKYDSTHGHFKGTVKAENGKLVIN
G3P_SPECI       --VKVGVNGFGRIGRLVTRAAFNSG--KVDIVAINDFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVIN
G3P_PICCI       MAITVGINGFGRIGRLVLRI--ALSRKDIQIVAINDFIAPEYASYMFKYDSTHGRYSGEVSHEGENIVID
E4PD_PSEHT      MAIKLAINGFGRIGRNIVRALYESGSNEIKIVAINELADPEAIAHLLKYDTSHGRFFFPVKLGEDTISVA
G3P_RAT         --VKVGVNGFGRIGRLVTRA--AFSCDKVDIVAINDFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVIN
G3P_MOUSE       --VKVGVNGFGRIGRLVTRAAICSG--KVEIVAINDFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVIN
G3P_ASPNG       MAPKVGINGFGRIGRIVFR--NAINHGEVDVVAVNDFIETHYAAYMLKYDSTHGQFKGTIETYEEGLIVN
G3P_TRISI       --VKIGVNGFGRIGRLVTRAAFTC--DKVQIVAINDFIDLNYMVYMFKYDSTHGRFHGTVKAENGKLVIN
G3P_CANFA       --VKVGVNGFGRIGRLVTRAAFNSG--KVDIVAINDFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVIN
G3PT_DANRE      ----VGINGFGRIGRLVLRACLQKG---IKVTAINDFIDLQYMVYMFKYDSTHGRYKGEVHMEDGKLIVD
G3P_PICAN       MTANVGINGFGRIGRLVLRI--ALSRDDINVIAINDAPDYA--AYMFKYDSTHGKFKGTVTHEGKYLVIN
G3PA_TOBAC      --LKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKVGTDGISVD
G3P1_RHIRA      MVVQVGINGFGRIGRIVLRATES--NKDVQVVAINDFIPLDYMVYMLKYDTVHGRFDGSVEAKDGKLVVN
G3P_RABIT       --VKVGVNGFGRIGRLVTRAAFNSG--KVDVVAINDFIDLHYMVYMFQYDSTHGKFHGTVKAENGKLVIN
G3P_FELCA       --VKVGVNGFGRIGRLVTRAAFNSG--KVDIVAINDFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVIN
G3PC_PINSY      --IKIGINGFGRIGRLVARV--ALTRDDIELVGVNDFISTDYMSYMFKYDSVHGKWKHHEVNVKDSKTLG
G3PT_MOUSE      --LTVGINGFGRIGRLVLRVCMEKG---IRVVAVNDFIDPEYMVYMFKYDSTHGRYKGNVEHKNGQLVVD
G3P_PIG         --VKVGVNGFGRIGRLVTRAAFNSG--KVDIVAINDFIDLHYMVYMFQYDSTHGKFHGTVKAENGKLVIN
G3P_YARLI       MAIKVGINGFGRIGRIVLR--NALKNPEVEVVAVNDFIDTEYAAYMFKYDSTHGRFKGKVEAKDGGLIID
G3P_ONCVO       ---KIGINGFGRIGRLVLRA--AVEKDTVEVVAVNDFINIDYMVYMFKYDSTHGRFKGHVEGGKLIVTNG
G3P_BOVIN       --VKVGVNGFGRIGRLVTRAAFNSG--KVDIVAINDFIDLHYMVYMFQYDSTHGKFNGTVKAENGKLVIN
G3P_PONAB       --VKVGINGFGRIGRLVTRAAFNSG--KVDIVAINDFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVIN
G3P_HUMAN       --VKVGVNGFGRIGRLVTRAAFNSG--KVDIVAINDFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVIN
G3PT_HUMAN      --LTVGINGFGRIGRLVLRACMEKG---VKVVAVNDFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVVD
G3P_OMPOL       MVVKVGINGFGRIGRLVIRNALEAQG--VEVVAVNDFIPLDYMVYMFKFDSVHGRYKGTVEAKDGKLIIA
G3P_PHANO       MVVKVGINGFGRIGRIVFR--NAIEHNDVEIVAVNDFIEPHYAAYMLKYDSQHGQFKGDIKVEGNDLTIN
G3P_HOMAM       ---KIGINGFGRIGRLVLRAALSCGA---QVVAVNDFIALEYMVYMFKYDSTHGVFKGEVKMEDGALVVD
G3PC_GRAVE      MTVQVGINGFGRIGRLVLRA--AIEKDTMSVVAINDFIDLEYMAYMFKFDSTHGRYAGSVETKDGKLIVN
G3P_COCHE       MVVKVGINGFGRIGRIVFR--NAIEHNDVDIVAVNDFIEPHYAAYMLKYDSTHGQFKGDIKVDGNNLTVN
G3P_TRIAT       MSIKVGINGFGRIGRILLS--NALEKPELSVVAVNDFIEPTYAAYMLKYDSSHGLFKGDIEVDGQNLVVN
G3PT_BOVIN      ----VGINGFGRIGRLVLRACMEKG---VKVVAVNDFIDLEYMVYMFKYDSTHGRYKGNVEHKKGQLVVD
G3P3_ECOLI      --------------------------SNIDVVAINDLTSPKILAYLLKHDSNYGPFPWSVDFTEDSLIVD
G3P2_RHIRA      MVTQVGINGFGRIGRIVLRA--SLSNPEVQVVAINDFIPLEYMVYMFKYDSVHGRFQGTVEAKDGKLVVN
G3PC_LEIME      --VKVGINGFGRIGRVVFRAAQMR--PDIEIVGINDLLDAEYMAYSLKYDSTHGRFDGTVEVIKGALVVN
G3P3_ECO57      --------------------------SNIDVVAINDLTSPKILAYLLKHDSNYGPFPWSVDFTEDSLIVD
G3P_MYCGE       -TIKVAINGFGRIGRLVFRSLLSK--ANVEVVAINDLTQPEVLAHLLKYDSAHGELKRKITVKQNILQID
G3P_CURLU       MVVKVGINGFGRIGRIVFR--NAIEHNDVEIVAVNDFIEPHYAAYMLKYDSTHGQFKGDIKVDGNNLTVN
G3PC_RANAC      --IKIGINGFGRIGRLVARVALAR--DDVELVAVNDTTDYMT--YMFKYDTVHGQWKHELKVDEKTLLFG
G3P_PHARH       MAVKVGINGFGRIGRIVLRNAIIHG--DIDVVAINDFIDLEYMVYMFKYDSTHGVFKGSVEIKDGKLVIE
G3P_BUCBP       MTIKIGINGFGRIGRVLFRLAQLR--SNIEILAINDLINVQYIAYMLKYDSIHGNFNGKIVIKNETLFVN
G3P_LACLA       MVVKVGINGFGRIGRLALRRIQEVEG--VEVAHINDLTDPAMLAHLLKYDTTQGRFKGTVEVKEDGFDVN
G3P_PANVR       ---KIGINGFGRIGRLVLRAALEMGA---QVVAVNDFIALEYMVYMFKYDSTHGMFKGEVKAEDGALVVD
G3P_DANRE       --VKVGINGFGRIGRLVTRAAFLT--KKVEIVAINDFIDLDYMVYMFQYDSTHGKYKGEVKAEGGKLVID
G3P1_JACOR      --VKVGVNGFGRIGRLVTRAAFNSGKVDVDIVAINDFIDLNYMVYMFKYDSTHGKFKGTVKAENGKLVIN
G3P_XENLA       --VKVGINGFGCIGRLVTRAAFDSG--KVQVVAINDFIDLDYMVYMFKYDSTHGRFKGTVKAENGKLIIN
G3P_ONCMY       ----VGINGFGRIGRLVLRACLQKG---IKVVAINDFIDLQYMVYMFKYDSTHGRYKGEVSMEDGKLIVD
G3P_ERYGR       --IKVGINGFGRIGRIVFR--NAAQSCEVEVVAVNDFIEPEYAAYMLKYDSTHGQFNGDIQTVEDGLVVN
G3PT_RAT        --LTVGINGFGRIGRLVLRVCMEKG---VRVVAVNDFIDPEYMVYMFKYDSTHGRYKGTVEHKNGRLVVD
G3P2_STAAR      MSTNIAINGMGRIGRMVLRI--ALQNKNLNVVAINASYPPETIAHLINYDTTHGKYNLKVEPIENGLQVG
G3P_LYOSH       --VNVGINGFGRIGRIVFR--NALLNPKIQVVAINDFINLEYMVYMFKYDSVHGRFKGTVEAKDGKLWIQ
G3P_DICDI       MVVPIGINGFGRIGRLVLRA--SLENPECRVLAINEFMDVKYMVYMFKYDSTHGRFKGTVEDINGEFVVN
G3P_BUCAP       MTIKIGINGFGRIGRVLFRLAQER--ENIEVVAINDLLDPKYIAYMLKYDSTHGNFKKDIEVXXXXXXXX
G3P_BRUMA       ---KVGINGFGRIGRLVLRA--AVEKDTVDVVAVNDFINIDYMVYMFKYDSTHGRFKGSVEGGKLIVTNG
G3P1_SCHPO      ---KVGINGFGRIGRIVLRNALVA--KTIQVVAINDFIDLEYMAYMFKYDSTHGRFDGSVEIKDGKLVID
G3P2_STAAW      MSTNIAINGMGRIGRMVLRI--ALQNKNLNVVAINASYPPETIAHLINYDTTHGKYNLKVEPIENGLQVG
G3P2_STAAS      MSTNIAINGMGRIGRMVLRI--ALQNKNLNVVAINASYPPETIAHLINYDTTHGKYNLKVEPIENGLQVG
G3P2_STAAN      MSTNIAINGMGRIGRMVLRI--ALQNKNLNVVAINASYPPETIAHLINYDTTHGKYNLKVEPIENGLQVG
G3P2_STAAM      MSTNIAINGMGRIGRMVLRI--ALQNKNLNVVAINASYPPETIAHLINYDTTHGKYNLKVEPIENGLQVG
G3P2_STAAC      MSTNIAINGMGRIGRMVLRI--ALQNKNLNVVAINASYPPETIAHLINYDTTHGKYNLKVEPIENGLQVG
G3P1_GLORO      ---KVGINGFGRIGRLALRA--AVEKDTVQVVAINDFIELDYMVYMFNYDSTHGRFNGKISTSAGNLVVA
G3P_TREPA       --MRVAINGFGRIGRLVLQAMQKLLGKEFDVAAVVDLTDARYFAYQLKYDSVQGKMGSSLSAAEDILEVG
G3P_SCLSC       ---KVGINGFGRIGRIVFR--NAIEHDDIDIVAVNDFIETEYAAYMLKYDSTHGQFKGDIKVLSDGLEVN
G3PX_HORVU      --IKIGINGFGRIGRLVARV--ALQSDDVELVAVNDFITTEYMTYMFKYDTVHGHWKSDIKLKDDTLLFG
G3P_CRYNE       MVVKVGINGFGRIGRIVLR--NAIEHGDLEVVAVNDFIDLDYMVYMFKYDSTHGRFKGSVEVKDGKLYIN
G3P_KLEPN       ------INGFGRIGRIVFRAAQKR--SDIEIVAINDLLDAEYMAYMLKYDSTHGRFDGTVEVKDGHLVVN
G3P_BUCAI       MTIKVGINGFGRIGRVLFRLAQKR--SDIEIIAINDLLAPEYIAYMLKYDSTHGVFKKHITFXXXXXXXX
G3P2_SCHPO      ---KVGINGFGRIGRIVLRNAILTG--KIQVVAVNDFIDLDYMAYMFKYDSTHGRFEGSVETKGGKLVID
G3PD_MAIZE      --IKIGINGFGRIGRLVARV--ALQSEDVELVAVNDTTDYMT--YMFKYDTVHGQWKHSDIALKDSKTLG
G3PC_MAIZE      --IKIGINGFGRIGRLVARV--ALQSEDVELVAVNDTTDYMT--YMFKYDTVHGHWKHSDITLKDSKTLG
E4PD_SALG2      MTVRIAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRHEREQLFVG
E4PD_SALSV      MTVRIAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRHEREQLFVG
G3P_MESAU       -----------RIGRLVTRAAFTSG--KVDIVAINDFIDLNYMVYMFQYDSTHGKFKGTVKAENGKLVIN
E4PD_SALTY      MTVRIAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRHEREQLFVG
E4PD_SALTI      MTVRIAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRHEREQLFVG
E4PD_SALPC      MTVRIAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRHEREQLFVG
E4PD_SALPB      MTVRIAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRHEREQLFVG
E4PD_SALNS      MTVRIAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRHEREQLFVG
E4PD_SALHS      MTVRIAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRHEREQLFVG
E4PD_SALEP      MTVRIAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRHEREQLFVG
E4PD_SALDC      MTVRIAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRHEREQLFVG
E4PD_SALCH      MTVRIAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRHEREQLFVG
E4PD_SALA4      MTVRIAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRHEREQLFVG
G3P_LACDE       MTVKIGINGFGRIGRLAFRRIMDLGEEDIEVVAINDLTTPAMLAHLLKYDSTHGTFDHEVSATEDSLVVD
G3PC_PEA        --IKIGINGFGRIGRLVARV--ALKRDDVELVAVNDTTDYMT--YMFKYDSVHGQWKNDELTVKDSNTLG
G3P_PHYIN       --MNVAINGFGRIGRLVLRA--SAKNPLINIVAINDPFVSTTMEYMLEYDTVHGKFDGSLSHDETHIFVN
G3P_RHIMI       MTVKAGINGFGRIGRIVLRA--SLLNPEVEVVAINDFIDLEYMVYMFKYDSTHGRFKGTVEAKDGKLVVN
G3P_ATRNU       --VKIGINGFGRIGRLVARVILQS--DDCELVAINDTTDYMT--YMFKYDSVHGQWKHELKVDEKTLLFG
G3PA_SCEVA      -------NGFGRIGRNFLRCLETRQNSLLEVIAINDSGGVKQASHLLKYDSTLGKFDADVKIVDDGISVN
E4PD_SALPK      MTVRIAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRHEREQLFVG
E4PD_SALPA      MTVRIAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRHEREQLFVG
E4PD_SALAR      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRHEREQLFVG
E4PD_ALTMD      --VNIAINGFGRIGRNVLRALYESGNNEFNVVAINDIAKPEGIAHLLKYDTAHGRFRFDVALENNTLNVA
G3PE_MAIZE      --IKIGINGFGRIGRLVARV--ALQSDDVELVAVNDSTDYMT--YMFKYDTVHGQWKHHEVKVKDSKTLG
