[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ56054.1

[Show Plain Result]


## Summary of Sequence Search
    1::656
    1::656       0.0 100%  656 aa  UVRC_THEFY RecName: Full=UvrABC system protein C;       
    6::666       0.0  65%  693 aa  UVRC_BEUC1 RecName: Full=UvrABC system protein C;       
    8::630       0.0  62%  681 aa  UVRC_STRAW RecName: Full=UvrABC system protein C;       
    8::640       0.0  62%  655 aa  UVRC_RENSM RecName: Full=UvrABC system protein C;       
    8::652       0.0  63%  674 aa  UVRC_ARTCA RecName: Full=UvrABC system protein C;       
    8::673       0.0  65%  728 aa  UVRC_STRCO RecName: Full=UvrABC system protein C;       
    6::670       0.0  63%  673 aa  UVRC_NOCFA RecName: Full=UvrABC system protein C;       
    6::645       0.0  63%  647 aa  UVRC_MYCPA RecName: Full=UvrABC system protein C;       
    8::673       0.0  63%  692 aa  UVRC_FRASN RecName: Full=UvrABC system protein C;       
    6::643       0.0  59%  646 aa  UVRC_MYCTU RecName: Full=UvrABC system protein C;       
    6::643       0.0  59%  646 aa  UVRC_MYCTA RecName: Full=UvrABC system protein C;       
    6::643       0.0  59%  646 aa  UVRC_MYCBT RecName: Full=UvrABC system protein C;       
    6::643       0.0  59%  646 aa  UVRC_MYCBP RecName: Full=UvrABC system protein C;       
    6::643       0.0  59%  646 aa  UVRC_MYCBO RecName: Full=UvrABC system protein C;       
    8::647       0.0  58%  672 aa  UVRC_PROAC RecName: Full=UvrABC system protein C;       
    8::664       0.0  60%  665 aa  UVRC_SALTO RecName: Full=UvrABC system protein C;       
    4::636       0.0  60%  641 aa  UVRC_ACIC1 RecName: Full=UvrABC system protein C;       
    8::654       0.0  61%  660 aa  UVRC_SALAI RecName: Full=UvrABC system protein C;       
    8::687       0.0  64%  705 aa  UVRC_FRASC RecName: Full=UvrABC system protein C;       
    6::677       0.0  58%  681 aa  UVRC_COREF RecName: Full=UvrABC system protein C;       
    6::644       0.0  58%  671 aa  UVRC_MYCA9 RecName: Full=UvrABC system protein C;       
    6::647       0.0  59%  647 aa  UVRC_MYCLE RecName: Full=UvrABC system protein C;       
    6::647       0.0  59%  647 aa  UVRC_MYCLB RecName: Full=UvrABC system protein C;       
    6::644       0.0  60%  647 aa  UVRC_MYCMM RecName: Full=UvrABC system protein C;       
    8::667       0.0  59%  671 aa  UVRC_ARTAT RecName: Full=UvrABC system protein C;       
    6::644       0.0  59%  678 aa  UVRC_MYCGI RecName: Full=UvrABC system protein C;       
    8::647       0.0  60%  669 aa  UVRC_ARTS2 RecName: Full=UvrABC system protein C;       
    6::655       0.0  58%  730 aa  UVRC_RHOE4 RecName: Full=UvrABC system protein C;       
    6::650       0.0  59%  676 aa  UVRC_MYCSS RecName: Full=UvrABC system protein C;       
    6::650       0.0  59%  676 aa  UVRC_MYCSK RecName: Full=UvrABC system protein C;       
    6::650       0.0  59%  676 aa  UVRC_MYCSJ RecName: Full=UvrABC system protein C;       
    6::715       0.0  59%  717 aa  UVRC_SACEN RecName: Full=UvrABC system protein C;       
    8::678       0.0  56%  689 aa  UVRC_KOCRD RecName: Full=UvrABC system protein C;       
    7::689       0.0  56%  690 aa  UVRC_CORJK RecName: Full=UvrABC system protein C;       
    6::677       0.0  58%  727 aa  UVRC_RHOSR RecName: Full=UvrABC system protein C;       
    6::693       0.0  58%  743 aa  UVRC_RHOOB RecName: Full=UvrABC system protein C;       
    6::674       0.0  58%  678 aa  UVRC_MYCVP RecName: Full=UvrABC system protein C;       
    6::677       0.0  54%  687 aa  UVRC_CORDI RecName: Full=UvrABC system protein C;       
    6::666       0.0  55%  706 aa  UVRC_MYCS2 RecName: Full=UvrABC system protein C;       
    8::681       0.0  56%  684 aa  UVRC_CORA7 RecName: Full=UvrABC system protein C;       
    6::692       0.0  53%  696 aa  UVRC_CORGB RecName: Full=UvrABC system protein C;       
    6::692       0.0  53%  696 aa  UVRC_CORGL RecName: Full=UvrABC system protein C;       
    8::653     e-178  54%  656 aa  UVRC_LEIXX RecName: Full=UvrABC system protein C;       
    6::743     e-158  50%  746 aa  UVRC_BIFLO RecName: Full=UvrABC system protein C;       
    6::743     e-158  50%  746 aa  UVRC_BIFLD RecName: Full=UvrABC system protein C;       
    8::686     e-152  63%  717 aa  UVRC_STRGG RecName: Full=UvrABC system protein C;       
   10::624     e-125  42%  629 aa  UVRC_SYMTH RecName: Full=UvrABC system protein C;       
    4::619     e-117  37%  621 aa  UVRC_ALKOO RecName: Full=UvrABC system protein C;       
    5::607     e-114  39%  607 aa  UVRC_DEHE1 RecName: Full=UvrABC system protein C;       
    2::604     e-112  41%  607 aa  UVRC_CARHZ RecName: Full=UvrABC system protein C;       
   10::613     e-112  36%  623 aa  UVRC_CLOAB RecName: Full=UvrABC system protein C;       
   11::615     e-111  37%  622 aa  UVRC_CLOTE RecName: Full=UvrABC system protein C;       
    5::607     e-111  38%  607 aa  UVRC_DEHSC RecName: Full=UvrABC system protein C;       
    5::607     e-111  38%  607 aa  UVRC_DEHSB RecName: Full=UvrABC system protein C;       
   11::616     e-111  39%  622 aa  UVRC_ALKMQ RecName: Full=UvrABC system protein C;       
   11::619     e-111  36%  625 aa  UVRC_CLOTH RecName: Full=UvrABC system protein C;       
    4::599     e-110  42%  607 aa  UVRC_TROW8 RecName: Full=UvrABC system protein C;       
    4::599     e-110  42%  607 aa  UVRC_TROWT RecName: Full=UvrABC system protein C;       
   11::609     e-110  39%  612 aa  UVRC_EUBE2 RecName: Full=UvrABC system protein C;       
   11::620     e-109  39%  620 aa  UVRC_CLOPS RecName: Full=UvrABC system protein C;       
    3::609     e-109  43%  613 aa  UVRC_MOOTA RecName: Full=UvrABC system protein C;       
   11::620     e-109  39%  620 aa  UVRC_CLOP1 RecName: Full=UvrABC system protein C;       
   11::620     e-108  39%  620 aa  UVRC_CLOPE RecName: Full=UvrABC system protein C;       
   19::607     e-108  41%  628 aa  UVRC_GLOVI RecName: Full=UvrABC system protein C;       
   11::613     e-107  36%  622 aa  UVRC_CLOK5 RecName: Full=UvrABC system protein C;       
   10::595     e-107  39%  616 aa  UVRC_GEMAT RecName: Full=UvrABC system protein C;       
   11::610     e-106  36%  613 aa  UVRC_CLOCE RecName: Full=UvrABC system protein C;       
    7::609     e-106  44%  611 aa  UVRC_RUBXD RecName: Full=UvrABC system protein C;       
    6::595     e-104  37%  601 aa  UVRC_SYNWW RecName: Full=UvrABC system protein C;       
   11::615     e-104  35%  621 aa  UVRC_CLOB8 RecName: Full=UvrABC system protein C;       
    1::592     e-104  39%  604 aa  UVRC_METBU RecName: Full=UvrABC system protein C;       
   15::611     e-104  36%  617 aa  UVRC_THETN RecName: Full=UvrABC system protein C;       
    9::623     e-103  41%  623 aa  UVRC_SYNJB RecName: Full=UvrABC system protein C;       
   24::619     e-103  38%  625 aa  UVRC_MICAN RecName: Full=UvrABC system protein C;       
   15::583     e-102  39%  616 aa  UVRC_PROA2 RecName: Full=UvrABC system protein C;       
    4::601     e-102  37%  603 aa  UVRC_DESAA RecName: Full=UvrABC system protein C;       
   23::620     e-102  40%  624 aa  UVRC_CYAP4 RecName: Full=UvrABC system protein C;       
   16::604     e-102  43%  611 aa  UVRC_ALHEH RecName: Full=UvrABC system protein C;       
   22::607     e-102  39%  613 aa  UVRC_THICR RecName: Full=UvrABC system protein C;       
   17::603     e-102  42%  607 aa  UVRC_ALCBS RecName: Full=UvrABC system protein C;       
   19::605     e-101  41%  621 aa  UVRC_SYNJA RecName: Full=UvrABC system protein C;       
   29::618     e-101  43%  623 aa  UVRC_RHOS4 RecName: Full=UvrABC system protein C;       
   11::617     e-100  41%  626 aa  UVRC_CHLTE RecName: Full=UvrABC system protein C;       
   18::606     e-100  39%  607 aa  UVRC_PSEMY RecName: Full=UvrABC system protein C;       
   17::620     1e-99  37%  625 aa  UVRC_NOSP7 RecName: Full=UvrABC system protein C;       
    7::615     2e-99  42%  628 aa  UVRC_PELLD RecName: Full=UvrABC system protein C;       
    3::589     2e-99  38%  610 aa  UVRC_ACIBL RecName: Full=UvrABC system protein C;       
   13::622     4e-99  37%  629 aa  UVRC_CHLCH RecName: Full=UvrABC system protein C;       
    2::611     5e-99  37%  615 aa  UVRC_THEP3 RecName: Full=UvrABC system protein C;       
   18::607     9e-99  39%  608 aa  UVRC_PSEA7 RecName: Full=UvrABC system protein C;       
    2::611     1e-98  37%  615 aa  UVRC_THEPX RecName: Full=UvrABC system protein C;       
   11::606     1e-98  40%  614 aa  UVRC_DESAP RecName: Full=UvrABC system protein C;       
   16::598     3e-98  39%  599 aa  UVRC_METFK RecName: Full=UvrABC system protein C;       
    9::611     3e-98  42%  614 aa  UVRC_GEOMG RecName: Full=UvrABC system protein C;       
   18::607     4e-98  39%  608 aa  UVRC_PSEAE RecName: Full=UvrABC system protein C;       
   18::607     6e-98  39%  608 aa  UVRC_PSEAB RecName: Full=UvrABC system protein C;       
   18::607     6e-98  39%  608 aa  UVRC_PSEA8 RecName: Full=UvrABC system protein C;       
   14::603     1e-97  41%  618 aa  UVRC_SYNAS RecName: Full=UvrABC system protein C;       
   24::618     1e-97  41%  624 aa  UVRC_MAGSA RecName: Full=UvrABC system protein C;       
   11::627     1e-97  36%  628 aa  UVRC_CLOPH RecName: Full=UvrABC system protein C;       
   17::595     1e-97  38%  599 aa  UVRC_NITOC RecName: Full=UvrABC system protein C;       
    6::592     1e-97  37%  598 aa  UVRC_METST RecName: Full=UvrABC system protein C;       
   17::620     2e-97  37%  627 aa  UVRC_ANASP RecName: Full=UvrABC system protein C;       
   13::608     3e-97  38%  610 aa  UVRC_YERPS RecName: Full=UvrABC system protein C;       
   14::598     4e-97  39%  627 aa  UVRC_PELPB RecName: Full=UvrABC system protein C;       
    9::609     4e-97  40%  613 aa  UVRC_GEOSL RecName: Full=UvrABC system protein C;       
   13::608     5e-97  38%  610 aa  UVRC_YERE8 RecName: Full=UvrABC system protein C;       
   11::615     6e-97  34%  621 aa  UVRC_CLONN RecName: Full=UvrABC system protein C;       
   10::615     6e-97  34%  618 aa  UVRC_CLOBM RecName: Full=UvrABC system protein C;       
   13::608     8e-97  38%  610 aa  UVRC_YERPN RecName: Full=UvrABC system protein C;       
   13::608     8e-97  38%  610 aa  UVRC_YERPE RecName: Full=UvrABC system protein C;       
   13::608     8e-97  38%  610 aa  UVRC_YERPA RecName: Full=UvrABC system protein C;       
   13::608     8e-97  38%  610 aa  UVRC_YERP3 RecName: Full=UvrABC system protein C;       
   18::606     1e-96  37%  607 aa  UVRC_PSEFS RecName: Full=UvrABC system protein C;       
   37::642     1e-96  36%  645 aa  UVRC_GLUOX RecName: Full=UvrABC system protein C;       
   10::615     1e-96  34%  618 aa  UVRC_CLOBK RecName: Full=UvrABC system protein C;       
   18::606     1e-96  41%  607 aa  UVRC_AZOVD RecName: Full=UvrABC system protein C;       
   18::606     2e-96  38%  607 aa  UVRC_PSE14 RecName: Full=UvrABC system protein C;       
   10::615     2e-96  34%  618 aa  UVRC_CLOBL RecName: Full=UvrABC system protein C;       
   10::615     2e-96  34%  618 aa  UVRC_CLOBJ RecName: Full=UvrABC system protein C;       
    9::618     2e-96  37%  630 aa  UVRC_BDEBA RecName: Full=UvrABC system protein C;       
   18::606     2e-96  38%  607 aa  UVRC_PSEU2 RecName: Full=UvrABC system protein C;       
   18::606     2e-96  38%  607 aa  UVRC_PSEE4 RecName: Full=UvrABC system protein C;       
   21::603     2e-96  38%  610 aa  UVRC_METCA RecName: Full=UvrABC system protein C;       
   13::605     3e-96  39%  610 aa  UVRC_SALHS RecName: Full=UvrABC system protein C;       
   10::615     4e-96  34%  618 aa  UVRC_CLOBH RecName: Full=UvrABC system protein C;       
   10::615     4e-96  34%  618 aa  UVRC_CLOB1 RecName: Full=UvrABC system protein C;       
   23::611     5e-96  39%  612 aa  UVRC_SACD2 RecName: Full=UvrABC system protein C;       
   13::608     5e-96  38%  610 aa  UVRC_CITK8 RecName: Full=UvrABC system protein C;       
    5::648     5e-96  41%  707 aa  UVRC_ANASK RecName: Full=UvrABC system protein C;       
   13::605     9e-96  39%  610 aa  UVRC_ESCF3 RecName: Full=UvrABC system protein C;       
    5::648     9e-96  42%  707 aa  UVRC_ANADE RecName: Full=UvrABC system protein C;       
   13::608     1e-95  38%  610 aa  UVRC_ERWCT RecName: Full=UvrABC system protein C;       
   17::603     1e-95  38%  607 aa  UVRC_DICNV RecName: Full=UvrABC system protein C;       
   10::615     1e-95  34%  618 aa  UVRC_CLOB6 RecName: Full=UvrABC system protein C;       
   13::605     2e-95  39%  610 aa  UVRC_SALPK RecName: Full=UvrABC system protein C;       
   13::605     2e-95  39%  610 aa  UVRC_SALPA RecName: Full=UvrABC system protein C;       
   12::601     2e-95  39%  610 aa  UVRC_PARUW RecName: Full=UvrABC system protein C;       
   13::605     2e-95  39%  610 aa  UVRC_SALTY RecName: Full=UvrABC system protein C;       
   13::605     2e-95  39%  610 aa  UVRC_SALTI RecName: Full=UvrABC system protein C;       
   13::605     2e-95  39%  610 aa  UVRC_SALPB RecName: Full=UvrABC system protein C;       
   18::606     2e-95  37%  607 aa  UVRC_PSEPF RecName: Full=UvrABC system protein C;       
   19::629     3e-95  35%  651 aa  UVRC_SYNS3 RecName: Full=UvrABC system protein C;       
   13::605     3e-95  39%  610 aa  UVRC_SALNS RecName: Full=UvrABC system protein C;       
   13::605     3e-95  39%  610 aa  UVRC_SALG2 RecName: Full=UvrABC system protein C;       
   15::617     5e-95  38%  633 aa  UVRC_SALRD RecName: Full=UvrABC system protein C;       
   13::605     5e-95  39%  610 aa  UVRC_SALEP RecName: Full=UvrABC system protein C;       
   13::605     5e-95  39%  610 aa  UVRC_SALDC RecName: Full=UvrABC system protein C;       
   13::605     5e-95  38%  610 aa  UVRC_SALA4 RecName: Full=UvrABC system protein C;       
   18::606     5e-95  37%  607 aa  UVRC_PSEP1 RecName: Full=UvrABC system protein C;       
   21::609     5e-95  37%  609 aa  UVRC_LEPBL RecName: Full=UvrABC system protein C;       
   21::609     5e-95  37%  609 aa  UVRC_LEPBJ RecName: Full=UvrABC system protein C;       
   11::600     5e-95  38%  607 aa  UVRC_DESPS RecName: Full=UvrABC system protein C;       
    5::648     5e-95  43%  707 aa  UVRC_ANAD2 RecName: Full=UvrABC system protein C;       
   13::605     6e-95  38%  610 aa  UVRC_SALSV RecName: Full=UvrABC system protein C;       
   13::605     6e-95  38%  610 aa  UVRC_SALPC RecName: Full=UvrABC system protein C;       
   13::605     6e-95  38%  610 aa  UVRC_SALCH RecName: Full=UvrABC system protein C;       
   18::606     1e-94  37%  607 aa  UVRC_PSEPK RecName: Full=UvrABC system protein C;       
   17::614     1e-94  38%  618 aa  UVRC_LEGPL RecName: Full=UvrABC system protein C;       
   40::634     1e-94  40%  644 aa  UVRC_GRABC RecName: Full=UvrABC system protein C;       
   20::631     1e-94  36%  631 aa  UVRC_CHLPD RecName: Full=UvrABC system protein C;       
    3::602     1e-94  39%  604 aa  UVRC_GEOLS RecName: Full=UvrABC system protein C;       
   13::605     1e-94  38%  610 aa  UVRC_ECO45 RecName: Full=UvrABC system protein C;       
   17::620     1e-94  38%  627 aa  UVRC_ANAVT RecName: Full=UvrABC system protein C;       
   31::625     2e-94  39%  631 aa  UVRC_JANSC RecName: Full=UvrABC system protein C;       
   18::606     2e-94  37%  607 aa  UVRC_PSEPW RecName: Full=UvrABC system protein C;       
    1::630     2e-94  33%  640 aa  UVRC_PROMT RecName: Full=UvrABC system protein C;       
   20::630     2e-94  33%  640 aa  UVRC_PROM1 RecName: Full=UvrABC system protein C;       
   30::618     3e-94  41%  623 aa  UVRC_SILPO RecName: Full=UvrABC system protein C;       
   17::614     3e-94  38%  618 aa  UVRC_LEGPA RecName: Full=UvrABC system protein C;       
   32::650     4e-94  34%  656 aa  UVRC_PROMP RecName: Full=UvrABC system protein C;       
   41::652     4e-94  36%  667 aa  UVRC_PROMM RecName: Full=UvrABC system protein C;       
   17::614     4e-94  38%  618 aa  UVRC_LEGPH RecName: Full=UvrABC system protein C;       