G3PC_SINAL      --IKIGINGFGRIGRLVARVILQR--NDVELVAVNDFITTEYMTYMFKYDSVHGQWKNELKVDEKTLLFG
E4PD_ESCF3      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLCVG
G3PC_GINBI      --IKIGINGFGRIGRLVARV--ALLRDDIELVAVNDSTDYMT--YMFKYDSVHGQWKKHEVKVKDSNTLG
E4PD_SHISS      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
E4PD_SHIFL      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
E4PD_SHIF8      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
E4PD_SHIBS      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
E4PD_SHIB3      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
E4PD_ECOUT      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
E4PD_ECOSM      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
E4PD_ECOSE      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
E4PD_ECOLU      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
E4PD_ECOLI      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
E4PD_ECOLC      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
E4PD_ECOL6      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
E4PD_ECOL5      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
E4PD_ECOHS      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
E4PD_ECODH      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
E4PD_ECOBW      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
E4PD_ECO8A      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
E4PD_ECO81      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
E4PD_ECO5E      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
E4PD_ECO57      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
E4PD_ECO55      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
E4PD_ECO27      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
E4PD_ECO24      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
E4PD_SHIDS      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
G3P_CRYCU       MATKVGINGFGRIGRIVLRNALEHG--DIDVVAINDFIDLDYMVYMFKYDSTHGRFKGKVETKDGKLVIE
G3PC_TAXBA      --IKIGINGFGRIGRLVARV--ALQRDDIELVAVNDFISTESLTSLFKYDSVHGQWKKEVKVDEKTLLFG
G3P_LENED       MAVKVGINGFGRIGRIVLR--NALLNPEVNVVAVNDFIALEYMVYMFKYDSVHGRFKGTVETKGGKLIVD
G3P_HAEIN       ---------------------------DIEVVGINDLIDVEYMAYMLKYDSTHGRFDGTVEVKDGNLVVN
G3PC_ORYSJ      --IKIGINGFGRIGRLVARV--ALQSEDVELVAVNDTTDYMT--YMFKYDTVHGQWKSDIKIKDSTLLLG
G3PC_ORYSI      --IKIGINGFGRIGRLVARV--ALQSEDVELVAVNDTTDYMT--YMFKYDTVHGQWKSDIKIKDSTLLLG
E4PD_PROMH      MTIRVAINGFGRIGRNVLRALYESGKAEISVVAINELADATGIAHLLKYDSSHGRFAWDIRVNNDLLQVG
G3PC_PETCR      MKMKIGINGFGRIGRLVARV--ALMSDDIELVAVNDFITTEYMTYMFKYDSVHGQWKKDELKVKDSKTLG
G3P_ECHMU       MKPQVGINGFGRIGRLVLRXXXXXXXXXXXXXX-DPFIDLEYMVYMFKYDSAHGRYKGDVKVDGGKLVID
G3P3_RHIRA      -TINTGINGF----RSHWPYCLACSNPKVKVVAINDFIDLEYMVYMFKYDSTHGRFKGTVEHKDGKLVVN
E4PD_ECOK1      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
E4PD_ECO7I      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
E4PD_ECO45      MTVRVAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVG
G3P_SCHCO       MAVKVGINGFGRIGRIVLRNALQLG--NIEVVAINDFIALDYMVYMFKYDTVHGRYKGTVEVKDGKLVVD
G3PC_DIACA      --IKIGINGFGRIGRLVARVILQR--EDCELVAVNDFITTEYMTYMFKYDSVHGQWKHDIKVDEKTLLFG
E4PD_TOLAT      MTIRIAINGFGRIGRNVLRALYESGRAEIKVVAINEPADAAGMAHLLKYDSTHGRFDWDVRQERDVLYVG
G3PC_MESCR      --VKVGINGFGRIGRLVARVILQR--DDCELVAVNDSTDYMT--YMFKYDSVHGQCKSEIKLDEKTLLFG
E4PD_KLEP7      MTIRIAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGIAHLLKYDTSHGRFAWDVRQEREQLFVG
G3P_PHACH       MPVKAGINGFGRIGRIVLRNALLHG--DIDVVAVNDFIDLEYMVYMFKYDSVHGRFKGSVEAKDGKLYVE
G3P_GLOMM       ---KIGINGFGRIGRLVLRAALDKGA---EVVAVNDFIDVNYMVYLFKYDSTHGRFKGTVAADGGFLVVN
E4PD_KLEP3      MTIRIAINGFGRIGRNVVRALYESGRAEITVVAINELADAAGIAHLLKYDTSHGRFAWDVRQEREQLFVG
E4PD_CITK8      MTVRVAINGFGRIGRNVVRALYESGRAEISVVAINELADAAGMAHLLKYDTSHGRFAWDVRQEREQLIVG
E4PD_SHESR      --IRVAINGYGRIGRSILRALYESGKQQIQIVAINELAKPEAIVHLTQYDTTHGRFQPRVKLVDDQMLIG
E4PD_SHESM      --IRVAINGYGRIGRSILRALYESGKQQIQIVAINELAKPEAIVHLTQYDTTHGRFQPRVKLVDDQMLIG
G3P_PLESA       --VNVGINGFGRIGRIVFRNALEVGG--VDVVAINDFIDLDYMVYMFKYDSVHGRFKGSIEAKDGKLIVE
G3PC_ANTMA      --IKIGINGFGRIGRLVARV--ALQRDDVELVAVNDSTDYMT--YMFKYDSVHGAWKHELKVDEKTLLFG
E4PD_SHESA      --IRVAINGYGRIGRSILRALYESGKQQIQIVAINELAKPEAIIHLTQYDTTHGRFQPRVKLVDDQMLIG
E4PD_SHEB2      --IRVAINGYGRIGRSILRALYESGKQQMQIVAINELAKPEAIIHLTQYDTTHGRFAHKVKLVDDHMLIG
E4PD_SHEON      --IRVAINGYGRIGRSILRALYESGKQQIQIVAINELAKPEAIIHLTQYDTTHGRFQPRVKLVDGQMQIG
E4PD_ENTS8      MTLRVAINGFGRIGRNVVRALYESGRAEISVVAINELADAAGMAHLLKYDTSHGRFAWDVRQEGEQLWIG
G3PC_PETHY      --IKIGINGFGRIGRLVARV--ALQRDDVELVAVNDFISVEYMTYMFKYDSVHGQWKHHELKAKDDKTLG
E4PD_AERHH      --IKIAINGYGRIGRNVLRALYESGDKNIKIVAINELAAPEAMVHLTRFDTSHGRFHHPVQLAGNSMLVG
G3PC_PHYPA      --IKVGINGFGRIGRLVARV--ALERDDIELVAINDFITPEYMTYMFKYDSTHGQWK-KTEVSEGHLTFG
G3PC_CHOCR      ---KVGINGFGRIGRLVLRAAIEKG--TCQVVAINDFIDLDYMAYMLKYDSTHGRYAGDVSIKDGKLQVD
E4PD_ENT38      MTVRVAINGFGRIGRNVIRALYESGRAEITVVAINELADAVGMAHLLKYDTSHGRFAWDVRQEREQLFVG
E4PD_AERS4      --IKIAINGYGRIGRNVLRALYESGDKNIKIVAINELAAPEAMVHLTRFDTSHGRFRYPVQLAGHSMLVG
G3P_SERMA       --------------------------SDIEIVAINDLLDAEYMAYMLKYDSTHGRFNGTVEVKDGHLVVN
E4PD_ERWCT      MTIRIAINGFGRIGRSVLRALYESGRAEITVVAINELASAEGMAHLLKYDSSHGRFSWDVRQECDQLYVG
G3P_SCHMA       ---KVGINGFGRIGRLVLRA--AFLKNTVDVVSVNDFIDLEYMVYMIKRDSTHGTFPGEVSTENGKLKVN
G3P1_ESCFE      --------------------------SDIEIVAINDLLDADYMAYMLKYDSTHGRFDGTVEVKDGHLIVN
E4PD_SHESW      --IRVAINGYGRIGRSILRALYESGKQQIQIVAINELAKPEAIIHLTQYDTTHGRFQHKVKLVDNHMLIG
E4PD_SHEPW      --IRVAINGYGRIGRSILRAVYESAKRDIQIVAINELAKPEAMLHLTQYDTTHGRFHTQVKLDEQHMIIG
E4PD_SHEPC      --IRVAINGYGRIGRSILRALYESGKQQIQIVAINELAKPEAIIHLTQYDTTHGRFQHKVKLVDNHMLIG
G3P_ESCHE       -----------------FRAAQTR--SDIEIVAINDLLDAEYMAYMLKYDSTHGRFDGTVEVKDGHLVVN
E4PD_PSEA6      --IRVAINGFGRVGRNVLRALYETGNKQIQIVAINELAEPEGVAHLLKYDTAHGRFRFPVVLDNQQLVVA
G3P_USTMA       ------------------------------VVAINDFIDLEYMVYMLKYDSTHGVFNGDISTKDGKLIVN
G3PC_SCEVA      -------NGFGRIGSLVLRAT--LDRKDVKVVAINDFIEGEYMAYMFKYDSVHGRYEGDVQGDKHGITIN
G3P2_DROME      ---KIGINGFGRIGRLVLRAAIDKGAN---VVAVNDFIDVNYMVYLFKFDSTHGRFKGTVAAEGGFLVVN
E4PD_PECCP      MTIRIAINGFGRIGRSVLRALYESGRAEITVVAINELASAEGMAHLLKYDSSHGRFSWDVRQECDQLYVG
G3P1_ESCVU      --------------------------SDIEIVAINDLLDAEYMAYMLKYDSTHGRFDGTVEVKDGHLVVN
E4PD_SHEFN      --IRVAINGYGRIGRSILRALYESGKQQIQIVAINELAKPEAICHLTQYDTTHGRFKHTVKLNGDQLLIG
G3P1_AGABI      --VNVGINGFGRIGRLVLR--NALQMQILTVVAVNDFLDVEYMAYLFKYDSVHGRYQGKVETKDGKLIID
E4PD_SHEDO      --IRVAINGYGRIGRSILRALYESGKQQIQIVAINELAKPEAIRHLTQYDTTHGRFGQTVELQEGKLHIG
E4PD_ERWT9      MTVRIAINGFGRIGRNVLRALYETGRAEISAVAINELADAAGMAHLLKYDTSHGRFAWDVRQERDLLTVG
G3P_CITFR       --------------------------SDIEIVAINDLLDADYMAYMLKYDSTHGRFNGTVEVKDGHLIVN
E4PD_SHEHH      --IRVAINGYGRIGRSILRALYESAKRDIQIVAINELAKPEAMLHLTQYDTTHGRFHTQVKLDNQHMIIG
G3P_BORHE       -------------------------------------TDPKTLAHLLKYDSTFGVYNKKVESRDGAIVVD
E4PD_SHEPA      --IRVAINGYGRIGRSILRALYESAKRDIQIVAINELAKPEAMLHLTQYDTTHGRFHTQVKLDNQHMIIG
G3PC_TOBAC      ----------GRIGRLVARV--ALQRDDVELVAVNDSTDYMT--YMFKYDSVHGQWKHELKVDEKTLLFG
G3P_SHEEP       ------------IGRLVTRAAFNTG--KVDIVAINDFIDLHYMVYMFQYDSTHGKFHGTVKAENGKLVIN
G3P_ENTAE       --------------------------SDIEIVGINDLLDAEYMAYMLKYDSTHGRFDGTVEVKDGHLVVN
G3P_DROHY       ---KIGINGFGRIGRLVLRAAVDKGAS---VVAVNDFIDVNYMVYLFKFDSTHGRFKGTVSAEGGFLVVN
G3P_SEROD       --------------------------SDIEIVAINDLLDAEYMAYMLKYDSTHGRFNGSVEVKDGHLVVN
E4PD_SHEAM      --IRVAINGYGRIGRSVLRALYESGKGQMQLVAINELAKPEAIVHLTNYDTTHGRFHTRASLDEGMMHLG
E4PD_YERE8      MTIRIAINGFGRIGRSVLRALYESGRAEISVVAINELANAEGMAHLLKYDSSHGRFAWDVRQECDKLYVG
G3P_MASBA       ------------------------------VVLINDITTDA-MAYIFKYDTVHGRFPGTVKEGKLEITLN
E4PD_SHELP      --IKVAINGYGRIGRSILRALYESGKRDIQIVAINELANPEAMLHLTQYDTTHGRFQSPASLDANVMTIG
G3P_ESCBL       --------------------------SDIEIVAINDLLDAEYMAYMLKYDSTHGRFNGTVEVKDGHLIVN
G3PC_CRAPL      --VKIGINGFGRIGRLVARV--ALVRDDVELVAVNDFITVDYMAYMFKYDTVHGQYKHELKVDEKTLLFG
G3PC_MAGLI      ---------------------------DVELVAVNDTTDYMT--YMFKYDSVHGQWKHHELKVKDSKTLG
E4PD_VIBCH      --LRVAINGFGRIGRNVLRAVYESGKRDIQVVAVNELAKPDAMAHLLQYDTSHGRFGKKISHDQQHIYVH
E4PD_VIBC3      --LRVAINGFGRIGRNVLRAVYESGKRDIQVVAVNELAKPDAMAHLLQYDTSHGRFGKKISHDQQHIYVH
E4PD_PHOLL      MTIKVAINGFGRIGRSILRALYESGRAEIAVIAVNELADAEGIAHLLKYDSSHGRFAWDVRLNNDVLQVG