   13::605     4e-94  38%  610 aa  UVRC_ECOK1 RecName: Full=UvrABC system protein C;       
   22::619     5e-94  37%  622 aa  UVRC_TRIEI RecName: Full=UvrABC system protein C;       
   42::646     5e-94  37%  653 aa  UVRC_MESSB RecName: Full=UvrABC system protein C;       
   13::605     5e-94  38%  610 aa  UVRC_ECOUT RecName: Full=UvrABC system protein C;       
   13::605     5e-94  38%  610 aa  UVRC_ECOSM RecName: Full=UvrABC system protein C;       
   13::608     7e-94  37%  610 aa  UVRC_SODGM RecName: Full=UvrABC system protein C;       
   13::605     7e-94  38%  610 aa  UVRC_SHISS RecName: Full=UvrABC system protein C;       
   13::605     7e-94  38%  610 aa  UVRC_SHIB3 RecName: Full=UvrABC system protein C;       
   13::605     7e-94  38%  610 aa  UVRC_ECOSE RecName: Full=UvrABC system protein C;       
   13::605     7e-94  38%  610 aa  UVRC_ECOLU RecName: Full=UvrABC system protein C;       
   13::605     7e-94  38%  610 aa  UVRC_ECOLI RecName: Full=UvrABC system protein C;       
   13::605     7e-94  38%  610 aa  UVRC_ECOLC RecName: Full=UvrABC system protein C;       
   13::605     7e-94  38%  610 aa  UVRC_ECOL6 RecName: Full=UvrABC system protein C;       
   13::605     7e-94  38%  610 aa  UVRC_ECOHS RecName: Full=UvrABC system protein C;       
   13::605     7e-94  38%  610 aa  UVRC_ECODH RecName: Full=UvrABC system protein C;       
   13::605     7e-94  38%  610 aa  UVRC_ECOBW RecName: Full=UvrABC system protein C;       
   13::605     7e-94  38%  610 aa  UVRC_ECO8A RecName: Full=UvrABC system protein C;       
   13::605     7e-94  38%  610 aa  UVRC_ECO81 RecName: Full=UvrABC system protein C;       
   13::605     7e-94  38%  610 aa  UVRC_ECO7I RecName: Full=UvrABC system protein C;       
   13::605     7e-94  38%  610 aa  UVRC_ECO5E RecName: Full=UvrABC system protein C;       
   13::605     7e-94  38%  610 aa  UVRC_ECO57 RecName: Full=UvrABC system protein C;       
   13::605     7e-94  38%  610 aa  UVRC_ECO55 RecName: Full=UvrABC system protein C;       
   13::605     7e-94  38%  610 aa  UVRC_ECO27 RecName: Full=UvrABC system protein C;       
   13::605     7e-94  38%  610 aa  UVRC_ECO24 RecName: Full=UvrABC system protein C;       
   17::614     1e-93  38%  618 aa  UVRC_LEGPC RecName: Full=UvrABC system protein C;       
   19::616     1e-93  37%  617 aa  UVRC_NEIMA RecName: Full=UvrABC system protein C;       
    3::591     1e-93  37%  593 aa  UVRC_CALS8 RecName: Full=UvrABC system protein C;       
   13::608     3e-93  38%  610 aa  UVRC_ERWT9 RecName: Full=UvrABC system protein C;       
    3::601     3e-93  37%  606 aa  UVRC_DESAH RecName: Full=UvrABC system protein C;       
   13::608     3e-93  38%  610 aa  UVRC_KLEP3 RecName: Full=UvrABC system protein C;       
   16::609     4e-93  36%  609 aa  UVRC_LEPIC RecName: Full=UvrABC system protein C;       
    6::597     4e-93  38%  599 aa  UVRC_ACIBY RecName: Full=UvrABC system protein C;       
   23::634     6e-93  39%  643 aa  UVRC_SYNP6 RecName: Full=UvrABC system protein C;       
   23::634     6e-93  39%  643 aa  UVRC_SYNE7 RecName: Full=UvrABC system protein C;       
   13::607     6e-93  37%  609 aa  UVRC_SHEHH RecName: Full=UvrABC system protein C;       
   13::608     6e-93  38%  610 aa  UVRC_PHOLL RecName: Full=UvrABC system protein C;       
    5::604     6e-93  37%  646 aa  UVRC_MYXXD RecName: Full=UvrABC system protein C;       
   14::603     7e-93  37%  604 aa  UVRC_NITEC RecName: Full=UvrABC system protein C;       
   23::606     7e-93  37%  612 aa  UVRC_IDILO RecName: Full=UvrABC system protein C;       
   16::605     1e-92  41%  606 aa  UVRC_NITMU RecName: Full=UvrABC system protein C;       
   16::609     1e-92  36%  609 aa  UVRC_LEPIN RecName: Full=UvrABC system protein C;       
    6::597     1e-92  38%  599 aa  UVRC_ACIBS RecName: Full=UvrABC system protein C;       
   16::607     2e-92  35%  612 aa  UVRC_HAHCH RecName: Full=UvrABC system protein C;       
   14::621     2e-92  38%  626 aa  UVRC_ACAM1 RecName: Full=UvrABC system protein C;       
   10::612     3e-92  39%  612 aa  UVRC_PELCD RecName: Full=UvrABC system protein C;       
   10::606     5e-92  37%  608 aa  UVRC_ACTSZ RecName: Full=UvrABC system protein C;       
   37::629     6e-92  35%  635 aa  UVRC_SILST RecName: Full=UvrABC system protein C;       
   14::606     6e-92  41%  607 aa  UVRC_BORA1 RecName: Full=UvrABC system protein C;       
   14::608     8e-92  38%  610 aa  UVRC_PROMH RecName: Full=UvrABC system protein C;       
   60::657     1e-91  35%  664 aa  UVRC_ZYMMO RecName: Full=UvrABC system protein C;       
   19::616     1e-91  37%  617 aa  UVRC_NEIG1 RecName: Full=UvrABC system protein C;       
    3::631     2e-91  39%  645 aa  UVRC_ACIC5 RecName: Full=UvrABC system protein C;       
   18::613     2e-91  37%  616 aa  UVRC_PHOPR RecName: Full=UvrABC system protein C;       
    6::597     3e-91  37%  599 aa  UVRC_ACIAD RecName: Full=UvrABC system protein C;       
   13::607     4e-91  37%  609 aa  UVRC_SHESH RecName: Full=UvrABC system protein C;       
   13::607     4e-91  36%  609 aa  UVRC_SHEPA RecName: Full=UvrABC system protein C;       
   10::606     4e-91  37%  608 aa  UVRC_PASMU RecName: Full=UvrABC system protein C;       
   13::608     4e-91  37%  610 aa  UVRC_ENTS8 RecName: Full=UvrABC system protein C;       
   11::597     5e-91  34%  605 aa  UVRC_CLOD6 RecName: Full=UvrABC system protein C;       
   13::607     7e-91  36%  609 aa  UVRC_SHEPW RecName: Full=UvrABC system protein C;       
   14::606     9e-91  37%  609 aa  UVRC_HAEI8 RecName: Full=UvrABC system protein C;       
   14::600     9e-91  41%  601 aa  UVRC_CHRVO RecName: Full=UvrABC system protein C;       
    4::606     9e-91  36%  611 aa  UVRC_BRUME RecName: Full=UvrABC system protein C;       
   20::622     9e-91  36%  627 aa  UVRC_BRUAB RecName: Full=UvrABC system protein C;       
    4::606     9e-91  36%  611 aa  UVRC_BRUA2 RecName: Full=UvrABC system protein C;       
   13::607     2e-90  36%  610 aa  UVRC_SHEFN RecName: Full=UvrABC system protein C;       
   19::616     2e-90  37%  617 aa  UVRC_NEIMB RecName: Full=UvrABC system protein C;       
    7::574     2e-90  41%  579 aa  UVRC_METTH RecName: Full=UvrABC system protein C;       
    4::606     2e-90  36%  611 aa  UVRC_BRUSU RecName: Full=UvrABC system protein C;       
    5::588     3e-90  38%  590 aa  UVRC_GEOKA RecName: Full=UvrABC system protein C;       
   13::607     4e-90  39%  609 aa  UVRC_SHESM RecName: Full=UvrABC system protein C;       
   13::607     4e-90  39%  609 aa  UVRC_SHEON RecName: Full=UvrABC system protein C;       
   18::606     4e-90  35%  607 aa  UVRC_PSEFL RecName: Full=UvrABC system protein C;       
   14::606     4e-90  37%  609 aa  UVRC_HAEIE RecName: Full=UvrABC system protein C;       
   18::606     6e-90  36%  607 aa  UVRC_PSESM RecName: Full=UvrABC system protein C;       
   13::608     6e-90  40%  610 aa  UVRC_EDWI9 RecName: Full=UvrABC system protein C;       
    3::597     8e-90  36%  623 aa  UVRC_SOLUE RecName: Full=UvrABC system protein C;       
   14::607     8e-90  39%  609 aa  UVRC_SHESA RecName: Full=UvrABC system protein C;       
   59::652     8e-90  38%  658 aa  UVRC_NOVAD RecName: Full=UvrABC system protein C;       
   13::607     1e-89  39%  609 aa  UVRC_SHESR RecName: Full=UvrABC system protein C;       
   20::673     1e-89  36%  674 aa  UVRC_BURM1 RecName: Full=UvrABC system protein C;       
    5::588     1e-89  41%  590 aa  UVRC_BACLD RecName: Full=UvrABC system protein C;       
   28::619     1e-89  35%  626 aa  UVRC_SYNY3 RecName: Full=UvrABC system protein C;       
   10::592     2e-89  36%  599 aa  UVRC_DICT6 RecName: Full=UvrABC system protein C;       
   11::602     2e-89  34%  608 aa  UVRC_FINM2 RecName: Full=UvrABC system protein C;       
   13::607     4e-89  38%  609 aa  UVRC_SHELP RecName: Full=UvrABC system protein C;       
   24::665     4e-89  42%  666 aa  UVRC_POLSJ RecName: Full=UvrABC system protein C;       