E4PD_ALISL      --LRVAINGFGRIGRSVLRALYESGKRDIEIVAVNELSQPEGMAHLLQYDSTHGRFLHKVTHDQEYLYIS
E4PD_YERPS      MAIRIAINGFGRIGRSVLRALYESGRAEISVVAINELASAEGMAHLLKYDSSHGRFAWDVRQECDSLYVG
E4PD_YERPN      MAIRIAINGFGRIGRSVLRALYESGRAEISVVAINELASAEGMAHLLKYDSSHGRFAWDVRQECDSLYVG
E4PD_YERPE      MAIRIAINGFGRIGRSVLRALYESGRAEISVVAINELASAEGMAHLLKYDSSHGRFAWDVRQECDSLYVG
E4PD_YERPA      MAIRIAINGFGRIGRSVLRALYESGRAEISVVAINELASAEGMAHLLKYDSSHGRFAWDVRQECDSLYVG
E4PD_EDWI9      MTIRIAINGFGRIGRNVLRALYESGRTQMRVVAINELAAAEGMAHLLQYDTCHGRFAWSVRQQDDWLWIG
G3PC_ARATH      ---------------------------DVELVAVNDFITTEYMTYMFKYDSVHGQWKNELKIDEKTLLFG
G3P_LACDT       ----------------------------VKVLAVSDFIDLQYMVYMFKYDSVHGRFKGTVEIKDGKLVID
E4PD_VIBHB      --LKVAINGFGRIGRNVLRAVYESGKQQIKVVAVNELAQPEAMAHLLQYDTSHGRFGKKISHDQEHLYVH
E4PD_VIBFM      --LRVAINGFGRIGRSVLRALYESDKRDIEVVAVNELSQPEAMAHLFQYDSTHGRFQHKVTHDQEYLYIS
E4PD_IDILO      ---RIAINGFGRIGRSFLRALYENGYRDVQVVLINEPAASEAIAHLLKYDSSHGRFGEKVTQSGDALTVA
G3P1_DROME      ---KIGINGFGRIGRLVLRAAIDKGAS---VVAVNDFIDVNYMVYLFKFDSTHGRFKGTVAAEGGFLVVN
E4PD_VIBPA      --LKVAINGFGRIGRNVLRAVYESGKQQIKVVAVNELAQPEAMAHLLQYDTSHGRFGKKISHDQEHLNVH
G3P2_DROPS      ---KIGINGFGRIGRLVLRAAIDKGAS---VVAVNDFIDVNYMVYLFKFDSTHGRFKGTVAAEGGFLVVN
E4PD_VIBF1      --LRVAINGFGRIGRSVLRALYESDKRDIEVVAVNELSQPEAMAHLFQYDSTHGRFQHKVTHDQDVPDSS
E4PD_COLP3      MTIRIAINGFGRIGRSVVRALYESGKTDLTLVSINELAPASGIAHLLKYDSTHGRFPFSVSEKENQLIIN
E4PD_VIBVY      --LKVAINGFGRIGRNVLRAVYESGKQQIKVVAVNELAQPEAMAHLLQYDTSHGRFGKRISHDQEHLYVH
E4PD_VIBVU      --LKVAINGFGRIGRNVLRAVYESGKQQIKVVAVNELAQPEAMAHLLQYDTSHGRFGKRISHDQEHLYVH
G3P_HELPY       --MKIFINGFGRIGRCVLRAILERNDTNLEVIGINDPANWEILAYLLEHDSVHGLLPKEVRYSNYKLIIG
E4PD_PSYIN      MSIRIAINGYGRIGRSVVRALYENNRQDMKVVVINELAEPSAIAHLTQYDSTHGRFPFPVNLQNNLLKIK
G3PA_GUITH      -----GINGFGRIGRLVARIM--IKDPETKLLQVN--AGSATMAYQFKYDSIHGRYQXXXXXXXXXXXXX
G3P_AMAMU       --------------------------TDLDVVAINDFIDLAYMVYMFKYDSVHGRFSGSVETKDGKLWIN
E4PD_PHOPR      MTLKVAINGFGRIGRSVLRALYESGKHHINVVAVNELAEPEAMAHLLQYDSSHGRFFKPVSHDQEHLFIA
G3PC_HORVU      ------------------------------------------MTYMFKYDTVHGQWKHHEVKVKDSKTLG
G3P_HELPJ       --MKIFINGFGRIGRCVLRAILERNDTNLEVIGINDPANWEILAYLLEHDSTHGLLNKEVRYSNGKLIIG
G3P_MELGA       ----------------------------------------------------------------------
G3P_BOLED       ---------------------------EINITAVNDFIDLDYMVYMFKYDSVHGRFEGEVSTKDGKLVIN
G3PA_SINAL      ----------------------------------------------------------------------
G3P2_DROSU      -----------RIGRLVLRAAIDKGAS---VVAVNDFIDVNYMVYLFKFDSTHGRFKGTVVAEGGFLVVN
G3P_CAVPO       ----------------------------------------------------------------------
G3P_AERPE       --VKVGVNGFGTIGRRVALAITLQ--KDMKLVGVVKRTDYAALYAASRGIPIYTPTAKEAEEFEKGIKVG
G3P_METHJ       --IKVAINGYGTIGKRVADAVSAQ--KDMEIIGVSKTSAEALIAVQRGYPIYIADMSKKDAFAKAGIPVA
G3P_HALMA       --LHVGINGFGTIGKRVADAVRVQPDMTVAGVAKRSPNFEATIADDRGYD--LYAADGREPFDEADLGTA
G3P2_JACOR      --VKVGVNGFGRIGRLVTRA--AFNSGKVDIVAIND----------------------------------
DHAS_CORFL      ----------------------------------------------------------------------
G3P_PYRAR       --IRVGIVGFGTIGKRIADAVAAQG--DMHVSGVLKVTPDYEVLVAAAKGFKVYTLPDRVEKFKKAGIEP
G3P_HALSA       --IRVGINGYGTIGKRVADAVAAQPDMTVAGVAKTSPNFEATQARKRGFD-----LYTAVEDRADQFPAA
G3P_HALS3       --IRVGINGYGTIGKRVADAVAAQPDMTVAGVAKTSPNFEATQARKRGFD-----LYTAVEDRADQFPAA


                         .         .         *         .         .         .         .:140
query           GTTMKALAQRDPAQLPWGDLGVDIVVESTGFFTKAEDAKKHLDAGAKKVIISAPAKGEDLTVVMGVNDDK
G3P_STRCO       GKTIKVLSERNPADIPWGELGVDIVIESTGIFTKKADAEKHIAGGAKKVLISAPAKDEDITIVMGVNQDK
G3P_MYCTU       RAKIKALAVREPAALPWGDLGVDVVVESTGLFTNAAKAKGHLDAGAKKVIISAPATDEDITIVLGVNDDK
G3P_MYCBO       RAKIKALAVREPAALPWGDLGVDVVVESTGLFTNAAKAKGHLDAGAKKVIISAPATDEDITIVLGVNDDK
G3P_MYCAV       PAKIKALEVREPAALPWGDLGVDVVVESTGLFTNAAKAKGHLDAGAKKVIISAPATDEDITVVLGVNDDK
G3P_BACST       XKEIIVKAERDPENLAWGEIGVDIVVESTGRFTKREDAAKHLEAGAKKVIISAPAKNEDITIVMGVNQDK
G3P1_BACSU      GKTIEVSAERDPAKLSWGKQGVEIVVESTGFFTKRADAAKHLEAGAKKVIISAPANEEDITIVMGVNEDK
G3P_CORGL       GKRIAVYAERDPKNLDWAAHNVDIVIESTGFFTDANAAKAHIEAGAKKVIISAPASNEDATFVYGVNHES
G3P_AQUAE       GKEIKVFAQKDPSQIPWGDLGVDVVIEATGVFRDRENASKHLQGGAKKVIITAPAKNPDITVVLGVNEEK
G3P_MYCLE       SEKIKALAVREPAALPWHAFGVDVVVESTGLFTNAAKAKGHLEAGAKKVIVSAPATDPDITIVFGVNDDK
G3P_STRAE       DRTIKVLAERDPGALPWGDLGVDIVIESTGIFTDAAKARSHVDGGAKKVIIAAPASGEDFTVVLGVNDGD
G3P_BACME       GKTIEISAERDPAQLSWGKQGVEIVVESTGFFTKRADAAKHLEAGAKKVIISAPASDEDITIVMGVNEDK
G3P_THEMA       GKEIKVFAEPDPSKLPWKDLGVDFVIESTGVFRNREKAELHLQAGAKKVIITAPAKGEDITVVIGCNEDQ
G3P1_BACCE      GKEIKVIAERDPAQLPWSDYGVEVVVESTGRFTKKSDAEKHLGGSVKKVIISAPASDEDITVVMGVNHEQ
G3P_THEAQ       GKAIRATAVKDPKEIPWAEAGVGVVIESTGVFTDADKAKAHLEGGAKKVIITAPAKGEDITIVMGVNHEA
G3P2_SYNY3      GKTIKCVSDRNPLNLPWAEWNVDLVIEATGVFVTHEGATKHVQAGAKKVLITAPGKGPNITYVVGVNAHE
G3P2_ANASP      GKTIKCVSDRNPENLPWKEWEIDLIIEATGVFVSKEGATKHINAGAKKVLITAPGKNEDGTFVMGVNHHD
G3PA_CHOCR      GKTIKIVSNRNPLQLPWKEMNIDIVVEATGVFVDAPGAGKHIEAGAKKVLITAPGKGDGITFVVGVNEKD
G3PA_GRAVE      GKTIKVVSNRNPLELPWKEMEIDIVVEATGVFVDAVGAGKHIQAGAKKVLITAPGKGEGVTFVVGVNDHL
G3P_STRAU       GRRITVTAEREPANLPWAELGVDIVLEATGRFTSAKAARAHLDAGAKKVLVSAPADGADITLAFGVNTDA
G3P2_ANAVT      GKTIKCVSDRNPENLPWKEWEIDLIIESTGVFTSKEGALKHVNAGAKKVLITAPGKNEDGTFVIGXXXXX
G3PP_RALEH      GDRIRVLAQRNPAELPWGELGVDVVMECTGLFTSKEKASAHLKGGAKKVIISAPGKDVDATIVYGVNHGV
G3PC_RALEH      GDRIRVLAQRNPAELPWGELGVDVVMECTGLFTSKEKASAHLRGGAKKVIISAPGKDVDATIVYGVNHGV
G3P_BACCO       GKEIIVKAERNPENLAWGEIGVDIVVESTGRFTKREDAAKHLEAGAKKVIISAPAKVENITVVMGVNQDK
G3PA_SPIOL      GKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEG
G3P2_BACSU      GKKVLLLNSRDPKQLPWREYDIDIVVEATGKFNAKDKAMGHIEAGAKKVILTAPGKNEDVTIVMGVNEDQ
G3P2_RHOSH      RGPIKVTAIRNPAELPWA--GVDMAMECTGIFTTKEKAAAHLQNGAKRVLVSAPCDGADRTIVYGVNHAT
G3P1_ANAVT      GHFIPCVSVRNPAELPWGKLGADYVVESTGLFTDSEGASKHLQAGAKRVIISAPTKDPDRTLLVGVNHDL
G3P1_ANASP      GHFIPCVSVRNPAELPWGKLGADYVVESTGLFTDSEGASKHLQAGARRVIISAPTKDPDRTLLVGVNHDL
G3P_CHLMU       ERKIRFLAEKDVQKLPWKDLDVDVVVESTGLFVNKDDAAKHLDSGAKRVLITAPAKGDVPTFVMGVNHQK
G3P_XANFL       RGPIKVTAVRNPAELPHKELGVDIALECTGIFTSRDKXXXXXXXXXKRVLVSAPADGADLTVVYGVNHEK
G3P_BORBU       GREIKIIAERDPKNLPWAKLGIDVVIESTGVFSSASDKGGYLDAGAKKVILTVPAKDEIKTIVLGVNDHD
G3PB_ARATH      GKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGASKVIITAPAKGADITYVMGVNEQD
G3P_CHLPN       KRKIQFLSERNVQNLPWKDLGVDLVIECTGLFTKKEDAEKHIQAGAKRVLISAPGKGDIPTFVMGVNHKT
G3P_PSEAE       GDRIAVSAIRNPAELPWKSLGVDIVLECTGLFTSRDKAAAHLQAGAGKVLISAPGKDVEATVVYGVNHEV
G3P_CLOPA       GKEVKVFAEADPEKLPWGELGIDVVLECTGFFTKKEKAEAHVRAGAKKVVISAPAGNDLKTIVFNVNNED
G3P_RALSO       GKKIRLTAVKDPAELKWGEVGADVVVESTGIFLTKEGAQKHIDAGAKKVIMSAPSKDDTPMFVYGVNHGT
G3P_CLOAB       GKEVKVFAEADPEKLPWGDLGIDVVLECTGFFTKKEKAEAHVRAGAKKVVISAPAGNDLKTIVFNVNNED
G3P_PARBA       NKTIHFYQERDPANIPWGKHGVDYVVESTGVFTTTEKAKAHLSGGAKKVIISAPSADAPM-FVMGVNEKS
G3P_ZYMMO       GKKIVVTAERDPANLPHKKLGVDIVMECTGIFTNTEKASAHLTAGAKKVLISAPAKGDDRTVVYGVNH-K
G3P_STRP3       GNFIKVSAERDPENIDWATDGVEIVLEATGFFAKKEAAEKHLHTGAKKVVITAPGGNDVKTVVFNTNHDI
G3P_NEUCR       GKKVKFYTERDPAAIPWSETGADYIVESTGVFTTTEKASAHLKGGAKKVIISAPSADAPM-YVMGVNNET
G3P_CHLTR       ERKVHFLAEKDVQKLPWKDLDVDVVVESTGLFVNRDDVAKHLDSGAKRVLITAPAKGDVPTFVMGVNHQQ
G3PB_SPIOL      GKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGSDITYVVGVNEKD
G3P_MONAN       GKKIKFYAERDPAQIPWSETGAEYVVESTGVFTKQEKASLHLKGGAKKVIISAPSSDSPM-FVMGVNNDQ
G3P1_ESCF3      GKKIRVTAERDPANLKWDEVGVDVVAEATGIFLTDETARKHITAGAKKVVLTGPSKDNTPMFVKGANFDK
G3P_COCPO       GKHVRFYQERDPANIPWAETGADYVIESTGVFTTTEKASAHLKGGAKKVIISAPSADAPM-FVMGVNNET
G3P1_SYNY3      DQFIPCFSQRNPAQLPWGDLGADYVVESTGLFTTYATAENHLKAGAKRVIISAPSKDPEKTFVVGVNHLN
G3P1_SHIFL      GKKIRVTAERDPANLKWDEVGVDVVAEATGLFLTDETARKHITAGAKKVVMTGPSKDNTPMFVKGANFDK
G3P1_SALTY      GKKIRVTAERDPANLKWDEVGVDVVAEATGIFLTDETARKHITAGAKKVVLTGPSKDNTPMFVKGANFDK
G3P1_SALTI      GKKIRVTAERDPANLKWDEVGVDVVAEATGIFLTDETARKHITAGAKKVVLTGPSKDNTPMFVKGANFDK
G3P1_ECOLI      GKKIRVTAERDPANLKWDEVGVDVVAEATGLFLTDETARKHITAGAKKVVMTGPSKDNTPMFVKGANFDK
G3P1_ECOL6      GKKIRVTAERDPANLKWDEVGVDVVAEATGLFLTDETARKHITAGAKKVVMTGPSKDNTPMFVKGANFDK
G3P1_ECO57      GKKIRVTAERDPANLKWDEVGVDVVAEATGLFLTDETARKHITAGAKKVVMTGPSKDNTPMFVKGANFDK
G3P_AJECA       GKAVTFYQERDPASIPWGKHGVEYVVESTGVFTTTEKASAHLKGGAKKVIISAPSADAPM-FVMGVNEKT