   33::634     4e-89  39%  640 aa  UVRC_CAUCR RecName: Full=UvrABC system protein C;       
   13::608     5e-89  36%  610 aa  UVRC_SERP5 RecName: Full=UvrABC system protein C;       
    5::590     5e-89  38%  596 aa  UVRC_OCEIH RecName: Full=UvrABC system protein C;       
   10::597     6e-89  39%  598 aa  UVRC_THIDA RecName: Full=UvrABC system protein C;       
    5::588     6e-89  38%  590 aa  UVRC_BACSU RecName: Full=UvrABC system protein C;       
    5::588     6e-89  40%  590 aa  UVRC_BACA2 RecName: Full=UvrABC system protein C;       
   28::647     8e-89  32%  652 aa  UVRC_PROM9 RecName: Full=UvrABC system protein C;       
    6::592     8e-89  37%  603 aa  UVRC_LISMH RecName: Full=UvrABC system protein C;       
    6::592     8e-89  37%  603 aa  UVRC_LISIN RecName: Full=UvrABC system protein C;       
   33::637     1e-88  36%  639 aa  UVRC_RHORT RecName: Full=UvrABC system protein C;       
    8::611     1e-88  38%  622 aa  UVRC_GEOSF RecName: Full=UvrABC system protein C;       
   13::607     1e-88  38%  609 aa  UVRC_SHEB9 RecName: Full=UvrABC system protein C;       
   69::682     2e-88  34%  688 aa  UVRC_RHILO RecName: Full=UvrABC system protein C;       
    6::592     2e-88  37%  603 aa  UVRC_LISMO RecName: Full=UvrABC system protein C;       
    6::592     2e-88  36%  603 aa  UVRC_LISW6 RecName: Full=UvrABC system protein C;       
   13::607     3e-88  38%  609 aa  UVRC_SHEB8 RecName: Full=UvrABC system protein C;       
    6::592     3e-88  36%  603 aa  UVRC_LISMC RecName: Full=UvrABC system protein C;       
   13::607     4e-88  38%  609 aa  UVRC_SHESW RecName: Full=UvrABC system protein C;       
   23::643     5e-88  33%  647 aa  UVRC_PROM4 RecName: Full=UvrABC system protein C;       
    4::592     5e-88  36%  593 aa  UVRC_BREBN RecName: Full=UvrABC system protein C;       
   50::655     5e-88  34%  661 aa  UVRC_BARHE RecName: Full=UvrABC system protein C;       
   45::638     7e-88  35%  644 aa  UVRC_SPHAL RecName: Full=UvrABC system protein C;       
   23::635     9e-88  34%  661 aa  UVRC_SYNSC RecName: Full=UvrABC system protein C;       
    6::592     9e-88  36%  603 aa  UVRC_LISMF RecName: Full=UvrABC system protein C;       
   13::607     1e-87  38%  609 aa  UVRC_SHEB5 RecName: Full=UvrABC system protein C;       
   20::676     1e-87  35%  677 aa  UVRC_BURS3 RecName: Full=UvrABC system protein C;       
    5::629     2e-87  34%  652 aa  UVRC_SYNPX RecName: Full=UvrABC system protein C;       
   13::607     2e-87  38%  609 aa  UVRC_SHEPC RecName: Full=UvrABC system protein C;       
   18::606     2e-87  34%  607 aa  UVRC_PSEF5 RecName: Full=UvrABC system protein C;       
   14::606     5e-87  37%  609 aa  UVRC_HAEIN RecName: Full=UvrABC system protein C;       
   12::602     5e-87  35%  609 aa  UVRC_COXBN RecName: Full=UvrABC system protein C;       
   20::680     5e-87  36%  681 aa  UVRC_BURCH RecName: Full=UvrABC system protein C;       
   20::680     5e-87  36%  681 aa  UVRC_BURCA RecName: Full=UvrABC system protein C;       
   11::607     5e-87  36%  610 aa  UVRC_ACTP7 RecName: Full=UvrABC system protein C;       
   11::607     6e-87  37%  610 aa  UVRC_ACTPJ RecName: Full=UvrABC system protein C;       
   20::681     8e-87  36%  682 aa  UVRC_BURCC RecName: Full=UvrABC system protein C;       
   13::608     1e-86  36%  610 aa  UVRC_VIBPA RecName: Full=UvrABC system protein C;       
   12::602     1e-86  35%  609 aa  UVRC_COXB1 RecName: Full=UvrABC system protein C;       
   14::607     1e-86  40%  609 aa  UVRC_BORPA RecName: Full=UvrABC system protein C;       
   14::607     1e-86  40%  609 aa  UVRC_BORBR RecName: Full=UvrABC system protein C;       
   12::606     2e-86  36%  609 aa  UVRC_SHEDO RecName: Full=UvrABC system protein C;       
   14::607     2e-86  40%  609 aa  UVRC_BORPE RecName: Full=UvrABC system protein C;       
   16::601     2e-86  39%  602 aa  UVRC_AZOSE RecName: Full=UvrABC system protein C;       
   13::608     2e-86  36%  610 aa  UVRC_VIBVU RecName: Full=UvrABC system protein C;       
   16::606     2e-86  36%  608 aa  UVRC_PSEA6 RecName: Full=UvrABC system protein C;       
   13::608     3e-86  36%  610 aa  UVRC_VIBVY RecName: Full=UvrABC system protein C;       
   12::602     3e-86  34%  609 aa  UVRC_COXBU RecName: Full=UvrABC system protein C;       
   12::602     3e-86  34%  609 aa  UVRC_COXBR RecName: Full=UvrABC system protein C;       
   12::602     3e-86  34%  609 aa  UVRC_COXB2 RecName: Full=UvrABC system protein C;       
   20::682     7e-86  35%  683 aa  UVRC_BURVG RecName: Full=UvrABC system protein C;       
   14::603     9e-86  35%  604 aa  UVRC_NITEU RecName: Full=UvrABC system protein C;       
   16::602     9e-86  37%  603 aa  UVRC_DECAR RecName: Full=UvrABC system protein C;       
   13::575     1e-85  37%  575 aa  UVRC_SHIDS RecName: Full=UvrABC system protein C;       
   30::653     1e-85  37%  654 aa  UVRC_RALSO RecName: Full=UvrABC system protein C;       
    5::588     1e-85  36%  591 aa  UVRC_BACHD RecName: Full=UvrABC system protein C;       
   11::607     1e-85  36%  610 aa  UVRC_ACTP2 RecName: Full=UvrABC system protein C;       
   14::613     3e-85  38%  614 aa  UVRC_HYPNA RecName: Full=UvrABC system protein C;       
   20::599     3e-85  36%  607 aa  UVRC_DESHY RecName: Full=UvrABC system protein C;       
   11::602     3e-85  35%  604 aa  UVRC_CHRSD RecName: Full=UvrABC system protein C;       
   19::618     3e-85  37%  626 aa  UVRC_THEEB RecName: Full=UvrABC system protein C;       
   64::671     3e-85  33%  680 aa  UVRC_RHIL3 RecName: Full=UvrABC system protein C;       
    5::657     4e-85  41%  716 aa  UVRC_ANADF RecName: Full=UvrABC system protein C;       
   13::609     6e-85  35%  612 aa  UVRC_HAEDU RecName: Full=UvrABC system protein C;       
    6::614     1e-84  31%  614 aa  UVRC_LEPBP RecName: Full=UvrABC system protein C;       
    6::614     1e-84  31%  614 aa  UVRC_LEPBA RecName: Full=UvrABC system protein C;       
   80::679     2e-84  33%  686 aa  UVRC_BRAJA RecName: Full=UvrABC system protein C;       
   24::635     2e-84  35%  661 aa  UVRC_SYNS9 RecName: Full=UvrABC system protein C;       
   24::662     2e-84  35%  663 aa  UVRC_RALEJ RecName: Full=UvrABC system protein C;       
   20::617     2e-84  35%  618 aa  UVRC_HERAR RecName: Full=UvrABC system protein C;       
   62::666     5e-84  35%  674 aa  UVRC_RHIME RecName: Full=UvrABC system protein C;       
   65::672     6e-84  33%  681 aa  UVRC_AGRT5 RecName: Full=UvrABC system protein C;       
    5::589     1e-83  34%  594 aa  UVRC_BACC2 RecName: Full=UvrABC system protein C;       
   91::697     2e-83  34%  704 aa  UVRC_RHOPA RecName: Full=UvrABC system protein C;       
   20::617     2e-83  35%  618 aa  UVRC_JANMA RecName: Full=UvrABC system protein C;       
   10::608     2e-83  35%  609 aa  UVRC_HAES2 RecName: Full=UvrABC system protein C;       
   10::608     2e-83  35%  609 aa  UVRC_HAES1 RecName: Full=UvrABC system protein C;       
    9::604     3e-83  36%  649 aa  UVRC_GEOSM RecName: Full=UvrABC system protein C;       
   91::692     4e-83  34%  699 aa  UVRC_RHOPB RecName: Full=UvrABC system protein C;       
   35::670     4e-83  40%  671 aa  UVRC_RHOFD RecName: Full=UvrABC system protein C;       
   13::608     5e-83  34%  610 aa  UVRC_VIBCM RecName: Full=UvrABC system protein C;       
   13::608     5e-83  34%  610 aa  UVRC_VIBCH RecName: Full=UvrABC system protein C;       
   13::608     5e-83  34%  610 aa  UVRC_VIBC3 RecName: Full=UvrABC system protein C;       
   81::683     9e-83  35%  690 aa  UVRC_NITHX RecName: Full=UvrABC system protein C;       
   87::688     1e-82  34%  695 aa  UVRC_RHOPS RecName: Full=UvrABC system protein C;       
    9::604     1e-82  36%  623 aa  UVRC_GEOBB RecName: Full=UvrABC system protein C;       
   12::591     2e-82  35%  591 aa  UVRC_STRU0 RecName: Full=UvrABC system protein C;       
   10::606     3e-82  36%  608 aa  UVRC_MANSM RecName: Full=UvrABC system protein C;       
   12::605     3e-82  36%  608 aa  UVRC_ALISL RecName: Full=UvrABC system protein C;       
   34::629     3e-82  34%  633 aa  UVRC_MARMM RecName: Full=UvrABC system protein C;       
    5::589     3e-82  34%  594 aa  UVRC_BACWK RecName: Full=UvrABC system protein C;       
   87::688     4e-82  34%  695 aa  UVRC_RHOP2 RecName: Full=UvrABC system protein C;       
    5::589     1e-81  34%  594 aa  UVRC_BACHK RecName: Full=UvrABC system protein C;       
    5::589     1e-81  34%  594 aa  UVRC_BACCZ RecName: Full=UvrABC system protein C;       
    5::589     1e-81  34%  594 aa  UVRC_BACC3 RecName: Full=UvrABC system protein C;       
    5::589     1e-81  34%  594 aa  UVRC_BACC0 RecName: Full=UvrABC system protein C;       
    5::589     1e-81  34%  594 aa  UVRC_BACAH RecName: Full=UvrABC system protein C;       
    5::589     2e-81  34%  594 aa  UVRC_BACC4 RecName: Full=UvrABC system protein C;       
    5::589     2e-81  34%  594 aa  UVRC_BACAN RecName: Full=UvrABC system protein C;       
    5::589     2e-81  34%  594 aa  UVRC_BACAC RecName: Full=UvrABC system protein C;       
    5::589     2e-81  34%  594 aa  UVRC_BACAA RecName: Full=UvrABC system protein C;       
   12::590     2e-81  36%  594 aa  UVRC_STREM RecName: Full=UvrABC system protein C;       
   34::636     2e-81  34%  639 aa  UVRC_COLP3 RecName: Full=UvrABC system protein C;       
    5::585     3e-81  37%  596 aa  UVRC_LYSSC RecName: Full=UvrABC system protein C;       
    5::589     3e-81  34%  594 aa  UVRC_BACCR RecName: Full=UvrABC system protein C;       
   67::672     4e-81  34%  678 aa  UVRC_BARQU RecName: Full=UvrABC system protein C;       
    5::588     4e-81  34%  594 aa  UVRC_BACCQ RecName: Full=UvrABC system protein C;       
    5::588     4e-81  34%  594 aa  UVRC_BACC7 RecName: Full=UvrABC system protein C;       
   12::590     5e-81  36%  594 aa  UVRC_STRE4 RecName: Full=UvrABC system protein C;       
   23::635     8e-81  31%  640 aa  UVRC_PROMA RecName: Full=UvrABC system protein C;       
   12::596     8e-81  35%  599 aa  UVRC_PORGI RecName: Full=UvrABC system protein C;       
   13::597     8e-81  35%  600 aa  UVRC_PORG3 RecName: Full=UvrABC system protein C;       
    8::606     8e-81  31%  611 aa  UVRC_PELUB RecName: Full=UvrABC system protein C;       
   12::590     1e-80  36%  594 aa  UVRC_STRS7 RecName: Full=UvrABC system protein C;       
    5::588     1e-80  35%  598 aa  UVRC_ENTFA RecName: Full=UvrABC system protein C;       
    5::588     1e-80  34%  594 aa  UVRC_BACC1 RecName: Full=UvrABC system protein C;       
   26::672     2e-80  35%  673 aa  UVRC_RALME RecName: Full=UvrABC system protein C;       
   82::682     2e-80  38%  689 aa  UVRC_NITWN RecName: Full=UvrABC system protein C;       
    3::586     2e-80  33%  597 aa  UVRC_FLAJ1 RecName: Full=UvrABC system protein C;       
   63::670     2e-80  33%  679 aa  UVRC_RHIEC RecName: Full=UvrABC system protein C;       
   13::593     3e-80  35%  594 aa  UVRC_PEDPA RecName: Full=UvrABC system protein C;       
    4::646     3e-80  35%  669 aa  UVRC_LACLM RecName: Full=UvrABC system protein C;       
    6::591     4e-80  34%  605 aa  UVRC_LACBA RecName: Full=UvrABC system protein C;       
   12::605     7e-80  36%  608 aa  UVRC_VIBF1 RecName: Full=UvrABC system protein C;       
    3::583     1e-79  33%  597 aa  UVRC_GRAFK RecName: Full=UvrABC system protein C;       
   12::588     2e-79  35%  593 aa  UVRC_STRA3 RecName: Full=UvrABC system protein C;       
   12::588     3e-79  35%  593 aa  UVRC_STRA5 RecName: Full=UvrABC system protein C;       
   12::588     3e-79  35%  593 aa  UVRC_STRA1 RecName: Full=UvrABC system protein C;       
    4::587     4e-79  34%  594 aa  UVRC_BACSK RecName: Full=UvrABC system protein C;       
   12::588     5e-79  34%  611 aa  UVRC_STRGC RecName: Full=UvrABC system protein C;       
    6::597     5e-79  34%  607 aa  UVRC_OENOB RecName: Full=UvrABC system protein C;       
   12::589     8e-79  34%  598 aa  UVRC_STRP6 RecName: Full=UvrABC system protein C;       
   17::609     8e-79  35%  612 aa  UVRC_FRAP2 RecName: Full=UvrABC system protein C;       
   12::589     1e-78  34%  598 aa  UVRC_STRPZ RecName: Full=UvrABC system protein C;       
   12::589     1e-78  34%  598 aa  UVRC_STRPM RecName: Full=UvrABC system protein C;       
   12::589     1e-78  34%  598 aa  UVRC_STRPG RecName: Full=UvrABC system protein C;       
   12::589     1e-78  34%  598 aa  UVRC_STRPF RecName: Full=UvrABC system protein C;       
   12::589     1e-78  34%  598 aa  UVRC_STRPD RecName: Full=UvrABC system protein C;       
   12::589     1e-78  34%  598 aa  UVRC_STRPC RecName: Full=UvrABC system protein C;       
   12::589     1e-78  34%  598 aa  UVRC_STRPB RecName: Full=UvrABC system protein C;       
    8::591     1e-78  34%  595 aa  UVRC_STACT RecName: Full=UvrABC system protein C;       
   12::589     1e-78  34%  598 aa  UVRC_STRP8 RecName: Full=UvrABC system protein C;       
   12::589     1e-78  34%  598 aa  UVRC_STRP3 RecName: Full=UvrABC system protein C;       
   12::589     1e-78  34%  598 aa  UVRC_STRP1 RecName: Full=UvrABC system protein C;       
   18::604     2e-78  37%  618 aa  UVRC_XANOR RecName: Full=UvrABC system protein C;       
   18::604     2e-78  37%  618 aa  UVRC_XANOP RecName: Full=UvrABC system protein C;       
   18::604     2e-78  37%  618 aa  UVRC_XANOM RecName: Full=UvrABC system protein C;       
   12::588     2e-78  35%  595 aa  UVRC_STRMU RecName: Full=UvrABC system protein C;       
    5::588     3e-78  34%  614 aa  UVRC_STRP7 RecName: Full=UvrABC system protein C;       
    5::588     4e-78  34%  614 aa  UVRC_STRZT RecName: Full=UvrABC system protein C;       
    5::592     4e-78  33%  615 aa  UVRC_STRP4 RecName: Full=UvrABC system protein C;       
    4::644     4e-78  35%  668 aa  UVRC_LACLA RecName: Full=UvrABC system protein C;       
    9::609     4e-78  36%  617 aa  UVRC_DEIRA RecName: Full=UvrABC system protein C;       
    5::592     5e-78  33%  615 aa  UVRC_STRZJ RecName: Full=UvrABC system protein C;       
    5::588     5e-78  34%  614 aa  UVRC_STRPN RecName: Full=UvrABC system protein C;       
    5::588     5e-78  34%  615 aa  UVRC_STRPI RecName: Full=UvrABC system protein C;       
    3::618     5e-78  33%  621 aa  UVRC_LAWIP RecName: Full=UvrABC system protein C;       
    5::604     7e-78  33%  614 aa  UVRC_STRR6 RecName: Full=UvrABC system protein C;       
    5::592     7e-78  33%  615 aa  UVRC_STRPS RecName: Full=UvrABC system protein C;       
    5::592     7e-78  33%  615 aa  UVRC_STRPJ RecName: Full=UvrABC system protein C;       
    5::604     7e-78  33%  614 aa  UVRC_STRP2 RecName: Full=UvrABC system protein C;       
    5::588     1e-77  34%  614 aa  UVRC_STRZP RecName: Full=UvrABC system protein C;       
   18::604     1e-77  35%  618 aa  UVRC_XANCP RecName: Full=UvrABC system protein C;       
   18::604     1e-77  35%  618 aa  UVRC_XANC8 RecName: Full=UvrABC system protein C;       
    8::588     1e-77  34%  589 aa  UVRC_FUSNN RecName: Full=UvrABC system protein C;       
   12::591     3e-77  34%  595 aa  UVRC_STRT1 RecName: Full=UvrABC system protein C;       
   24::612     3e-77  34%  614 aa  UVRC_PSYCK RecName: Full=UvrABC system protein C;       
   12::591     4e-77  34%  595 aa  UVRC_STRT2 RecName: Full=UvrABC system protein C;       
   18::604     7e-77  35%  618 aa  UVRC_XANCB RecName: Full=UvrABC system protein C;       
   12::588     7e-77  34%  611 aa  UVRC_STRSV RecName: Full=UvrABC system protein C;       
   18::604     1e-76  36%  619 aa  UVRC_XANAC RecName: Full=UvrABC system protein C;       
    8::591     1e-76  34%  594 aa  UVRC_STAEQ RecName: Full=UvrABC system protein C;       
   12::586     2e-76  33%  599 aa  UVRC_FLAPJ RecName: Full=UvrABC system protein C;       
   18::604     2e-76  36%  619 aa  UVRC_XANC5 RecName: Full=UvrABC system protein C;       