G3P_CANAL       GHKIKVFQERDPANIPWGKSGVDYVIESTGVFTKVEGAQKHIDAGAKKVIITAPSADAPMFVV-GVNEDK
G3P_SORMA       GKKVKFYTERDPSAIPWSETGADYIVESTGVFTTTEKASAHLKGGAKKVIISAPSADAPM-YVMGVNNES
G3P2_STAEQ      GHEIKLLSDRNPENLPWNEMDIDVVIEATGKFNHGDKAVAHINAGAKKVLLTGPSKGGDVQIVKGVNDNQ
G3P_COCIM       GKHVRFYQERDPANIPWAETGADYVIESTGVFTTTEKASAHLKGGAKKVIISAPSADAPM-FVMGVNNET
G3P2_STAES      GHEIKLLSDRNPENLPWNEMDIDVVIEATGKFNHGDKAVAHINAGAKKVLLTGPSKGGDVQIVKGVNDNQ
G3PA_CHLRE      GKQIKIVSSRDPLQLPWKEMNIDLVIEGTGVFIDKVGAGKHIQAGASKVLITAPAKDKDITFVVGVNEGD
G3P1_STAES      GKEIKSFDEPDAGKLPWGDLDIDVVLECTGFYTDKEKAQAHIDAGAKKVLISAPAKGDVKTIVFNTNHDT
G3P1_STAEQ      GKEIKSFDEPDAGKLPWGDLDIDVVLECTGFYTDKEKAQAHIDAGAKKVLISAPAKGDVKTIVFNTNHDT
G3P_PODAN       GKTVKFYTERDPSAIPWKDTGAEYIVESTGVFTTTEKASAHLKGGAKRVIISAPSADAPM-YVMGVNEKT
G3P_HALVA       XXFEAGIFETDPTQLPWDDLDVDVAFEATGIFRTKEDASQHLDAGADKVLISAPPKGDEPVLVYGVNHDE
G3P_DEBHA       GQSIKVFGEKDPASIPWGKAGVDYVIESTGVFTTTEGAQKHIDGGAKKVIITAPSSDAPMFVV-GVNEQK
G3P_PICPA       GKEITVFQERDPVNIPWGKAGVDYVIESTGVFTTLEGAQKHIDAGAKKVVITAPSKDAPMFVV-GVNEEK
G3P_ASPOR       GKKIRFFAERDPAAIPWGSAGAAYIVESTGVFTTTEKASAHLKGGAKKVIISAPSADAPM-FVMGVNNKE
G3P1_GIALA      GNKISVFKSMKPEEIPWGKTQVDIVLECTGRFTTKKDAELHITGGCKRVIISAPSADAPM-FVCGCNLET
G3P_MYCPN       KKKVLVFSEKDPANLPWAEHNIDIVVESTGRFVSEEGASLHLQAGAKRVIISAPAKQKTITVVYNVNH-K
G3PA_MAIZE      GKVIKVVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQ
G3P_EMENI       GKKIRFHTERDPANIPWGQDGAEYIVESTGVFTTQEKASAHLKGGAKKVVISAPSADAPM-FVMGVNNET
G3P_CLAPU       GKKVKFHTERDPSAIPWKASGAEYIVESTGVFTTTEKAKAHLTGGAKKVIISAPSADAPM-YVMGVNEKT
G3PC_CHLRE      GRKIHTFTESDPSKINWGAAGADIVIESTGVFTDIAKATAHLTGGAKKVIITAPSNDAPM-YVMGVNHEK
G3P_STRPY       GNFIKVSAERDPENIDWATDGVEIVLEATGXXXXXXXXXXHLHAGAKKVVITAPGGNDVKTVVFNTNHDI
G3P_STRP8       GNFIKVSAERDPENIDWATDGVEIVLEATGXXXXXXXXXXHLHAGAKKVVITAPGGNDVKTVVFNTNHDI
G3P_STRP6       GNFIKVSAERDPENIDWATDGVEIVLEATGXXXXXXXXXXHLHAGAKKVVITAPGGNDVKTVVFNTNHDI
G3P_STRP1       GNFIKVSAERDPENIDWATDGVEIVLEATGXXXXXXXXXXHLHAGAKKVVITAPGGNDVKTVVFNTNHDI
G3P_COLGL       GKTVKFYTERDPAAIPWKETGADYVVESTGVFTTTDKAKAHLQGGAKKVIISAPSADAPM-YVMVVNEKS
G3PG_CRIFA      HRILCVKADRNPADLPWGKLGVDYVIESTGLFTDKAKAEGHVKGGAKKVVISAPASGGAKTIVMGVNQHE
G3P_COLLN       GKKVKFYTERDPAVIPWKETGADYVVESTGVFTTIDKAKAHLQGGAKKVIISAPSADAPM-YVMGVNEKS
G3PG_TRYCR      GHRILCVAQRNPADLPWGKLGVEYVIESTGLFTAKAAAEGHLRGGARKVVISAPASGGAKTLVMGVNHHE
G3P1_KLULA      GHKIAVFQEKDPANLPWGKLGVDIVIDSTGVFKELDSAQKHLDAGAKKVVITAPSKTAPMFVV-GVNEDK
G3P_ASHGO       GKKIKVFQERDPAQLPWGEEGIDIAIDSTGVFKELDSAQKHIDAGAKKVVITAPSSTAPM-FVMGVNEEK
G3PA_ARATH      GKIIQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADA
G3P1_STAAW      GKEVKSFSEPDASKLPWKDLNIDVVLECTGFYTDKDKAQAHIEAGAKKVLISAPATGDLKTIVFNTNHQE
G3P1_STAAU      GKEVKSFSEPDASKLPWKDLNIDVVLECTGFYTDKDKAQAHIEAGAKKVLISAPATGDLKTIVFNTNHQE
G3P1_STAAS      GKEVKSFSEPDASKLPWKDLNIDVVLECTGFYTDKDKAQAHIEAGAKKVLISAPATGDLKTIVFNTNHQE
G3P1_STAAR      GKEVKSFSEPDASKLPWKDLNIDVVLECTGFYTDKDKAQAHIEAGAKKVLISAPATGDLKTIVFNTNHQE
G3P1_STAAN      GKEVKSFSEPDASKLPWKDLNIDVVLECTGFYTDKDKAQAHIEAGAKKVLISAPATGDLKTIVFNTNHQE
G3P1_STAAM      GKEVKSFSEPDASKLPWKDLNIDVVLECTGFYTDKDKAQAHIEAGAKKVLISAPATGDLKTIVFNTNHQE
G3P1_STAAC      GKEVKSFSEPDASKLPWKDLNIDVVLECTGFYTDKDKAQAHIEAGAKKVLISAPATGDLKTIVFNTNHQE
G3P_BACFR       GNKIRLTAEMDPANLKWNEVDADVVVESTGFFLTDETARKHIQAGAKKVIMSAPSKDSTPMFVYGVNHTS
G3PC_TRYBB      GKKIRVTSERDPANLKWNEINVDVVVESTGLFLSDDTARKHIQAGAKKVVITGPSKDDTPMFVMGVNHTT
G3P1_YEAST      GVKIATYQERDPANLPWGSLKIDVAVDSTGVFKELDTAQKHIDAGAKKVVITAPSSSAPMFVV-GVNHTK
G3PG_LEIME      GHRIKCVAQRNPADLPWGKLGVDYVIESTGLFTDKLKAEGHIKGGAKKVVISAPASGGAKTIVMGVNQHE
G3P2_KLULA      GKKVLVFQERDPATLPWGEHNVDIAIDSTGVFKELDSAQKHIDAGAKKVVITAPSSTAPMFVV-GVNEDK
G3P3_YEAST      GKKIATYQERDPANLPWGSSNVDIAIDSTGVFKELDTAQKHIDAGAKKVVITAPSSTAPM-FVMGVNEEK
G3P2_TRIKO      GKKVRFYTERNPADIKWSETGAEYVVESTGVFTTTEKAKAHLVGGAKKVIISAPSADAPM-YVMGVNESD
G3P2_KLUMA      GKKVLVFQERDPATLPWGAEKIDIAIDSTGIFKELDSAQKHIDAGAKKVVITAPSSTAPMFVV-GVNEDK
G3P1_CAEEL      SHKIKVFNSKDPAAIAWGSVKADFVVESTGVFTTKEKASAHLQGGAKKVIISAPSADAPMYVV-GVNHEK
G3PB_PEA        GKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADITYVIGVNEQD
G3P1_TRIKO      GKRIKFYQERDPANIPWKDSGAEYIVESTGVFTTTEKASAHFKGGAKKVIISAPSADAPM-YVMGVNEDT
G3P1_KLUMA      GKKVAVFQEKDPATLPWGKLGVDIAVDSTGVFKELDSAQKHIDAGAKKVVITAPSKTAPMFVV-GVNEDK
G3P_STREQ       GNFIKVSAERDPENIDWATDGVEIVLEATGFFAKKEAAEKPLHAGAKKVVITAPG-GNDVKQLFSTLTTS
G3P4_CAEEL      SHKIKVFNSKDPAAIAWGSVKADFVVESTGVFTTKEKASAHLQGGAKKVIISAPSADAPMYVV-GVNHEK
G3P3_KLUMA      GKKVLVFQERDPATLPWGAEKIDIAIDSTGIFKELDSAQKHIDAGAKKVVITAPSSTAPMFVV-GVNEDK
G3P_CRIGR       GKAITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPM-FVMGVNQDK
G3P2_YEAST      GHKIATFQERDPANLPWASLNIDIAIDSTGVFKELDTAQKHIDAGAKKVVITAPSSTAPM-FVMGVNEEK
G3P2_CANGA      XXXXAVHQERDPANLPWGSENIDIAIDSTGVFKELDTAQKHIDAGAKKVVITAPSSTAPMFVV-GVNEDK
G3P_ZYGRO       GKKVAVFNEKDPAALPWGKLGVDVAIDSTGIFKEMDSANKHIEAGAKKVVITAPS-GSAPMYVMGVNEET
G3PB_TOBAC      GKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADITYVVGVNEQD
G3P_COTJA       GNAITIFQERDPSNIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPM-FVMGVNHEK
G3P3_CAEEL      KEKIKVYNSRDPAEIQWGASGADYVVESTGVFTTIEKANAHLKGGAKKVIISAPSADAPMFVV-GVNHEK
G3P3_ANAVT      STPLSFSEYGKPEDVPWEDFGVDLVLECSGKFRTPATLDPYFKRGVQKVIVAAPVKEEALNIVMGVNDYL
G3P2_CAEEL      KEKIKVYNSRDPAEIQWGASGADYVVESTGVFTTIEKANAHLKGGAKKVIISAPSADAPMFVV-GVNHEK
G3P3_CAEBR      KEKIKVYNSRDPAEIQWGSAGADYVVESTGVFTTIEKANAHLKGGAKKVIISAPSADAPMFVV-GVNHEK
G3PG_TRYBB      GHRILCVAQRNPADLPWGKLGVEYVIESTGLFTVKSAAEGHLRGGARKVVISAPASGGAKTFVMGVNHNN
G3P2_CAEBR      NEKIKVYNSKDPAEIQWGAAGADYVVESTGVFTTIEKANAHLKGGAKKVIISAPSADAPMFVV-GVNHEK
G3P2_AGABI      GRPMKVFAERDPAAIPWGSVGADYVVESTGVFTTIDKASAHLKGGAKKVVISAPSADAPM-YVCGVNLDK
G3P1_CANGA      GKAIKCYQERDPADLPWGDNDIDIVIEATGVFTAKDLAEKHITAGAKKVVITGPSATAPM-FVKGVNDDK
G3PA_PEA        GKVIKVVSDRNPANLPWKELGIDLVIEGTGVFVDREGAGRHITAGAKKVLITAPGKGDIPTYVVGVNADA
G3P3_ANASP      GTPLSFSEYGKPDDVPWEDFGVDLVLECSGKFRTPATLDPYFKRGVQKVIVAAPVKEEALNIVMGVNDYL
G3P_CRYPA       GKKVRFYTERDPAAIPWSETGADYIVESTGVFTTTEXXXXXXXXXXXXVIISAPSADAPM-YVMGVNEKT
G3PT_MACFA      NHEISVYQCKEPKQIPWRDVGSPYVVESTGVYLSIEAASNHISAGAQRVVISAPSPDAP-TFVMGVNENN
G3P_MUSPF       GKSISIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPM-FVMGVNHEK
G3P_COLLI       GNAITIFQERDPSNIKWADAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPM-FVMGVNHEK
G3P_CHICK       GHAITIFQERDPSNIKWADAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPM-FVMGVNHEK
G3P_SPECI       GKSISIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPM-FVMGVNHEK
G3P_PICCI       GKKIRVYQERDPVNIPWGKDGVDYVIDSTGVFKELDSAQKHIDAGAKKVVITAPSSTAPMFVV-GVNEDK
E4PD_PSEHT      GDAIALFCEPNPAELPWKTLGVDVVLECTGVYHSREHAQLHLTAGAKKVLFSHPADNDDATIVYGINDDE
G3P_RAT         GKPITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPM-FVMGVNHEK
G3P_MOUSE       GKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPM-FVMGVNHEK
G3P_ASPNG       GKKIRFFAERDPAAIPWGTTGADYIVESTGVFTTQEXXXXXXXXXXXXVVISAPSADAPM-FVMGVNNTS
G3P_TRISI       GQAITIFQERDPANIKWGDAGAEYVVESTGVFTTTEKASAHLKGGAKRVVISAPSADAPM-FVMGVNHEK
G3P_CANFA       GKSISIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPM-FVMGVNHEK
G3PT_DANRE      GQAISVFQCMKPAEIPWGDAGALYVVESTGVFLSIEKASAHIQGGAKRVVVSAPSPDAPM-FVMGVNQDK
G3P_PICAN       GKKIEVFQERDPANIPWGKEGVDYVLDSTGVFTTIEGAQKHIDAGAKKVIITAPSKDAPMFVV-GVNHEE
G3PA_TOBAC      GKVIQVVSDRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADL
G3P1_RHIRA      GHAIAVSAERDPTSIPWGSAGADYVVESTGVFTTTEAASAHLKGGAKKVIISAPSADAPM-FVCGVNLEA
G3P_RABIT       GKAITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPM-FVMGVNHEK
G3P_FELCA       GKPITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPM-FVMGVNHEK
G3PC_PINSY      EKSVAVFGCRNPEEIPWGEVGAEYVVESTGVFTDKEKASAHLKAGAKKVVISAPSKDAPMFVV-GVNEHQ
G3PT_MOUSE      NLEINTYQCKDPKEIPWSSIGNPYVVECTGVYLSIEAASAHISSGARRVVVTAPSPDAPM-FVMGVNEKD
G3P_PIG         GKAITIFQERDPANIKWGDAGATYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPM-FVMGVNHEK
G3P_YARLI       GKHIQVFGERDPSNIPWGKAGADYVVESTGVFTGKEAASAHLKGGAKKVIISAPS-GDAPMFVVGVNLDA
G3P_ONCVO       KTTHQIAVHKDPAEIPWGVEGAEYVVESTGVFTHTEKASAHLKGGAKKVIISAPSADAPM-FVMGVNNDK
G3P_BOVIN       GKAITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPM-FVMGVNHEK
G3P_PONAB       GNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADAPM-FVMGVNHEK