   12::591     4e-76  34%  595 aa  UVRC_STRTD RecName: Full=UvrABC system protein C;       
    8::591     4e-76  34%  594 aa  UVRC_STAES RecName: Full=UvrABC system protein C;       
   13::585     4e-76  36%  604 aa  UVRC_LACPL RecName: Full=UvrABC system protein C;       
   18::684     5e-76  38%  685 aa  UVRC_VEREI RecName: Full=UvrABC system protein C;       
    5::588     5e-76  34%  590 aa  UVRC_BACP2 RecName: Full=UvrABC system protein C;       
   13::584     8e-76  35%  590 aa  UVRC_LACS1 RecName: Full=UvrABC system protein C;       
   12::603     1e-75  31%  607 aa  UVRC_PSEHT RecName: Full=UvrABC system protein C;       
   17::609     2e-75  34%  612 aa  UVRC_FRATO RecName: Full=UvrABC system protein C;       
   17::609     2e-75  34%  612 aa  UVRC_FRATH RecName: Full=UvrABC system protein C;       
   17::609     2e-75  34%  612 aa  UVRC_FRATF RecName: Full=UvrABC system protein C;       
    8::591     3e-75  33%  593 aa  UVRC_STAAU RecName: Full=UvrABC system protein C;       
    8::591     3e-75  33%  593 aa  UVRC_STAAR RecName: Full=UvrABC system protein C;       
    8::591     3e-75  33%  593 aa  UVRC_STAAB RecName: Full=UvrABC system protein C;       
   17::609     3e-75  34%  612 aa  UVRC_FRATN RecName: Full=UvrABC system protein C;       
    8::591     4e-75  33%  593 aa  UVRC_STAAT RecName: Full=UvrABC system protein C;       
    8::591     4e-75  33%  593 aa  UVRC_STAAE RecName: Full=UvrABC system protein C;       
    8::591     4e-75  33%  593 aa  UVRC_STAAC RecName: Full=UvrABC system protein C;       
    8::591     4e-75  33%  593 aa  UVRC_STAA8 RecName: Full=UvrABC system protein C;       
    8::591     4e-75  33%  593 aa  UVRC_STAA3 RecName: Full=UvrABC system protein C;       
   17::609     4e-75  34%  612 aa  UVRC_FRATM RecName: Full=UvrABC system protein C;       
    8::591     5e-75  33%  593 aa  UVRC_STAAW RecName: Full=UvrABC system protein C;       
    8::591     5e-75  33%  593 aa  UVRC_STAAS RecName: Full=UvrABC system protein C;       
    8::591     5e-75  33%  593 aa  UVRC_STAAN RecName: Full=UvrABC system protein C;       
    8::591     5e-75  33%  593 aa  UVRC_STAAM RecName: Full=UvrABC system protein C;       
    8::591     5e-75  33%  593 aa  UVRC_STAA9 RecName: Full=UvrABC system protein C;       
    8::591     5e-75  33%  593 aa  UVRC_STAA2 RecName: Full=UvrABC system protein C;       
    8::591     5e-75  33%  593 aa  UVRC_STAA1 RecName: Full=UvrABC system protein C;       
    4::643     7e-75  36%  652 aa  UVRC_TREDE RecName: Full=UvrABC system protein C;       
   17::609     7e-75  34%  612 aa  UVRC_FRATW RecName: Full=UvrABC system protein C;       
    3::593     1e-74  32%  595 aa  UVRC_STAS1 RecName: Full=UvrABC system protein C;       
    1::594     2e-74  32%  596 aa  UVRC_CYTH3 RecName: Full=UvrABC system protein C;       
    7::525     3e-74  35%  527 aa  UVRC_METMP RecName: Full=UvrABC system protein C;       
    9::595     4e-74  32%  596 aa  UVRC_STAHJ RecName: Full=UvrABC system protein C;       
   13::588     6e-74  36%  592 aa  UVRC_LACSS RecName: Full=UvrABC system protein C;       
    6::586     2e-73  33%  603 aa  UVRC_LACRJ RecName: Full=UvrABC system protein C;       
    6::586     2e-73  33%  603 aa  UVRC_LACRD RecName: Full=UvrABC system protein C;       
   17::609     2e-73  34%  612 aa  UVRC_FRATT RecName: Full=UvrABC system protein C;       
   17::609     2e-73  34%  612 aa  UVRC_FRAT1 RecName: Full=UvrABC system protein C;       
    8::518     3e-73  36%  520 aa  UVRC_METHJ RecName: Full=UvrABC system protein C;       
   13::596     5e-73  33%  600 aa  UVRC_LACJO RecName: Full=UvrABC system protein C;       
   13::608     6e-73  34%  609 aa  UVRC_BACTN RecName: Full=UvrABC system protein C;       
   18::606     1e-72  35%  621 aa  UVRC_XYLF2 RecName: Full=UvrABC system protein C;       
   18::606     1e-72  35%  621 aa  UVRC_XYLFT RecName: Full=UvrABC system protein C;       
   13::594     1e-72  34%  602 aa  UVRC_LACCB RecName: Full=UvrABC system protein C;       
   13::594     1e-72  34%  602 aa  UVRC_LACC3 RecName: Full=UvrABC system protein C;       
   13::596     4e-72  33%  600 aa  UVRC_LACGA RecName: Full=UvrABC system protein C;       
   11::592     5e-72  35%  598 aa  UVRC_CHLTR RecName: Full=UvrABC system protein C;       
   11::592     5e-72  35%  598 aa  UVRC_CHLTA RecName: Full=UvrABC system protein C;       
    1::548     9e-72  36%  557 aa  UVRC_THEP1 RecName: Full=UvrABC system protein C;       
   24::612     9e-72  33%  614 aa  UVRC_PSYA2 RecName: Full=UvrABC system protein C;       
   13::596     1e-71  33%  600 aa  UVRC_LACDB RecName: Full=UvrABC system protein C;       
   13::596     1e-71  33%  600 aa  UVRC_LACDA RecName: Full=UvrABC system protein C;       
   22::606     3e-71  35%  621 aa  UVRC_XYLFA RecName: Full=UvrABC system protein C;       
   12::520     4e-71  36%  523 aa  UVRC_METMA RecName: Full=UvrABC system protein C;       
   15::548     5e-71  37%  557 aa  UVRC_THESQ RecName: Full=UvrABC system protein C;       
   24::612     8e-71  32%  614 aa  UVRC_PSYWF RecName: Full=UvrABC system protein C;       
    8::592     2e-70  32%  604 aa  UVRC_CHLAB RecName: Full=UvrABC system protein C;       
    1::548     1e-69  36%  557 aa  UVRC_THEMA RecName: Full=UvrABC system protein C;       
    9::602     3e-69  37%  616 aa  UVRC_DEIGD RecName: Full=UvrABC system protein C;       
    6::514     7e-69  41%  516 aa  UVRC_METAC RecName: Full=UvrABC system protein C;       
   19::605     1e-68  33%  608 aa  UVRC_BACFR RecName: Full=UvrABC system protein C;       
   19::605     1e-68  33%  608 aa  UVRC_BACFN RecName: Full=UvrABC system protein C;       
   19::617     2e-68  32%  626 aa  UVRC_RICPR RecName: Full=UvrABC system protein C;       
    8::617     2e-68  32%  626 aa  UVRC_RICTY RecName: Full=UvrABC system protein C;       
    6::586     2e-67  32%  603 aa  UVRC_LACF3 RecName: Full=UvrABC system protein C;       
    3::644     2e-67  35%  688 aa  UVRC_DESVH RecName: Full=UvrABC system protein C;       
   13::606     4e-67  35%  613 aa  UVRC_ANAMM RecName: Full=UvrABC system protein C;       
    5::632     5e-67  30%  635 aa  UVRC_RICBR RecName: Full=UvrABC system protein C;       
    9::605     9e-67  32%  611 aa  UVRC_NAUPA RecName: Full=UvrABC system protein C;       
    8::599     9e-67  31%  604 aa  UVRC_CHLFF RecName: Full=UvrABC system protein C;       
   15::558     2e-65  37%  558 aa  UVRC_THELT RecName: Full=UvrABC system protein C;       
   19::635     4e-65  32%  639 aa  UVRC_RICPU RecName: Full=UvrABC system protein C;       
   19::635     4e-65  32%  639 aa  UVRC_RICAE RecName: Full=UvrABC system protein C;       
    6::580     5e-65  35%  581 aa  UVRC_HALMA RecName: Full=UvrABC system protein C;       
    8::604     2e-64  31%  605 aa  UVRC_CHLCV RecName: Full=UvrABC system protein C;       
   19::635     4e-64  31%  639 aa  UVRC_RICCN RecName: Full=UvrABC system protein C;       
    9::571     4e-64  31%  574 aa  UVRC_PETMO RecName: Full=UvrABC system protein C;       
   19::635     1e-63  32%  639 aa  UVRC_RICRS RecName: Full=UvrABC system protein C;       
   19::635     1e-63  32%  639 aa  UVRC_RICRO RecName: Full=UvrABC system protein C;       
   10::592     3e-63  33%  598 aa  UVRC_CHLMU RecName: Full=UvrABC system protein C;       
   18::606     8e-63  30%  606 aa  UVRC_WOLTR RecName: Full=UvrABC system protein C;       
    6::514     8e-63  34%  519 aa  UVRC_METBF RecName: Full=UvrABC system protein C;       
   13::596     1e-62  31%  600 aa  UVRC_LACH4 RecName: Full=UvrABC system protein C;       
   11::595     9e-62  30%  603 aa  UVRC_CHLPN RecName: Full=UvrABC system protein C;       
   13::596     1e-61  30%  600 aa  UVRC_LACAC RecName: Full=UvrABC system protein C;       
   18::604     3e-61  39%  614 aa  UVRC_STRMK RecName: Full=UvrABC system protein C;       
   18::604     3e-61  39%  614 aa  UVRC_STRM5 RecName: Full=UvrABC system protein C;       