G3P_HUMAN       GNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADAPM-FVMGVNHEK
G3PT_HUMAN      NHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAASDHISAGAQRVVISAPSPDAPM-FVMGVNEND
G3P_OMPOL       GKPIAVFGERDPASIPWGASGADYVVESTGVFTTIDKASAHLKGGAKKVIISAPSADAPM-YVCGVNLDA
G3P_PHANO       GKTIRFYTEKDPANIPWSETGAYYVVESTGVFTTTDXXXXXXXXXXXXVVISAPSADAPM-FVMGVNNET
G3P_HOMAM       GKKITVFNEMKPENIPWSKAGAEYIVESTGVFTTIEKASAHFKGGAKKVVISAPSADAPM-FVCGVNLEK
G3PC_GRAVE      GKSITIYGHRDPAEIPWAEAGADYVVESTGVFTLKEKAEKHFTGGAKKVIISAPSKDAPM-FVCGVNEDK
G3P_COCHE       GKTIRFHMEKDPANIPWSETGAYYVVESTGVFTTTEXXXXXXXXXXXXVVISAPSPDAPM-FVMGVNHET
G3P_TRIAT       GKPIRFYSERDPANIKWSETGAEYIVESTGVFTTIDKAKAHLNGGAKKVIISAPSADAPM-FVMGVNHKD
G3PT_BOVIN      NNEISVFQCKQPKEIPWKSVGSPFVVEATGVYLSLEETKAHIEAGAQRVVICAPSPDAPM-FVMGVNEKE
G3P3_ECOLI      GKSIAVYAEKEAKNIPWKAKGAEIIVECTGFYTSAEKSQAHLDAGAKKVLISAPA-GEMKTIVYNVNDDT
G3P2_RHIRA      GKEISVFSERDPAQIPWGSVEAAYVVESTGVFTSIDAASAHLQGGAKKVIISAPS-GDAPMFVCGVNLEK
G3PC_LEIME      GKSIRVTSERDPANLKWDEIGVEVVVESTGLFLTQETAHKHIEAGARRVVMTGPPKDDTPMFVMGVNHTT
G3P3_ECO57      GKSIAVYAEKEAKNIPWKAKGAEIIVECTGFYTSAEKSQAHLDAGAKKVLISAPA-GEMKTIVYKVNDDT
G3P_MYCGE       RKKVYVFSEKDPQNLPWDEHDIDVVIESTGRFVSEEGASLHLKAGAKRVIISAPAKEKTITVVYNVNH-K
G3P_CURLU       GKTVRFHMEKDPANIPWSETGAYYVVESTGVFTTTEXXXXXXXXXXXXVVISAPSADAPM-FVMGVNHET
G3PC_RANAC      EKPVTVFGCRNPEEIPWGETGAEFVVESTGVFTTKEKASAHLKGGAKKVVISAPSADAPMFVV-GVNHTE
G3P_PHARH       GKPIVVYGERDPANIQWGAAGADYVVESTGVFTTQEKAELHLKGGAKKVVISAPSADAPM-FVCGVNLDK
G3P_BUCBP       GKKIRITNEKDPKNLMWGDLNIDVVIESTGIFLTTEDSYKHIQAGAKKVIITSPPKDNTPMFVRGVNFNE
G3P_LACLA       GKFVKVTAERNPEDIQWADSGVEIVLEATGFFATKEKAEKHLHGGAKKVLITAPGGNDVKTVVFNTNHTI
G3P_PANVR       GKKITVFNEMKPENIPWSKAGAEYIVESTGVFTTIEKASAHFKGGAKKVIISAPSADAPM-FVCGVNLEK
G3P_DANRE       GHAITVYSERDPANIKWGDAGATYVVESTGVFTTIEKASAHIKGGAKRVIISAPSADAPM-FVMGVNHEK
G3P1_JACOR      GHAITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSRDAPM-FVMGVNHEK
G3P_XENLA       DQVITVFQERDPSSIKWGDAGAVYVVESTGVFTTTEKASLHLKGGAKRVVISAPSADAPMFVV-GVNHEK
G3P_ONCMY       DHSISVFQCMKPHEIPWGKAGADYVVESTGVFLSIDKASSHIQGGAKRVVVSAPSPDAPM-FVMGVNEDK
G3P_ERYGR       SRNVKFYNKRNPEEIPWAETGAEYIVESTGVFTTTEXXXXXXXXXXXXVIISAPSADAPM-FVMGVNHKS
G3PT_RAT        NLEINVFQCKEPKEIPWSSVGNPYVVEATGVYLSIEAASGHISSGARRVIVTAPSPDAPM-LVMGVNEKD
G3P2_STAAR      DHKIKLVADRNPENLPWKELDIDIAIDATGKFNHGDXXXXXXXXXXXXVLLTGPSKGGHVQVVKGVNDDQ
G3P_LYOSH       GKPVIVYGEKNPSDIKWGAAGRDYVVESTGVFTTVEKAEGHLKGGAKKVIISAPSADAPM-FVMGCNLDQ
G3P_DICDI       GNKIHVFAEKDPANIKWSSVGAEYIVESTGLFLSTEKAGVHLKGGAKKVVISAPSTDAPM-YVMGVNEET
G3P_BUCAP       XXXXXXTSIKDPEKLMWDKLLIDVVIESTGLFLTKDTAYKHILSGAKKVVITGPSKDDIPMFVRGANFDK
G3P_BRUMA       KTTISVHNSKDPAEIPWGVDGAEYVVESTGVFTTTDKASAHLKGGAKKVIISAPSADAPM-FVMGVNNDM
G3P1_SCHPO      GNAIDVHNERDPADIKWSTSGADYVIESTGVFTTQETASAHLKGGAKRVIISAPSKDAPMYVV-GVNEEK
G3P2_STAAW      DHKIKLVADRNPENLPWKELDIDIAIDATGKFNHGDXXXXXXXXXXXXVLLTGPSKGGHVQVVKGVNDNQ
G3P2_STAAS      DHKIKLVADRNPENLPWKELDIDIAIDATGKFNHGDXXXXXXXXXXXXVLLTGPSKGGHVQVVKGVNDNQ
G3P2_STAAN      DHKIKLVADRNPENLPWKELDIDIAIDATGKFNHGDXXXXXXXXXXXXVLLTGPSKGGHVQVVKGVNDNQ
G3P2_STAAM      DHKIKLVADRNPENLPWKELDIDIAIDATGKFNHGDXXXXXXXXXXXXVLLTGPSKGGHVQVVKGVNDNQ
G3P2_STAAC      DHKIKLVADRNPENLPWKELDIDIAIDATGKFNHGDXXXXXXXXXXXXVLLTGPSKGGHVQVVKGVNDNQ
G3P1_GLORO      THTIKVFNLKDPAEIKWAEVGAEYVIESTGVFTTIEKASAHLKGGAKKVVISAPSADAPM-YVMGVNEDK
G3P_TREPA       GHRIKCVCGRGPSQLPWKDLGIEVVIEATGIYAN-ESSYGHLEAGAKRVIIXXXXXXXXXTIVMGVNEHE
G3P_SCLSC       GKKVKFYTERDPANIPWAESEAYYVVESTGVFTTTEXXXXXXXXXXXXVVISAPSADAPM-YVMGVNNET
G3PX_HORVU      EKPVTVFGVRNPEEIPWGEAGADYVVESTGVFTXXXXXXXXXXXXXXXVVISAPSKDAPMFVV-GVNEDK
G3P_CRYNE       NKAIAVFGEKDPANIKWGEAGAEYVVESTGVFTTTEKAGVHLKGGAKKVVISAPSADAPM-FVCGVNLDA
G3P_KLEPN       GKKIRVTAERDPANLKWDEVGVDVVAEATGIFLTDETARKHITAGAKKVVLTGPSKDNTPMFVRGANFDA
G3P_BUCAI       XXXXRVTSIKDPEKLMWHDLSIDVVIESTGLFLKREQAYKHILAGSKKVVVTGPSKDDIPMFVRGANFHK
G3P2_SCHPO      GHSIDVHNERDPANIKWSASGAEYVIESTGVFTTKETASAHLKGGAKRVIISAPSKDAPMFVV-GVNLEK
G3PD_MAIZE      EKPVTVFGIRNPEEIPWGEAGAEYVVESTGVFTXXXXXXXXXXXXXXXVVISAPSKDAPMFVV-GVNEDK
G3PC_MAIZE      DKPVTVFGIRNPEEIPWGEAGAEYVVESTGVFTXXXXXXXXXXXXXXXVVISAPSKDAPMFVV-GVNEDK
E4PD_SALG2      DDVIRILHERTLADLPWRELGVDVVLDCTGVYGNREHGEAHIAAGAKKVLFSHPSNGLDATVVFGVNQNE
E4PD_SALSV      DDVIRILHERTLADLPWRELGVDIVLDCTGVYGNREHGEAHIAAGAKKVLFSHPGSNDDATVVFGVNQNQ
G3P_MESAU       GKAITIFQERDPTNIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPM-FVMGVNHDK
E4PD_SALTY      DDVIRILHERTLADLPWRELGVDVVLDCTGVYGNREHGEAHIAAGAKKVLFSHPGSNDDATVVFGVNQNQ
E4PD_SALTI      DDVIRILHERTLADLPWRELGVDVVLDCTGVYGNREHGEAHIAAGAKKVLFSHPGSNDDATVVFGVNQNQ
E4PD_SALPC      DDVIRILHERTLADLPWRELGVDVVLDCTGVYGNREHGEAHIAAGAKKVLFSHPGSNDDATVVFGVNQNQ
E4PD_SALPB      DDVIRILHERTLADLPWRELGVDVVLDCTGVYGNREHGEAHIAAGAKKVLFSHPGSNDDATVVFGVNQNQ
E4PD_SALNS      DDVIRILHERTLADLPWRELGVDVVLDCTGVYGNREHGEAHIAAGAKKVLFSHPGSNDDATVVFGVNQNQ
E4PD_SALHS      DDVIRILHERTLADLPWRELGVDVVLDCTGVYGNREHGEAHIAAGAKKVLFSHPGSNDDATVVFGVNQNQ
E4PD_SALEP      DDVIRILHERTLADLPWRELGVDVVLDCTGVYGNREHGEAHIAAGAKKVLFSHPGSNDDATVVFGVNQNE
E4PD_SALDC      DDVIRILHERTLADLPWRELGVDVVLDCTGVYGNREHGEAHIAAGAKKVLFSHPGSNDDATVVFGVNQNE
E4PD_SALCH      DDVIRILHERTLADLPWRELGVDVVLDCTGVYGNREHGEAHIAAGAKKVLFSHPGSNDDATVVFGVNQNQ
E4PD_SALA4      DDVIRILHERTLADLPWRELGVDVVLDCTGVYGNREHGEAHIAAGAKKVLFSHPGSNDDATVVFGVNQNQ
G3P_LACDE       GKKYRVYAEPQAQNIPWKNDGVDFVLECTGFYTSKAKSQAHLDAGAKRVLISAPAGNDLKTIVYSVNQDT
G3PC_PEA        QKPVTVFAHRNPEEIPWASTGADIIVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVV-GVNENE
G3P_PHYIN       GKPIRVFNEMNPENIKWGEEQVQYVVESTGAFTTLEKASTHLKNGVEKVVISAPSSDAPM-FVMGVNHEL
G3P_RHIMI       GKPISVYAERDPCCIP-GRIGAEYIVESTGVFTTKEKAGAHLTGGAKKVIISAPSADAPMFVV-GVNLES
G3P_ATRNU       ERPVTVFGNRNPEEIPWGQTGADYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVV-GVNEHE
G3PA_SCEVA      GKSIRVVSSRDPTKLPWGEMEIDLVIEGTGVFIDTPGASKHIEAGAKKVLITAPAKGSDITYVVGVNAHD
E4PD_SALPK      DDVIRILHERTLADLPWRELGVDVVLDCTGVYGNQEHGEAHIAAGAKKVLFSHPGSNDDATVVFGVNQNQ
E4PD_SALPA      DDVIRILHERTLADLPWRELGVDVVLDCTGVYGNQEHGEAHIAAGAKKVLFSHPGSNDDATVVFGVNQNQ
E4PD_SALAR      DDVIRILHEQTLADLPWRELGVDVVLDCTGVYGNREHGEAHIAAGAKKVLFSHPGSNDDATVVFGVNQNQ
E4PD_ALTMD      GDDIALLAISDIKELPWRDLGVDIVLECTGKFDDRASGQAHLDAGAGKVLFSSPGSPDDNTVIFGTNEDT
G3PE_MAIZE      EKEVAVFGCRNPEEIPWGSVGAEYVVESTGVFTDQEXXXXXXXXXXXXVVISAPSKDAPMFVV-GVNEKE
G3PC_SINAL      EKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTXXXXXXXXXXXXXXXVVISAPSKDAPMFVV-GVNEHE
E4PD_ESCF3      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDATVVYGVNQDQ
G3PC_GINBI      EKAVTVFGCRNPEEIPWGETGVEYVVESTGVFTDXXXXXXXXXXXXXXVVITAPSKDAPMFVV-GVNEHE
E4PD_SHISS      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDATVVYGVNQDQ
E4PD_SHIFL      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDATVVYGVNQDQ
E4PD_SHIF8      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDATVVYGVNQDQ
E4PD_SHIBS      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDATVVYGVNQDQ
E4PD_SHIB3      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDATVVYGVNQDQ
E4PD_ECOUT      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDTTVVYGVNQDQ
E4PD_ECOSM      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDATVVYGVNQDQ
E4PD_ECOSE      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDATVVYGVNQDQ
E4PD_ECOLU      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDATVVYGVNQDQ
E4PD_ECOLI      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDATVVYGVNQDQ
E4PD_ECOLC      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDATVVYGVNQDQ
E4PD_ECOL6      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDATVVYGVNQDQ
E4PD_ECOL5      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDATVVYGVNQDQ
E4PD_ECOHS      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDATVVYGVNQDQ
E4PD_ECODH      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDATVVYGVNQDQ
E4PD_ECOBW      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDATVVYGVNQDQ
E4PD_ECO8A      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDATVVYGVNQDQ
E4PD_ECO81      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDTTVVYGVNQDQ
E4PD_ECO5E      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDATVVYGVNQDQ
E4PD_ECO57      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDATVVYGVNQDQ
E4PD_ECO55      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDATVVYGVNQDQ
E4PD_ECO27      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDTTVVYGVNQDQ
E4PD_ECO24      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDATVVYGVNQDQ
E4PD_SHIDS      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDATVVYGVNQDQ
G3P_CRYCU       GKPISVFGERDPAAIPWGKAGADYVVESTGVFTTIEKASLHLKGGAKKVIISAPSADAPM-FVCGVNLEA
G3PC_TAXBA      EKHVAVFGCRNPEEIPWGEVGAEYVVESTGVFTXXXXXXXXXXXXXXXVVISAPSKDAPMFVV-GVNEHE
G3P_LENED       GKEISVFGEKDAGAIPWSSVGAEYIVESTGVFTTIEKASAHLKGGAKKVIISAPSADAPM-YVCGVNLDS
G3P_HAEIN       GKTIRVTAERDPANLNWGAIGVDIAVEATGLFLTDETARKHITAGAKKVVLTGPSKDATPMFVRGVNFNA
G3PC_ORYSJ      EKPVTVFGIRNPDEIPWAEAGAEYVVESTGVFTDXXXXXXXXXXXXXXVVISAPSKDAPM-FVCGVNEDK
G3PC_ORYSI      EKPVTVFGIRNPDEIPWAEAGAEYVVESTGVFTDXXXXXXXXXXXXXXVVISAPSKDAPM-FVCGVNEDK
E4PD_PROMH      DDAIRLFHHADIADLPWGELGIDVVLDCSGVYGSRADGEAHIAQGAKKVLFSHPGTIDDATVVFGVNQHE
G3PC_PETCR      DKPLTVFGVRNPEEDPWGEAGAEYVVESTGVFTXXXXXXXXXXXXXXXVVISAPSGNAPMFVV-GVNEKE
G3P_ECHMU       SHRITVFQEMSASAVPWSQAGAEYIVESTGINTTVEKASAHFQGGAKKVIISAPS-ADSSHVRVGVNHEK
G3P3_RHIRA      GHEIAVHAERDPAQIPWGSHGADYVIESTGVFTTKDAASAHLKGGAKKVIISAPSADAPMFVV-GVNLDK
E4PD_ECOK1      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDTTVVYGVNQDQ
E4PD_ECO7I      DDAIRVLHEHSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDATVVYGVNQDQ
E4PD_ECO45      DDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSNDDTTVVYGVNQDQ
G3P_SCHCO       GHAITVFAEKNPADIKWGSAGADYIVESTGVFTTVEKASLHLQGGAKKVVISAPSADAPMFVV-GVNLDK
G3PC_DIACA      EKAVTVFGNRNPEEIPWGGTGADYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVV-GVNEHE
E4PD_TOLAT      DDAIRLLHQKEISQLPWGDLGVDIVLDCSGVYGKRADGEMHLASGAKKVLFSHPGSSDDATVIYGVNHQQ
G3PC_MESCR      ETPVAVFGCRNPEEIPWGQAGADFVVESTGVFTXXXXXXXXXXXXXXXVVISAPSKDAPMFVV-GVNEHE
E4PD_KLEP7      DDSIRLLHEPTIAALPWRELAVDVVLDCTGVYGSREHGEAHLQAGAKKVLFSHPGGNDDATVVYGVNQDE
G3P_PHACH       GKPIHVFAEKDPANIPWGSVGAEYIVESTGVFTTTEKASAHLKGVCKKVIISAPSADAPM-FVCGVNLDA
G3P_GLOMM       GKKITVFCERDPTNINWASAGAEYIVESTGVFTTIDKASAHFKGGAKKVVISAPSADAPM-FVCGVNLEA
E4PD_KLEP3      DDAIRLLHEPTIAALPWRELAVDVVLDCTGVYGSREHGEAHLQAGAKKVLFSHPGGNDDATVVYGVNQDE
E4PD_CITK8      DDTIRILHERTLDALPWRELSIDVVLDCTGVYGNREHGEAHLAAGAKKVLFSHPGSHDDATVVFGVNQEQ
E4PD_SHESR      DDVIKILHEPDPAKLPWREMDIDIVYEATGAILDRNSCEAHIHAGAKQVLISHPSSADDGTIVYGVNQDL
E4PD_SHESM      DDVIKILHEPDPAKLPWHEMDIDIVYEATGAILDRNSCEAHIHAGAKQVLISHPSSADDGTIVYGVNQDL
G3P_PLESA       GKPIHIFAEKDPANIPWGSVGADYVVESTGVFTTIDKASAHL-KGGEKVVISAPSADAPM-FVCGVNLET
G3PC_ANTMA      EKPVVVFGRRNPEEIPRASTGAEYIVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVV-GVNEKE
E4PD_SHESA      DDVIKILHEPDPAKLPWREMDIDIVYEATGAILDRNSCEAHILAGAKQVLISHPSSADDGTIVYGVNQDL
E4PD_SHEB2      DDAIKILHEPDPTKLPWHEMDIDIVYEATGVLLDRQSCEAHIHAGAKQVLISHPSSADDGTIVYGVNHDL
E4PD_SHEON      DDTIKIFHEPDPAKLPWRELDIDIVYEATGAILDRQSCEAHIHAGAKQVLISHPSSADDGTIVYGVNHDL
E4PD_ENTS8      NDVIRLLHERDINALPWKALDVDVVLDCTGVYGSRADGIAHLEAGARKVLFSHPGGNDDATVVYGVNEEE
G3PC_PETHY      EKPVTVFGIRNPEEIPWGEAGADYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVV-GVNEKE
E4PD_AERHH      EDLISLFAERDPSRLPWRALGVDVVLDCTGVFGSRADAELHLAAGAGKVLFSHPAEADDATIVYGVNHQV
G3PC_PHYPA      GNPVAVYACRDPSEIPWGKHGADFVVESTGVFTXXXXXXXXXXXXXXXVVISAPSKDAPM-FVMGVNENK
G3PC_CHOCR      GNSITVFAHRDPAEIPWATAAADYIVEATGVFTLXXXXXXXXXXXXXXVVISAPSKDAPM-FVCGVNEAK
E4PD_ENT38      DDAIRVLHEQSIDALPWRELGVDVVLDCTGVYGNREHGEAHLAAGAKKVLFSHPGGHDDATVVYGVNHHE
E4PD_AERS4      EDLISLFAEQDPANLPWRALGVDVVLDCTGVFGSRADAELHLGAGAGKVLFSHPADADDATIVYGVNHQV
G3P_SERMA       GKTIRVTAEKDPANLKWNEVGVDVVAEATGIFLTDETARKHITAGAKKVVLTGPSKDATPMFVRGANFDK
E4PD_ERWCT      DDDIRLLHQVEIQQLPWRELSVDIVLDCSGVYGSREDGEAHLAAGAKKVLFSHPGTTDDATVVFGVNHDR
G3P_SCHMA       GKLISVHCERDPANIPWDKDGAEYVVESTGVFTTIDKAQAHINNRAKKVIISAPSADAPMFVV-GVNENS
G3P1_ESCFE      GKKIRVTAERDPANLKWDEVGVDVVAEATGIFLTDETARKHITAGAKKVVLTGPSKDNTPMFVKGANFDK
E4PD_SHESW      DDAIKILHEPDAAKLPWREMDIDIVYEATGVILDRQSCEAHIHAGAKQVLISHPSSADDGTIVYGVNHDL
E4PD_SHEPW      DDAIKLLHEPNPANLPWQEMDIDIVFEATGVINDRQACEAHIEAGARQVLISHPSSSDDATIVYGVNQDL
E4PD_SHEPC      DDAIKILHEPDAAKLPWREMDIDIVYEATGVILDRQSCEAHIHAGAKQVLISHPSSADDGTIVYGVNHDL
G3P_ESCHE       GKKIRVTAEKDPANLKWNEVGVDVVAEATGIFLTDETARKHITAGAKKVVLTGPSKDDTPMFVKGANFDK
E4PD_PSEA6      GDHITLLQQENIRDLPWAQLDIDVVLECTGVNNERVHGEQHIAQGAKKVLFSQPCGPDDATIIMGINEES
G3P_USTMA       GKSIAVFAEKDPSNIPWGQAGAHYVVESTGVFTTIDKASAHIKGGAKKVVISAPSADAPM-YVCGVNLDA
G3PC_SCEVA      GEQIKTLAMMDPTQIPWGEVGADYVVESTGVFTTVDKCQAHLKGGAKKVVISAPSADAPM-FVMGVNADK
G3P2_DROME      GQKITVFSERDPANINWASAGAEYIVESTGVFTTIDKASTHLKGGAKKVIISAPSADAPM-FVCGVNLDA
E4PD_PECCP      DDCIRLLHQAEIQALPWRELGVDIVLDCSGVYGSREDGEAHLAAGAKKVLFSHPGTADDATVVFGVNHQQ
G3P1_ESCVU      GKKIRVTAERDPANLKWDEVGVDVVAEATGIFLTDETARKHITAGAKKVVLTGPSKDNTPMFVRGANFDT
E4PD_SHEFN      DDSILLLNQPDANLLPWAELDIDIVYEATGSLIDRQACEAHIHAGAKQVLISHPSSADDETIVYGVNHDL
G3P1_AGABI      GHKIAAFAEREPANIKWADCGAEYIVESTGVFKTEELAKEHLKGGAKKVVITAPGSGVP-TYVVGVNLDK
E4PD_SHEDO      DDAIALFHQSDATKLPWGELDIDIVFEASGSLIEREACEAHIISGAKQVLISHPSSQDDATIVYGVNHHL
E4PD_ERWT9      DDTIRLLHIPEIGSLPWRELNVDIVLDCTGVYGSRADGEAHLKAGARKVLFSHPGGHDDATVVYGVNEKE
G3P_CITFR       GKKIRVTAERDPANLKWDEVGVDVVAEATGLFLTDETARKHITAGAKKVVLTGPSKDNTPMFVKGANFDK
E4PD_SHEHH      DDAIKLLHEPNPANLPWKELDIDIVYEATGVINDRQECEAHLKAGAKQVLISHPSSNDDATIVYGVNQDL
G3P_BORHE       GREIKIIAERDPKNLPWGKLGXDVVIESTGVFSSASDKGGYLDAGAKKVILTAPAKDEIKTIXLGVXDHD
E4PD_SHEPA      DDAIKLLHEPDPAKLPWKEMDIDIVFEATGVINDRLECEAHIQAGAKQVLISHPSSSDDATIVFGVNQDL
G3PC_TOBAC      EKSVRVFGIRNPEEIPWAEAGADFVVESTGVFTXXXXXXXXXXXXXXXVVISAPSKDAPMFVV-GVNEKE
G3P_SHEEP       GKAITIFQERDPANIKWGDAGAEYVVESTGVFTTMEXXXXXXXXXXXXVIISAPSADAPM-FVMGVNHEK
G3P_ENTAE       GKTIRVTAEKDPANLKWNEIGVDVVAEATGIFLTDETARKHITAGAKKVVLTGPSKDNTPMFVRGANFET
G3P_DROHY       GQKITVFSERDPANINWASAGAEYVVESTGVFTTTEKASTHLKGGAKKVVISAPSADAPM-FVCGVNLDA
G3P_SEROD       GQTIRVTAEKDPANLKWNEVGVDVVAEATGIFLTDETARKHIAAGAKKVVLTGPSKDDTPMFVMGVNLKS
E4PD_SHEAM      NDAIRLLAIEDAAALPWQALDVDLVFECTGALNDRQSAEAHITAGARKVLISHPSSADDATIVYGVNDAS
E4PD_YERE8      DDIIRLIHQPEIEQLPWGELGIDVVLDCSGVYGSRADGEAHLTSGAKKVLFAHPGGHDDATVVYGVNHQD
G3P_MASBA       GHVIAVSACKNPAEIPWGASNVEVVIESSGAFTTMEKAHLHQQGGAKKVLITAPSADAPM-FVYGVNHQS
E4PD_SHELP      DDRIQLLHEADAEKLPWRSLDIDIVFEATGALIDRQACEAHIRAGAKQVLISHPSSGDDATIVYGVNHQD
G3P_ESCBL       GKKIRVTAERDPANLKWNEAGVEVVAEATGLFLTDETARKHITAGAKKVVMTGPSKDSTPMFVRGANFDT
G3PC_CRAPL      DKPVAVFGLRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVV-GVNEKT
G3PC_MAGLI      EKPVTVFGVRNPEEIPWGETGAEFVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVV-GVNEHE
E4PD_VIBCH      HQSIRILHLSEIPLLPWRDLGVDLVLDCTGVYGCQEDGQQHIDAGAKLVLFSHPGASDDNTIIYGVNHET
E4PD_VIBC3      HQSIRILHLSEIPLLPWRDLGVDLVLDCTGVYGCQEDGQQHIDAGAKLVLFSHPGASDDNTIIYGVNHET
E4PD_PHOLL      DDNIRLFHQSDISMLPWQELGIDIVLDCSGIYGSRADGEAHLASGAKKVLFAHPGGNDDATVVYGVNQHL
E4PD_ALISL      QDRIRIVHQADISLLPWQSLQVDLVLDCTGVYGSKADGERHIDAGAKKVLFSHPGSADDNTIIYGVNHDT
E4PD_YERPS      DDIIRLIHQSEIEQLPWSELGIDVVLDCSGVYGSREDGEAHVASGAKKVLFAHPGGHDDATVVYGVNHQD
E4PD_YERPN      DDIIRLIHQSEIEQLPWSELGIDVVLDCSGVYGSREDGEAHVASGAKKVLFAHPGGHDDATVVYGVNHQD
E4PD_YERPE      DDIIRLIHQSEIEQLPWSELGIDVVLDCSGVYGSREDGEAHVASGAKKVLFAHPGGHDDATVVYGVNHQD
E4PD_YERPA      DDIIRLIHQSEIEQLPWSELGIDVVLDCSGVYGSREDGEAHVASGAKKVLFAHPGGHDDATVVYGVNHQD
E4PD_EDWI9      DDRIRLLHRPQIADLPWEALQVDVVLECSGVYGSRADGEAHLLAGAGKVLFSHPGGHDDATVVYGVNQES
G3PC_ARATH      EKPVTVFGIRNPEDIPWAEAGADYVVESTGVFTXXXXXXXXXXXXXXXVVISAPSKDAPMFVV-GVNEHE
G3P_LACDT       GHPITVFQERDPANIQWGSVGADYVVESSGVFTTVDKASAHLKGGAKKVIISAPSADAPMFVV-GVNLDA
E4PD_VIBHB      HDSIRILHLAEIELLPWRDLEVDIVLDCTGVFGSQADGQAHIEAGAQKVLFSHPGASDDNTIIYGVNHET
E4PD_VIBFM      QDKVRILHQADLSLLPWQSLEVDLILDCTGVYGSKADGEKHINAGAKKVLFSHPGGSDDNTIIYGVNHDT
E4PD_IDILO      GDNIALTHQTEIEAIDWRAHEVDFVVDCTGVFGSQADGQLYLQQGVKRVLFSHPGKPDDFTAIYGVNEKE
G3P1_DROME      GQKITVFSERDPANINWASAGAEYVVESTGVFTTIDKASTHLKGGAKKVIISAPSADAPM-FVCGVNLDA
E4PD_VIBPA      HESIRILHLSEIELLPWRDLEVDIVLDCTGVYGSKADGLAHIEAGAKKVLFSHPGANDDNTIIYGVNHET
G3P2_DROPS      GQKITVFSERDPANINWASAGAEYVVESTGVFTTIEKASTHLKGGAKKVVISAPSADAPM-FVCGVNLDA
E4PD_VIBF1      QDKVRILHQADLSLLPWQSLEVDLVLDCTGVYGSKSDGEKHITAGAKKVLFSHPGGSDDNTIIYGVNHDT
E4PD_COLP3      GDEIALTHIGNLNSLPWQQQNIDIVLDCTGKYGNKADGLSHINRGAKKVLFSHPGSQDDATIIYGINHQT
E4PD_VIBVY      HDSIRILHLSEINLLPWRDLEVDLVLDCTGVFGCQADGLEHIKAGAKKVLFSHPGASDDNTIIYGVNHET