   11::635     4e-61  30%  638 aa  UVRC_RICCK RecName: Full=UvrABC system protein C;       
   18::585     6e-61  38%  585 aa  UVRC_HALWD RecName: Full=UvrABC system protein C;       
   11::602     1e-60  30%  605 aa  UVRC_WOLPP RecName: Full=UvrABC system protein C;       
   19::638     2e-60  30%  642 aa  UVRC_RICFE RecName: Full=UvrABC system protein C;       
   27::605     6e-60  32%  614 aa  UVRC_ANAPZ RecName: Full=UvrABC system protein C;       
   11::602     2e-59  30%  605 aa  UVRC_WOLWR RecName: Full=UvrABC system protein C;       
   11::602     7e-59  30%  605 aa  UVRC_WOLPM RecName: Full=UvrABC system protein C;       
    9::572     1e-58  35%  590 aa  UVRC_THET8 RecName: Full=UvrABC system protein C;       
   19::648     2e-57  29%  651 aa  UVRC_RICAH RecName: Full=UvrABC system protein C;       
   16::585     1e-56  29%  594 aa  UVRC_HELPJ RecName: Full=UvrABC system protein C;       
    6::571     2e-56  37%  575 aa  UVRC_NATPD RecName: Full=UvrABC system protein C;       
   16::585     2e-56  29%  594 aa  UVRC_HELPY RecName: Full=UvrABC system protein C;       
   16::585     2e-56  29%  594 aa  UVRC_HELP2 RecName: Full=UvrABC system protein C;       
   16::585     3e-56  29%  594 aa  UVRC_HELPG RecName: Full=UvrABC system protein C;       
   16::585     6e-56  29%  594 aa  UVRC_HELPH RecName: Full=UvrABC system protein C;       
   17::585     4e-55  28%  594 aa  UVRC_HELAH RecName: Full=UvrABC system protein C;       
    3::613     6e-55  30%  616 aa  UVRC_ARCB4 RecName: Full=UvrABC system protein C;       
   16::585     1e-54  28%  594 aa  UVRC_HELPS RecName: Full=UvrABC system protein C;       
   12::599     2e-54  31%  600 aa  UVRC_CAMJD RecName: Full=UvrABC system protein C;       
    3::570     2e-54  30%  588 aa  UVRC_MESFL RecName: Full=UvrABC system protein C;       
   12::599     2e-53  31%  600 aa  UVRC_CAMJ8 RecName: Full=UvrABC system protein C;       
   12::599     6e-53  30%  600 aa  UVRC_CAMJJ RecName: Full=UvrABC system protein C;       
    6::590     1e-52  37%  590 aa  UVRC_HALSA RecName: Full=UvrABC system protein C;       
    6::590     1e-52  37%  590 aa  UVRC_HALS3 RecName: Full=UvrABC system protein C;       
   12::599     2e-52  30%  600 aa  UVRC_CAMJE RecName: Full=UvrABC system protein C;       
    2::599     4e-52  30%  600 aa  UVRC_CAMJR RecName: Full=UvrABC system protein C;       
   97::612     6e-52  34%  630 aa  UVRC_THET2 RecName: Full=UvrABC system protein C;       
   10::558     6e-52  30%  563 aa  UVRC_FERNB RecName: Full=UvrABC system protein C;       
    7::588     1e-51  27%  603 aa  UVRC_BORGA RecName: Full=UvrABC system protein C;       
    8::561     2e-51  28%  602 aa  UVRC_BORHD RecName: Full=UvrABC system protein C;       
   12::596     7e-51  30%  602 aa  UVRC_WOLSU RecName: Full=UvrABC system protein C;       
   15::588     3e-50  27%  598 aa  UVRC_BORAP RecName: Full=UvrABC system protein C;       
    2::586     2e-49  28%  600 aa  UVRC_SULDN RecName: Full=UvrABC system protein C;       
   19::730     2e-49  35%  731 aa  UVRC_BURPP RecName: Full=UvrABC system protein C;       
   19::733     3e-49  36%  734 aa  UVRC_BURXL RecName: Full=UvrABC system protein C;       
    5::577     9e-49  28%  589 aa  UVRC_MYCPE RecName: Full=UvrABC system protein C;       
   13::739     9e-49  37%  740 aa  UVRC_BURTA RecName: Full=UvrABC system protein C;       
   15::588     1e-48  27%  603 aa  UVRC_BORBZ RecName: Full=UvrABC system protein C;       
   15::588     1e-48  27%  603 aa  UVRC_BORBU RecName: Full=UvrABC system protein C;       
   20::683     3e-48  36%  684 aa  UVRC_BURCM RecName: Full=UvrABC system protein C;       
   20::683     3e-48  36%  684 aa  UVRC_BURA4 RecName: Full=UvrABC system protein C;       
    8::561     1e-47  28%  602 aa  UVRC_BORT9 RecName: Full=UvrABC system protein C;       
    9::551     2e-47  32%  551 aa  UVRC_THEAB RecName: Full=UvrABC system protein C;       
   11::534     2e-47  29%  565 aa  UVRC_HYDS0 RecName: Full=UvrABC system protein C;       
   13::742     9e-46  36%  743 aa  UVRC_BURPS RecName: Full=UvrABC system protein C;       
   13::746     9e-46  36%  747 aa  UVRC_BURP6 RecName: Full=UvrABC system protein C;       
   13::746     9e-46  36%  747 aa  UVRC_BURP1 RecName: Full=UvrABC system protein C;       
   13::746     9e-46  36%  747 aa  UVRC_BURP0 RecName: Full=UvrABC system protein C;       
   13::746     1e-45  36%  747 aa  UVRC_BURMS RecName: Full=UvrABC system protein C;       
   13::746     1e-45  36%  747 aa  UVRC_BURMA RecName: Full=UvrABC system protein C;       
   13::746     1e-45  36%  747 aa  UVRC_BURM9 RecName: Full=UvrABC system protein C;       
   13::746     1e-45  36%  747 aa  UVRC_BURM7 RecName: Full=UvrABC system protein C;       
    6::592     1e-44  41%  592 aa  UVRC_HALLT RecName: Full=UvrABC system protein C;       
   16::572     1e-44  26%  602 aa  UVRC_BORDL RecName: Full=UvrABC system protein C;       
   16::572     3e-44  26%  602 aa  UVRC_BORRA RecName: Full=UvrABC system protein C;       
    5::567     4e-44  29%  584 aa  UVRC_UREPA RecName: Full=UvrABC system protein C;       
    5::567     4e-44  29%  584 aa  UVRC_UREP2 RecName: Full=UvrABC system protein C;       
   18::612     4e-44  29%  621 aa  UVRC_HELHP RecName: Full=UvrABC system protein C;       
    9::700     6e-44  34%  700 aa  UVRC_DESDG RecName: Full=UvrABC system protein C;       
    5::567     1e-43  28%  584 aa  UVRC_UREU1 RecName: Full=UvrABC system protein C;       
   15::516     1e-43  31%  566 aa  UVRC_AQUAE RecName: Full=UvrABC system protein C;       
    4::580     2e-42  28%  589 aa  UVRC_AYWBP RecName: Full=UvrABC system protein C;       
  414::661     1e-37  40%  691 aa  UVRC_TREPS RecName: Full=UvrABC system protein C;       
  414::661     1e-37  40%  691 aa  UVRC_TREPA RecName: Full=UvrABC system protein C;       
    2::568     7e-37  25%  584 aa  UVRC_MYCMS RecName: Full=UvrABC system protein C;       
    5::576     5e-35  25%  592 aa  UVRC_MYCGA RecName: Full=UvrABC system protein C;       
    3::565     5e-34  25%  584 aa  UVRC_MYCCT RecName: Full=UvrABC system protein C;       
    4::566     5e-33  25%  586 aa  UVRC_MYCPN RecName: Full=UvrABC system protein C;       
    5::578     1e-32  24%  597 aa  UVRC_MYCGE RecName: Full=UvrABC system protein C;       
   12::556     2e-29  27%  571 aa  UVRC_MYCBV RecName: Full=UvrABC system protein C;       
   15::556     1e-28  28%  571 aa  UVRC_MYCAP RecName: Full=UvrABC system protein C;       
   24::202     8e-13  31%  295 aa  CHO_ECOLI RecName: Full=Excinuclease cho;       
   24::202     1e-12  31%  295 aa  CHO_ECO57 RecName: Full=Excinuclease cho;       
   31::202     2e-12  31%  295 aa  CHO_SHIFL RecName: Full=Excinuclease cho;       
   24::196     5e-12  31%  295 aa  CHO_ECOL6 RecName: Full=Excinuclease cho;       
  245::362     6e-12  35%  645 aa  Y2191_MYCTU RecName: Full=Uncharacterized protein Rv2191/MT2247;
   24::196     2e-10  30%  293 aa  CHO_SALTY RecName: Full=Excinuclease cho;       
   24::196     6e-10  29%  293 aa  CHO_SALTI RecName: Full=Excinuclease cho;       
  448::563     4e-07  35%  666 aa  DNLJ_COPPD RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  449::567     3e-05  29%  695 aa  DNLJ_CORJK RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  615::655     1e-04  41%  772 aa  DNLJ_PROAC RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  508::565     1e-04  40%  673 aa  DNLJ_HERA2 RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  116::221     2e-04  30%  221 aa  FAP24_MOUSE RecName: Full=Fanconi anemia-associated protein of 24
  721::774     3e-04  33%  778 aa  Y1505_METJA RecName: Full=Putative ATP-dependent RNA helicase
  536::575     4e-04  46%  695 aa  DNLJ_THERP RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  146::320     4e-04  29%  466 aa  CHLN_SYNE7 RecName: Full=Light-independent protochlorophyllide
  512::561     5e-04  38%  681 aa  DNLJ_FERNB RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  295::341     5e-04  37%  344 aa  DISA_PROAC RecName: Full=DNA integrity scanning protein disA;