E4PD_VIBVU      HDSIRILHLSEINLLPWRDLEVDLVLDCTGVFGCQADGLEHIKAGAKKVLFSHPGASDDNTIIYGVNHET
G3P_HELPY       SLEIPVFNSIKDLK------GVDVIIECSGKFLEPKTLENYLLLGAKKVLLSAPFMGEYPTLVYGVNHFC
E4PD_PSYIN      NDDIHLVRFSELADLPWHEHDIDIVLDCTGIYGSRXXXXXXXXXXXKKVIFSHPADPDDATVVYGINHQQ
G3PA_GUITH      XQRVITTRARDPKDIGWAKTGVEYLCESTGVFLTAEKAQPHIDAGVKKVIFSAPAKDDSLTVVMGVNAED
G3P_AMAMU       QKPITVFRKRDPVQIPWGSAGAEYIVESTGVFTTTEKASAHLKGGAKKIVISAPSADAPM-FVCGVNLDK
E4PD_PHOPR      HENIRILHQSDITLLPWHDLDVDIVLDCTGVYGSREDGLAHIKAGAKKVLFSHPAANDDNTIIYGVNH-K
G3PC_HORVU      EKEVAVFGCRNPEEIPWAAAGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPM-FVCGVNEKE
G3P_HELPJ       SLEIPVFNSIKDLK------GVGVIIECSGKFLEPKTLENYLLLGAKKVLLSAPFMGEYPTLVYGVNHFL
G3P_MELGA       ----------------------EYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPM-FVMGVNHEK
G3P_BOLED       GKAITVFAERDPANIPWGTVGAQYVVESTGVFTTIEKASAHLKGGAKKVIISAPSSDAPM-FVCGVNLDA
G3PA_SINAL      -----------------------------------EGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAEL
G3P2_DROSU      GQKITVFSERDPANINWASAGAEYVVESTGVFTTIEKASTHLKGGAKKVVISAPSADAPM-FVCGVNLDA
G3P_CAVPO       ----------------------------------------------------------------------
G3P_AERPE       GTLRELLAR------------VDVVVDATPEGQGAKNKPLYREAGVKQV-YQGGEKPEVAEASFSTLCNY
G3P_METHJ       GSVEDMLKK------------ADIVVDGTPGGVGESNKALYEKAGVKAIW----QGGEDHEVAFNAHANY
G3P_HALMA       GTVHDLIETS------------DVVVDTTPSGVGAANASLYAEHDTPAIFQGGDADVADVSFNARANYEK
G3P2_JACOR      ----------------------------------------------------------------------
DHAS_CORFL      --------------------GIDVALFSAGGTASKQYAPLFAAAGATVVDNSSAWRKDDEVIVSEVNPSD
G3P_PYRAR       AGTIEDLIKAS-----------DVIIDASPEDVGAENKEKYYSKFDKPVIFQGGEEAEVAEVSFNALANY
G3P_HALSA       GIETAG---------PVDDLDSDVVVDATPSGVGAENRSRYAAHDTPAIYQGGDASVADVSXXXXXXXXX
G3P_HALS3       GIETAG---------PVDDLDSDVVVDATPSGVGAENRSRYAAHDTPAIYQGGDASVADVSXXXXXXXXX


                         +         .         .         .         .         *         .:210
query           YDPANHHILSNASCTTNCVAPMAKTLMENFGIVKGLMTTVHAYTNDQVILDYPHKDLRRARAAAQNIIPT
G3P_STRCO       YDPANHHVISNASCTTNCVAPMAKVLDENFGIVKGLMTTVHAYTNDQRILDFPHKDLRRARAAAENIIPT
G3P_MYCTU       YD-GSQNIISNASCTTNCLAPLAKVLDDEFGIVKGLMTTIHAYTQDQNLQDGPHKDLRRARAAALNIVPT
G3P_MYCBO       YD-GSQNIISNASCTTNCLAPLAKVLDDEFGIVKGLMTTIHAYTQDQNLQDGPHKDLRRARAAALNIVPT
G3P_MYCAV       YD-GSQNIISNASCTTNCLAPLTKVLDDEFGIVRGLMTTIHAYTQDQNLQDGPHKDLRRARAAALNIVPT
G3P_BACST       YDPKAHHVISNASCTTNCLAPFAKVLHEQFGIVRGMMTTVHSYTNDQRILDLPHKDLRRARAAAESIIPT
G3P1_BACSU      YDAANHDVISNASCTTNCLAPFAKVLNDKFGIKRGMMTTVHSYTNDQQILDLPHKDYRRARAAAENIIPT
G3P_CORGL       YDPENHNVISGASCTTNCLAPMAKVLNDKFGIENGLMTTVHAYTGDQRLHDAPHRDLRRARAAAVNIVPT
G3P_AQUAE       YNPKEHNIISNASCTTNCLAPCVKVLNEAFGVEKGYMVTVHAYTNDQRLLDLPHKDFRRARAAAINIVPT
G3P_MYCLE       YD-GSQNIISNASCTTNCLAPLAKVLHDQFGIVKGLMTTVHAYTQDQNLQDGPHSDLXXXXXXXLNVVPT
G3P_STRAE       YDPERHTIISNASCTTNCLGVLAKVLHDAVGIDSGMMTTVHAYTQDQNLQDAPHKDLRRARAAALNIVPT
G3P_BACME       YDAANHNVISNAPCTTNCLAPFAKVLNDKFGLKRGMMTTVHSYTNDQQILDLPHKDYRRARAAAENIIPT
G3P_THEMA       LKP-EHTIISCASCTTNSIAPIVKVLHEKFGIVSGMLTTVHSYTNDQRVLDLPHKDLRRARAAAVNIIPT
G3P1_BACCE      YDAANHNVVSNASCTTNCLAPFAKVLNEKFGVKRGMMTTIHSYTNDQQILDLPHKDLRRARAAAENMIPT
G3P_THEAQ       YDPSRHHIISNASCTTNSLAPVMKVLEEAFGVEKALMTTVHSYTNDQRLLDLPHKDLXXXXXXXXXXXXX
G3P2_SYNY3      YKHEEYEVISNASCTTNCLAPFGKVINDNFGIIKGTMTTTHSYTGDQRILDASHRDLRRARAAAVNIVPT
G3P2_ANASP      YDHNLHNIISNASCTTNCLAPIAKVLNDKFGIIKGSMTTTHSYTGDQRLLDASHRDLRRARAAAINIVPT
G3PA_CHOCR      YSHDKYDIVSNASCTTNCMAPFMKVLDDEFGVVRGMMTTTHSYTGDQRLLDAGHRDLRRARSAALNIVPT
G3PA_GRAVE      YSHDKFDIVSNASCTTNCMAPFMKVLDDEFGVVRGMMTTTHSYTGDQRLLDAGHRDLRRARSAALNIVPT
G3P_STRAU       YDPDLHTIVSNASCTTNALAPLAKVLDDLAGIEHGFMTTVHAYTQEQNLQDGPHRDPXXXXXXXVNIVPT
G3P2_ANAVT      XXXXXXXXXSNASCTTNCLAPIAKVLNDKFGIIKGSMTTTHSYTGDQRLLDASHRDLRRARAAAINIVPT
G3PP_RALEH      LK-ATDTVISNASCTTNCLAPLVKPLHEKLGVVNGLMTTVHSYTNDQVLTDVYHEDLRRARSATMSMIPT
G3PC_RALEH      LK-ATDTVISNASCTTNCLAPLVKPLHEKLGLVNGLMTTVHSYTNDQVLTDVYHEDLRRARSATMSMIPT
G3P_BACCO       YDADAHHVISNASCTTICLAAFARVLHQIFGEVSRMMTTAHSYTNIQRILDATHADLRGARAAAESIIDT
G3PA_SPIOL      YTHADT-IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPT
G3P2_BACSU      FDAERHVIISNASCTTNCLAPVVKVLDEEFGIESGLMTTVHAYTNDQKNIDNPHKDLRRARACGESIIPT
G3P2_RHOSH      LT-ADDLVVSNASCTTNCLSPVAKVLHDAIGIAKGFMTTIHSYTGDQPTLDTMHKDLYRARAAALSMIPT
G3P1_ANAVT      FDPSKDVIVSNASCTTNCLAPIAKVINDNFGLTEGLMTTVHAMTATQPTVDGPKKDWRGGRGAAQNIIPS
G3P1_ANASP      FDPSKDLIVSNASCTTNCLAPIAKVINDNFGLTEGLMTTVHAMTATQPTVDGPKKDWRGGRGAAQNIIPS
G3P_CHLMU       FDPANDVIISNASCTTNCLAPLAKVLLDNFGIEEGLMTTVHAATATQSVVDGPRKDWRGGRGAFQNIIPA
G3P_XANFL       L-TNEHLVVSNASCTTNCLAPVAKVLNDAVGIEKGFMTTIHAYTGDQPTLDTMHKDLYRARAAAMSMIPT
G3P_BORBU       IN-SDLKAVSNASCTTNCLAPLAKVLHESFGIEQGLMTTVHAYTNDQRILDLPHSDLXXXXXXXLSIIPT
G3PB_ARATH      YGHDVANIISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQXXXXXXXXXXXXXXXXXXNIVPT
G3P_CHLPN       FNPEKDFVISNASCTTNCLAPIAKVLLDNFGITEGLMTTVHAATATQLVVDGPKKDWRGGRGCLQNIIPA
G3P_PSEAE       LR-ASHRIVSNASCTTNCLAPVAQVLHRELGIEHGLMTTIHAYTNDQNLSDVYHPDLYRARSATQSMIPT
G3P_CLOPA       LD-GTETVISGASCTTNCLAPMAKVLNDKFGIEKGFMTTIHAYTNDQNTLDGPHRDFRRARAAAVSIIPN
G3P_RALSO       Y--KGEAIISNASCTTNCLAPVAKVLNDKWGIKRGLMTTVHAATATQKTVDGPNKDWRGGRGILENIIPS
G3P_CLOAB       LD-GTETVISGASCTTNCLAPMAKVLNDKFGIEKGFMTTIHAFTNDQNTLDGPHRDLRRARAAAVSIIPN
G3P_PARBA       YRP-DISVLSNASCTTNCLAPLAKVIHDNFGIAEGLMTTIHSYTATQKTVDGPHKDWRGGRTAAQNIIPS
G3P_ZYMMO       DLTADDKIVSNASCTTNCLAPVLHVLQQKIGIVRGLMTTVHSFTNDQRILDQIHSDLRRARTASASMIPT
G3P_STRP3       LD-GTETVISGASCTTNCLAPMAKALHDAFGIQKGLMTTIHAYTGDQMILDGPHXXXXXXXXXXXNIVPN
G3P_NEUCR       YD-GSADVISNASCTTNCLAPLAKVIHDNFTIVEGLMTTVHSYTATQKTVDGPSKDWRGGRTAAQNIIPS
G3P_CHLTR       FDPAD-VIISNASCTTNCLAPLAKVLLDNFGIEEGLMTTVHAATATQSVVDGPRKDWRGGRGAFQNIIPA
G3PB_SPIOL      YGHDVANIISNASCTTNCLAPFVKVLDEELGIVKGTMTTTHSYTGDQXXXXXXXXXXXXXXXXXXNIVPT
G3P_MONAN       Y-TKDITVLSNASCTTNCLAPLAKVINDKFGIVEGLMTTVHSYTATQKVVDGPNKDWRGGRTAAQNIIPS
G3P1_ESCF3      Y--AGQDIVSNASCTTNCLAPLAKVINDNFGIIEGLMXXXXXXXXXXXXXDGPHKDWRGGRGASQNIIPS
G3P_COCPO       Y-KSDIKVLSNASCTTNCLAPLAKVVNDNFGLVEGLMTTVHSYTATQKTVDGPSKDWRGGRTAAQNIIPS
G3P1_SYNY3      YNADTDKIVSNASCTTNCLAPIAKILDDNFGIVEGLMTTVHAMTATQPTVDGPKKDFRGGRGAAQNIIPS
G3P1_SHIFL      Y--AGQDIVSNASCTTNCLAPLAKVINDNFGIIEGLMXXXXXXXXXXXXXDGPHKDWRGGRGASQNIIPS
G3P1_SALTY      YE--GQDIVSNASCTTNCLAPLAKVINDNFGIIEGLMXXXXXXXXXXXXXDGPHKDWRGGRGASQNIIPS
G3P1_SALTI      YE--GQDIVSNASCTTNCLAPLAKVINDNFGIIEGLMXXXXXXXXXXXXXDGPHKDWRGGRGASQNIIPS
G3P1_ECOLI      Y--AGQDIVSNASCTTNCLAPLAKVINDNFGIIEGLMXXXXXXXXXXXXXDGPHKDWRGGRGASQNIIPS
G3P1_ECOL6      Y--AGQDIVSNASCTTNCLAPLAKVINDNFGIIEGLMXXXXXXXXXXXXXDGPHKDWRGGRGASQNIIPS
G3P1_ECO57      Y--AGQDIVSNASCTTNCLAPLAKVINDNFGIIEGLMXXXXXXXXXXXXXDGPHKDWRGGRGASQNIIPS
G3P_AJECA       YDP-SVNVLSNASCTTNCLAPLAKVINDNFGLTEGLMTTIHSYTATQKTVDGPSKDWRGGRTAAQNIIPS
G3P_CANAL       YTP-DLKIISNASCTTNCLAPLAKVVNDTFGIEEGLMTTVHSITATQKTVDGPHKDWRGGRTASGNIIPS
G3P_SORMA       YD-GSANVISNASCTTNCLAPLAKVIHDNFTIVEGLMTTVHSYTATQKTVDGPSKDWRGGRTAAQNIIPS
G3P2_STAEQ      LDIDTYDIFSNASCTTNCIGPVAKVLNDKFGIINGLMTTVHAITNDQKNIDNPHKDLRRARSCNESIIPT
G3P_COCIM       Y-KSDIKVLSNASCTTNCLAPLAKVVNDNFGLVEGLMTTVHSYTATQKTVDGPSKDWRGGRAAAQNIIPS
G3P2_STAES      LDIDTYDIFSNASCTTNCIGPVAKVLNDKFGIINGLMTTVHAITNDQKNIDNPHKDLRRARSCNESIIPT
G3PA_CHLRE      Y-KHEYPIISNASCTTNCLAPFVKVLEQKFGIVKGTMTTTHSYTGDQXXXXXXXXXXXXXXXXXXNIVPT
G3P1_STAES      LD-GSETVVSGASCTTNSLAPVAKVLSDEFGLVEGFMTTIHAYTGDQNTQDAPHRDKXXXXXXXENIIPN
G3P1_STAEQ      LD-GSETVVSGASCTTNSLAPVAKVLSDEFGLVEGFMTTIHAYTGDQNTQDAPHRDKXXXXXXXENIIPN
G3P_PODAN       YD-GKAAVISNASCTTNCLAPLAKVVNDKFGIVEGLMTTVHSYTATQKTVDGPSKDWRGGRGAAQNIIPS
G3P_HALVA       YD--GEDVVSNASCTTNSITPVAKVLDEEFGINAGQLTTVHAYTGSQNLMDGPNGKPRRRRAAAENIIPT
G3P_DEBHA       YTP-DLKIVSNASCTTNCLAPLAKVINDKFGIEEGLMTTVHSITATQKTVDGPHKDWRGGRTASGNIIPS
G3P_PICPA       Y-TSDLNIVSNASCTTNCLAPLAKVVNDTFGIESGLMTTVHSMTATQKTVDGPHKDWRGGRTASGNIIPS
G3P_ASPOR       Y-KTDINVLSNASCTTNCLAPLAKVINDNFGLVEGLMTTVHSYTATQKTVDAPSKDWRGGRTAAQNIIPS
G3P1_GIALA      YDPSTMKVISNASCTTNCLAPLAMVVNKKFGIKEGLMTTVHAVTATQLPVDGPKKDWRGGRSCGANVIPS
G3P_MYCPN       IINAEDKIISAASCTTNCLAPMVHVLEKNFGILHGTMVTVHAYTADQRLQDAPHSDLRRARAAACNIVPT
G3PA_MAIZE      YNP-DEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQXXXXXXXXXXXXXXXXXXNIVPT
G3P_EMENI       Y-KKDIQVLSNASCTTNCLAPLAKVINDNFGIIEGLMTTVHSYTATQKVVDGPSKDWRGGRTAATNIIPS
G3P_CLAPU       YD-GKADVISNASCTTNCLAPLAKVIHDKYTIVEGLMTTVHSYTATQKTVDGPSKDWRGGRGAAQNIIPS
G3PC_CHLRE      YNPATDHIISNASCTTNCLAPLAKVVNSKFGIKEGLMXXXXXXXXXXXXXDGPKKDWRGGRAVNGNIIPS
G3P_STRPY       LD-GTETVISGASCTTNCLAPMAKALHDAFGIQKGLMTTIHAYTGDQMILDGPHXXXXXXXXXXXNIVPN
G3P_STRP8       LD-GTETVISGASCTTNCLAPMAKALHDAFGIQKGLMTTIHAYTGDQMILDGPHXXXXXXXXXXXNIVPN
G3P_STRP6       LD-GTETVISGASCTTNCLAPMAKALHDAFGIQKGLMTTIHAYTGDQMILDGPHXXXXXXXXXXXNIVPN
G3P_STRP1       LD-GTETVISGASCTTNCLAPMAKALHDAFGIQKGLMTTIHAYTGDQMILDGPHXXXXXXXXXXXNIVPN
G3P_COLGL       YD-GSADVISNASCTTNCLAPLAKVINDKFGIVEGLMTTVHSYTATQKTVHGPSKDWRGGRTAAQNIIPS
G3PG_CRIFA      YNPATHHVVSNASCTTNCLAPIVHVLKENFGIETGLMTTIHSYTATQKTVDVSIKDWRGGRAAAVNIIPS
G3P_COLLN       YD--GSAVISQASCTTNCLAPLAKVINDKYTIIEGLMTTVHSYTATQKTVDGPSKDWRGGRTAAQNIIPS
G3PG_TRYCR      YNPSEHHVVSNASCTTNCLAPIVHVLVEGFGVQTGLMTTIHSYTATQKTVDVSVKDWRGGRAAAVNIIPS
G3P1_KLULA      YN--GETIVSNASCTTNCLAPIAKIINDEFGIDEALMTTVHSITATQKTVDGPHKDWRGGRTASGNIIPS
G3P_ASHGO       Y--AGETIVSNASCTTNCLAPLAKVIDEQFGIEEGLMTTVHSLTATQKTVDGPSKDWRGGRTASGNIIPS
G3PA_ARATH      YS-HDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQXXXXXXXXXXXXXXXXXXNIVPT
G3P1_STAAW      LD-GSETVVSGASCTTNSLAPVAKVLNDDFGLVEGLMTTIHAYTGDQNTQDAPHRDKXXXXXXXENIIPN
G3P1_STAAU      LD-GSETVVSGASCTTNSLAPVAKVLNDDFGLVEGLMTTIHAYTGDQNTQDAPHRDKXXXXXXXENIIPN
G3P1_STAAS      LD-GSETVVSGASCTTNSLAPVAKVLNDDFGLVEGLMTTIHAYTGDQNTQDAPHRDKXXXXXXXENIIPN
G3P1_STAAR      LD-GSETVVSGASCTTNSLAPVAKVLNDDFGLVEGLMTTIHAYTGDQNTQDAPHRDKXXXXXXXENIIPN
G3P1_STAAN      LD-GSETVVSGASCTTNSLAPVAKVLNDDFGLVEGLMTTIHAYTGDQNTQDAPHRDKXXXXXXXENIIPN
G3P1_STAAM      LD-GSETVVSGASCTTNSLAPVAKVLNDDFGLVEGLMTTIHAYTGDQNTQDAPHRDKXXXXXXXENIIPN
G3P1_STAAC      LD-GSETVVSGASCTTNSLAPVAKVLNDDFGLVEGLMTTIHAYTGDQNTQDAPHRDKXXXXXXXENIIPN
G3P_BACFR       Y--AGQDIISNASCTTNCLAPIAKVLNDKFGIVKGLMTTVHAATATQKTVDGPKKDWRGGRGILENIIPS
G3PC_TRYBB      Y--KGEAIVSNASCTTNCLAPLAKVLNDKFGIVEGLMXXXXXXXXXXXXXDGPQKDWRGGRGAAQNIIPS
G3P1_YEAST      YTP-DKKIVSNASCTTNCLAPLAKVINDAFGIEEGLMTTVHSMTATQKTVDGPHKDWRGGRTASGNIIPS
G3PG_LEIME      YSPASHHVVSNASCTTNCLAPIVHVLKENFGIETGLMTTIHSYTATQKTVDVSLKDWRGGRAAAVNIIPS
G3P2_KLULA      YN--GETIVSNASCTTNCLAPLAKVVNNAFGIEEGLMSTIHSITATQKTVDGPQKDWRGGRTASGNIIPS
G3P3_YEAST      Y-TSDLKIVSNASCTTNCLAPLAKVINDAFGIEEGLMTTVHSLTATQKTVDGPHKDWRGGRTASGNIIPS
G3P2_TRIKO      YD-GSADVISNASCTTNCLAPLAKVINDNYGIVEGLMTTVHSYTATQKTVDGPSKDWRGGRGAAQNIIPS
G3P2_KLUMA      Y--AGQTIVSNASCTTNCLAPLAKIINNAFGIEEGLMTTVHSITATQKTVDGPHKDWRGGRTASGNIIPS
G3P1_CAEEL      YDASNDHVVSNASCTTNCLAPLAKVINDNFGIIEGLMTTVHAVTATQKTVDGPSGKLRDGRGAGQNIIPA
G3PB_PEA        YGHEVADIISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQXXXXXXXXXXXXXXXXXXNIVPT
G3P1_TRIKO      YAGAN--VISNASCTTNCLAPLAKTLNDKFTIVEGLMTAIHAYTASQKTVDGPSKDWRGGRAAAQNLIPS
G3P1_KLUMA      YN--GEKIVSNASCTTNCLAPIAKIINDEFGIEEGLMTTVHSITATQKTVDGPHKDWRGGRTASGNIIPS
G3P_STREQ       ILDGTETVISGASCTTNCLAPMAKALHDAFGIQKGLMTTIHAYTGDQMIVDXXXXXXXXXXXXXXNIVPN
G3P4_CAEEL      YDASNDHVISNASCTTNCLAPLAKVINDNFGIIEGLMTTVHAVTATQKTVDGPSGKLRDGRGAGQNIIPA
G3P3_KLUMA      Y--AGQTIVSNASCTTNCLAPLAKIINNAFGIEEGLMTTVHSITATQKTVDGPHKDWRGGRTASGNIIPS
G3P_CRIGR       YD-NSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLRDGRGAAQNIIPA
G3P2_YEAST      Y-TSDLKIVSNASCTTNCLAPLAKVINDAFGIEEGLMTTVHSMTATQKTVDGPHKDWRGGRTASGNIIPS
G3P2_CANGA      YT-SDLKIVSNASCTTNCLAPLAKVIDEAFGIEEGLMTTVHSLTATQKTVDGPHKDWRGGRTASGNIIPS
G3P_ZYGRO       YTP-DQKIVSNASCTTNCLAPLAKVIHNEFGIKEGLMTTVHSMTATQKTVDGPHKDWRGGRTASGNIIPS
G3PB_TOBAC      YSHEVADIISNASCTTNCLAPFVKVMDEELGIVKGTMTTTHSYTGDQXXXXXXXXXXXXXXXXXXNIVPT
G3P_COTJA       YD-KSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLRDGRGAAQNIIPA
G3P3_CAEEL      YDHANDHIISNASCTTNCLAPLAKVINDNFGIIEGLMTTVHAVTATQKTVDGPSGKLRDGRGAGQNIIPA
G3P3_ANAVT      YEPEKHHLLTAASCTTNCLAPVVKVIHEGLGIKHGIITTIHDNTNTQTLVDAPHKDLRRARATSLSLIPT
G3P2_CAEEL      YDHANDHIISNASCTTNCLAPLAKVINDNFGIIEGLMTTVHAVTATQKTVDGPSGKLRDGRGAGQNIIPA
G3P3_CAEBR      YDHANDHIISNASCTTNCLAPLAKVINDNFGIIEGLMTTVHAVTATQKTVDGPSGKLRDGRGAGQNIIPA
G3PG_TRYBB      YNPREQHVVSNASCTTNCLAPLVHVLVEGFGISTGLMTTVHSYTATQKTVDVSVKDWRGGRAAALNIIPS
G3P2_CAEBR      YDHANDHIISNASCTTNCLAPLAKVINDNFGIIEGLMTTVHAVTATQKTVDGPSGKLRDGRGAGQNIIPA
G3P2_AGABI      YNPKD-TIISNASCTTNCLATLAKVIHDNFGIVEGLMXXXXXXXXXXXXXDGPHKDWRGGRGVGNNIIPS
G3P1_CANGA      Y-TSDVTVISNASCTTNCLAPLAKVLQDNFGIEEALMSTVHSQTATQKTVDGPKKDWRGGRTASANIIPS
G3PA_PEA        YTHAD-DIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQXXXXXXXXXXXXXXXXXXNIVPT
G3P3_ANASP      YEPEKHHLLTAASCTTNCLAPVVKVIHEGLGIKHGIITTIHDNTNTQTLVDAPHKDLRRARATSLSLIPT
G3P_CRYPA       YDGSGM-VISNASCTTNCLAPLAKVINDEFKIIEGLMTTVHSYTATQKTVDGPSKDWRGGRTAAQNIIPS
G3PT_MACFA      YNPGSMNIVSNASCTTNCLAPLAKVIHERFGIVEGLMTTVHSYTATQKTVDGPSKKARDGRGAHQNIIPA
G3P_MUSPF       YD-NSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLRDGRGAAQNIIPA
G3P_COLLI       YD-KSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLRDGRGAAQNIIPA
G3P_CHICK       YD-KSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLRDGRGAAQNIIPA
G3P_SPECI       YD-NSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLRDGRGAAQNIIPA
G3P_PICCI       YTP-DLNIISNASCTTNCLAPLAKIINNKFGIEEGLMTTVHSITATQKTVDGPHKDWRSGPTASGNIIPS
E4PD_PSEHT      LKP-EHTIVSNGSCTTNCVVPVIKVLDDAFGIESGAITTIHASMNDQPVIDAYHHDLRRTRAASQSIIPV
G3P_RAT         YD-NSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLRDGRGAAQNIIPA
G3P_MOUSE       YD-NSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLRDGRGAAQNIIPA
G3P_ASPNG       Y-TKDINVLSNASCTTNCLAPLAKVINDKFGIVEGLMTTVHSYTATQKVVDAPSKDWRGGRTAAQNIIPS
G3P_TRISI       YD-NSLKVVSNASCTTNCLAPLAKVIHDNYGMVEGLMTTVHAITATQKTVDGPSGKLRDGRGAAQNIIPA
G3P_CANFA       YD-NSLKIVSNASCTTNCLAPLAKVIHDHFGIVEGLMTTVHAITATQKTVDGPSKMWRDGRGAAQNIIPA
G3PT_DANRE      YDPSSMTIVSNASCTTNCLAPLAKVIHDNFGIEEALMTTVHAYTATQKTVDGPSKAWRDGRGAHQNIIPA
G3P_PICAN       YTP-DIKILSNASCTTNCLAPLAKVINDIFGIEEGLMTTVHSITATQKTVDGPHKDWRGGRTASGNIIPS
G3PA_TOBAC      YNP-DEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQXXXXXXXXXXXXXXXXXXNIVPT
G3P1_RHIRA      Y-KSEYKVISNASCTTNCLAPLAKVINDNFGIADGLMXXXXXXXXXXXXXDGPHKDWRGGRAAAANIIPS
G3P_RABIT       YD-NSLKIVSNASCTTNCLAPLAKVIHDHFGIVEGLMTTVHAITATQKTVDGPSGKLRDGRGAAQNIIPA
G3P_FELCA       YD-NSLKIVSNASCTTNCLAPLAKVIHDHFGIVEGLMTTVHAITATQKTVDGPSGKLRDGRGAAQNIIPA
G3PC_PINSY      YK-SDVNIVSNASCTTNCLAPLAKVINDKFGIVEGLMTTVHSITATQKTVDGPNKDWRGGRGAGFNIIPS
G3PT_MOUSE      YNPGSMTIVSNASCTTNCLAPLAKVIHENFGIVEGLMTTVHSYTATQKTVDGPKKDWRGGRGAHQNIIPS
G3P_PIG         YD-NSLKIVSNASCTTNCLAPLAKVIHDHFGIVEGLMTTVHAITATQKTVDGPSGKLRDGRGAAQNIIPA
G3P_YARLI       YKP-DMTVISNASCTTNCLAPLAKVVNDKYGIIEGLMTTVHSITATQKTVDGPHKDWRGGRTASGNIIPS
G3P_ONCVO       YDKANNHIISNASCTTNCLAPLAKVIHDKFGIIEGLMXXXXXXXXXXXXXDGPSGKLRDGRGAGQNIIPA
G3P_BOVIN       YN-NTLKIVSNASCTTNCLAPLAKVIHDHFGIVEGLMTTVHAITATQKTVDGPSGKLRDGRGAAQNIIPA
G3P_PONAB       YD-NSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLRDGRGALQNIIPA
G3P_HUMAN       YD-NSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLRDGRGALQNIIPA
G3PT_HUMAN      YNPGSMNIVSNASCTTNCLAPLAKVIHERFGIVEGLMTTVHSYTATQKTVDGPRKAWRDGRGAHQNIIPA
G3P_OMPOL       YDPRRPSI-SNASCTTNCLAPLAKVIHDKFGIVEGLMSTIHATTATQKTVDGPNKDWRGGRSVNNNIIPS
G3P_PHANO       YTK-DIEVLSNASCTTNCLAPLAKVIHDKFTIIEGLMTTVHSYTATQKVVDGPSKDWRGGRTAAQNIIPS
G3P_HOMAM       YSK-DMTVVSNASCTTNCLAPVAKVLHENFEIVEGLMTTVHAVTATQKTVDGPSKDWRGGRGAAQNIIPS
G3PC_GRAVE      YTP-DLNVISNASCTTNCLAPLVKVIHEKYGIEEGLMXXXXXXXXXXXXXDGPQKDWRGGRGAGANIIPS
G3P_COCHE       YKP-DIEALSNASCTTNCLAPLAKVIHDKYTIIEGLMTTIHSYTATQKVVDGPSKDWRGGRTAAQNIIPS
G3P_TRIAT       YD-GTPTVLSNASCTTNGLAPLVKIVNDNFGIVEGLMTTVHSYTATQKTVDGPSKDWRGGRGAAQNIIPS
G3PT_BOVIN      YNPSSMKIVSNASCTTNCLAPLAKVIHERFGILEGLMTTVHSYTATQKTVDGPSKKARDGRGAHQNIIPA
G3P3_ECOLI      LD-GNDTIVSVASCTTNCLAPMAKALHDSFGIEVGTMTTIHAYTGTQSLVDGPRKDLRASRAAAENIIPH
G3P2_RHIRA      Y-TSDLKVISNASCTTNCLAPLAKVINDNFGIVEGLMXXXXXXXXXXXXXDGPNKDWRGGRGAGANIIPS
G3PC_LEIME      Y--KGQPIISNASCTTNCLAPLAKVVNEKYGIVEGLMXXXXXXXXXXXXXDGPSKDWRGGRGASQNIIPS
G3P3_ECO57      LD-GNDTIVSVASCTTNCLAPMAKALHDSFGIEVGTMTTIHAYTGTQSLVDGPRKDLRASRAAAENIIPH
G3P_MYCGE       TXXXXXXXXXXXXCTTNCLAPLVHVLEKNFGIVYGTMLTVHAYTADQRLQDAPHNDLRRARAAAVNIVPT
G3P_CURLU       YK-SDIEVLSNSSCTTNCLAPLAKVIHDKYTIIEGLMTTIHSYTATQKVVDGPSKDWRGGRTAAQNIIPS
G3PC_RANAC      YK-SDIDIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHAMTATQKTVDGPSKDWRGGRAASFN