  146::320     5e-04  29%  466 aa  CHLN_SYNP6 RecName: Full=Light-independent protochlorophyllide
   25::75      6e-04  40%  124 aa  YURQ_BACSU RecName: Full=Uncharacterized protein yurQ;
   38::120     6e-04  42%  193 aa  RUVA_BURCJ RecName: Full=Holliday junction ATP-dependent DNA
  148::212     6e-04  38%  215 aa  FAP24_HUMAN RecName: Full=Fanconi anemia-associated protein of 24
  507::572     8e-04  36%  648 aa  YEGI_ECOLI RecName: Full=Uncharacterized protein yegI;
  505::570     8e-04  36%  646 aa  YEGI_ECO57 RecName: Full=Uncharacterized protein yegI;
   72::130     8e-04  39%  202 aa  RUVA_DESMR RecName: Full=Holliday junction ATP-dependent DNA
  644::695     8e-04  40%  708 aa  HELS_PYRCJ RecName: Full=Putative ski2-type helicase;       
  116::208     8e-04  31%  215 aa  FAP24_BOVIN RecName: Full=Fanconi anemia-associated protein of 24
  520::562     8e-04  37%  669 aa  DNLJ_MICAN RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
    1::656

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTVRPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWT
UVRC_THEFY      MTVRPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWT
UVRC_BEUC1      -----TYRPRPGEIPDAPGVYRFRDPHGRVVYVGKAKSLRSRLSSYFQDLSALHPRTQQMVTTASSVEWT
UVRC_STRAW      -------RPKPGEIPDSPGVYKFRDEHHRVIYVGKAKSLRQRLASYFQDLAGLHPRTRTMVTTAAXXXXX
UVRC_RENSM      -------RPKTGEIPTDPGVYRFRDEHGRVIYVGKAKNLRSRLTSYFANPVTLLPKTFAMVHTATSVQWT
UVRC_ARTCA      -------RPRTGEIPTNPGVYRFRDPHGRVIYVGKAKSLRSRLNSYFANPAGLLPKTYAMVHAASSVEWT
UVRC_STRCO      -------RPRPGEIPDSPGVYRFRDEHRRVIYVGKAKSLRQRLANYFQDLAHLHPRTRTMVTTAAXXXXX
UVRC_NOCFA      -----TYRPAPGTIPVEPGVYKFRDSYGRVIYVGKAKSLRSRLNSYFADVASLHPRTKQMVTTAAXXXXX
UVRC_MYCPA      -----TYRPAPGSIPVEPGVYRFRDPHGRVIYVGKAKSLRSRLTSYFADVANLHPRTRQMVTTAAKVEWT
UVRC_FRASN      -------RPPPGSIPETPGVYRFRDEHGRVIYVGKAKSLRARLANYFADIHTLHPRTQHMVTTAGXXXXX
UVRC_MYCTU      -----TYRPAPGSIPVEPGVYRFRDQHGRVIYVGKAKSLRSRLTSYFADVASLAPRTRQLVTTAAKVEWT
UVRC_MYCTA      -----TYRPAPGSIPVEPGVYRFRDQHGRVIYVGKAKSLRSRLTSYFADVASLAPRTRQLVTTAAKVEWT
UVRC_MYCBT      -----TYRPAPGSIPVEPGVYRFRDQHGRVIYVGKAKSLRSRLTSYFADVASLAPRTRQLVTTAAKVEWT
UVRC_MYCBP      -----TYRPAPGSIPVEPGVYRFRDQHGRVIYVGKAKSLRSRLTSYFADVASLAPRTRQLVTTAAKVEWT
UVRC_MYCBO      -----TYRPAPGSIPVEPGVYRFRDQHGRVIYVGKAKSLRSRLTSYFADVASLAPRTRQLVTTAAKVEWT
UVRC_PROAC      -------RPAPGTIPTQPGVYRFSDAHGQVIYVGKAKNLRNRLNSYFQDISALHPRTQRMVTTAAHVQWT
UVRC_SALTO      -------RPAPGTIPESPGVYRFRDGTGRVIYVGKARNLRNRLNSYFADPVNLHQRTRQMVFTAESVDWI
UVRC_ACIC1      ----PQLRPAAGEIPESPGVYRFWDAHDRVIYVGKAKNLRARLTSYFADPALLHPRTRAMVTAAARLDWV
UVRC_SALAI      -------RPAPGTIPESPGVYRFRDGTGRVIYVGKARNLRSRLNSYFADPVNLHQRTRQMVFTAESVDWI
UVRC_FRASC      -------RPAPGSIPETPGVYRFRDEHGRVLYVGKAKNLRARLANYFAELHTLHPRTQHMVSSASSVDWT
UVRC_COREF      -----TYRPAPGTIPTEPGVYKFRDDARRVIYVGKAKNLRARLSNYFQDVTQLHPRTRQMVFAASSVEWT
UVRC_MYCA9      -----TYRPAPGSIPVEPGVYRFRDPHGRVIYVGKAKSLRSRLTSYFADITGLHPRTRQMVTTAGSVEWT
UVRC_MYCLE      -----TYRPATGSIPVEPGVYRFRDPYGRVIYVGKAKSLRSRLASYFADVANLHPRTRQMVTIAAKVEWT
UVRC_MYCLB      -----TYRPATGSIPVEPGVYRFRDPYGRVIYVGKAKSLRSRLASYFADVANLHPRTRQMVTIAAKVEWT
UVRC_MYCMM      -----TYRPAPGSIPVEPGVYRFRDPHGRVIYVGKAKSLRSRLTSYFADIAHLQPRTRQMVTTAAKVEWT
UVRC_ARTAT      -------RPQTGEIPTTPGVYRFRDPHGRVIYVGKAKNLRSRLNSYFANPAGLLPKTHAMVHAASSVEWT
UVRC_MYCGI      -----TYRPAPGSIPVEPGVYRFRDPHGRVIYVGKAKSLRSRLNSYFADISGLAPRTRQMVMTASSVEWT
UVRC_ARTS2      -------RPQTGEIPTNPGVYRFRDPHGRVIYVGKAKSLRSRLNSYFANPGGLLPKTYAMVHAASSVEWT
UVRC_RHOE4      -----TYRPATGTIPAAPGVYKFRDPHGRVIYVGKAKSLRSRLNSYFADVTTLHPRTRQMVTTAGXXXXX
UVRC_MYCSS      -----TYRPAPGSIPVEPGVYRFRDPHGRVIYVGKAKSLRSRLNSYFADLSGLAPRTRQMVMTAAKVEWT
UVRC_MYCSK      -----TYRPAPGSIPVEPGVYRFRDPHGRVIYVGKAKSLRSRLNSYFADLSGLAPRTRQMVMTAAKVEWT
UVRC_MYCSJ      -----TYRPAPGSIPVEPGVYRFRDPHGRVIYVGKAKSLRSRLNSYFADLSGLAPRTRQMVMTAAKVEWT
UVRC_SACEN      -----TYRPAPGTIPDAPGVYRFHDAEGRVIYVGKAKSLRSRLSSYFADLSGLHPRTRQMVTTATGVRWT
UVRC_KOCRD      -------KPARQDIPTNPGVYRFRDEHGRVIYVGKAKNLRNRVSSYFAPLHQLAPKTRXXXXXXXXXXXX
UVRC_CORJK      -------RPEPGSIPTDPGVYTFRDAHERVIYVGKAKNLRARLSNYFQDLDQLHPRTRAMVQSANHVQWT
UVRC_RHOSR      -----TYRPATGTIPVDPGVYKFRDPHGRVIYVGKAKSLRSRLNSYFADVSTLHPRTRQMVTTAGXXXXX
UVRC_RHOOB      -----TYRPATGTIPVDPGVYKFRDPHGRVIYVGKAKSLRSRLNSYFADVSTLHPRTRQMVTTAGXXXXX
UVRC_MYCVP      -----TYRPAPGSIPVEPGVYRFRDPHGRVIYVGKAKSLRSRLNSYFADLSGLAPRTRQMVMTAAXXXXX
UVRC_CORDI      -----TYRPAPGTIPTEPGVYKFRDPEGRVIYVGKAINLRSRLSNYFQDLSVLHPRTRQMVTTATSVEWT
UVRC_MYCS2      -----TYRPAPGSIPVEPGVYRFRDPHGRVIYVGKAKSLRSRLTSYFADITSLAPRTRQMVMTAGSXXXX
UVRC_CORA7      -------RPAPGSIPTDPGVYKFRDENRRVIYVGKAKNLRARLSNYFQDITQLHPRTRQMVLTAASVEWT
UVRC_CORGB      -----TYRPAPGTIPTEPGVYKFRDENRRVIYVGKAKNLRSRLSNYFQDVTQLHPRTRQMVFXXXXXXXX
UVRC_CORGL      -----TYRPAPGTIPTEPGVYKFRDENRRVIYVGKAKNLRSRLSNYFQDVTQLHPRTRQMVFXXXXXXXX
UVRC_LEIXX      -------RPKAGEIPTQPGVYRFRDKTRRVLYVGKAKNLRARLSNYFQPLRSLHERTRRMVTTAASVEWT
UVRC_BIFLO      ---RDLFRPKTSDIPAKPGVYKWRDGEGRVIYVGKAKNLRNRLTNYFQPLYLLHPRTQTMVLTARSLEWT
UVRC_BIFLD      ---RDLFRPKTSDIPAKPGVYKWRDGEGRVIYVGKAKNLRNRLTNYFQPLYLLHPRTQTMVLTARSLEWT
UVRC_STRGG      -------RPKPGQIPDSPGVYKFRDEHRRVIYVGKAKNLRQRVANYFQDLANLHPRTRTMVTTAAXXXXX
UVRC_SYMTH      -------------LPDRPGCYLFKDASGRIIYVGKARNLKNRVRQYFQSSRNLTAKVLAMVGQIVEIEHI
UVRC_ALKOO      ------LKEKLRTLPEKPGVYMMRNDKNEIIYVGKAISLKNRVRQYFQSSKNHPPKVKAMVSHIVTFEYI
UVRC_DEHE1      -----TLQNQIASLPENPGVYLMKNAQGEIIYVGKAAVLKDRVKSYFVPPSRLEPKTRQLVSQINELEYL
UVRC_CARHZ      -----TLWEKVKNLPDSPGVYLYKDEKGEVIYVGKAKNLKNRVRSYFQPPEKLLPKTRVMMEKARDIEVI
UVRC_CLOAB      ------------NLPDKPGVYIMKNSLGEVIYVGKAKILKNRVRQYFRNSKNHSEKVKAMVKNISEFEYI
UVRC_CLOTE      -------------LPEKPGVYLMKNSSDEVIYVGKAKILKNRVKQYFQQSKNHSEKVRVMVSNIAEFEYI
UVRC_DEHSC      -----TLQNQIASLPENPGVYLMKNAQGEIIYVGKAAVLKDRVKSYFVPPSRLTPKTCQLVSQINELEYL
UVRC_DEHSB      -----TLQNQIASLPENPGVYLMKNAQGEIIYVGKAAVLKDRVKSYFVPPSRLTPKTCQLVSQINELEYL
UVRC_ALKMQ      -------------LPDKPGVYLMKNKANEIIYVGKAISLKNRVRQYFQSSNNQHPKVRAMVTHINFFEYI
UVRC_CLOTH      -------------LPDKPGVYIMKDENGEIIYVGKAVVLKNRVRQYFQSLSNQTPKVRAMVAHIKEFEYI
UVRC_TROW8      --------PRRIEIPCKPGVYRFEDENGRILYVGKAKNLRNRLGSYFTN-ARRGRRISYMLSISKKVGWT
UVRC_TROWT      --------PRRIEIPCKPGVYRFEDENGRILYVGKAKNLRNRLGSYFTN-ARRGRRISYMLSISKKVGWT
UVRC_EUBE2      -------------LPAKPGVYIMHDKWDNIIYIGKAKVLKNRVRQYFQSNRNKSAKIVQMVSHIQYFEYI
UVRC_CLOPS      -------------LPDKPGVYIMKNSLGEVIYVGKAKVLKNRVRQYFQNSKNHSEKVRAMVKNIAEFEYI
UVRC_MOOTA      ------LEEKLARLPDHPGVYIMHDANGAIIYVGKAASLRNRVRSYFR--GQHQPRTQAMVSHVADFEYI
UVRC_CLOP1      -------------LPDKPGVYIMKNSLGEVIYVGKAKVLKNRVRQYFQNSKNHSEKVRAMVKNIAEFEYI
UVRC_CLOPE      -------------LPDKPGVYIMKNSLGEVIYVGKAKVLKNRVRQYFQNSKNHSEKVRAMVKNIAEFEYI
UVRC_GLOVI      --------------PTSAGVYLMRDEAGEILYVGKAKNLRNRVRSYFQPGHDHSPRIAIMVGKVHDFELI
UVRC_CLOK5      -------------LPDKPGVYLMKNSLGEVIYVGKAKILKNRVRQYFQKSKNHSEKVRTMVKHISEFEYI
UVRC_GEMAT      -------------LPESPGVYLWKDVEGQVLYVGKAKRLRSRVRSYWAQEHESSPKTRAMVRKVRDLETI
UVRC_CLOCE      -------------LPDKSGVYIMKDANGVVIYVGKAVVLKNRVRQYFQQSANHPPKVQAMVSKVSEFEYI
UVRC_RUBXD      --------PDRSHLPASPGVYIFRDGEGRVLYVGKARNIRSRVASYFTRSGDGRPKIAELRERVRQIDFI
UVRC_SYNWW      ------LKERLKKVPLQPGVYLFKNQEGQVLYVGKARVLRQRMRSYFQAPERMHPKVKAMMAWVSDFDFI
UVRC_CLOB8      -------------LPNEPGVYLMKNSLGEIIYVGKAKILKNRVRQYFQNSKNHSEKVKAMVKNVAEFEYI
UVRC_METBU      ------MRPDISNIPELPGVYLMKDISDNIIYIGKAKSLKKRVSQYFQSSKNHSSKTRAMVRKIADVDYI
UVRC_THETN      ------------------GVYLMKDEEGNIIYVGKASVLKNRVRQYFQNTDNHPPKVKVMLSHVEDFEYI
UVRC_SYNJB      ---RDVLESRLKEIPAEPGVYLMRDATDQILYVGKSKKLRSRVRSYFRFTSDLSPRIQRMVAQVCEIEFI
UVRC_MICAN      -------------IPLEPGVYFLRDQNGEILYIGKSKKLRSRVRSYFRPSQPLSPRIALMVRQVTEIEFI
UVRC_PROA2      ---------KLSNLPTCPGVYQFKNNQGTIIYVGKAKNIRSRVRSYFREGPHISGKTKVLVNHIADIDII
UVRC_DESAA      ------IEKKLATLSNGPGVYLMKDESGEIIYVGKARSLKKRVSSYFLEKPNRDLKTGILVKKIASFDAI
UVRC_CYAP4      -------------IPAEPGVYFMRDSQDQILYIGKSKKLRSRVRSYFRKFNELGPRLELMVRQVAEIEFI
UVRC_ALHEH      ------------SLTQRPGVYRMVDGRGEVLYVGKARNLKKRVASYFTR-SRKSARIELMLTQVQDIQVT
UVRC_THICR      -----------------PGVYLMYDASGQIIYVGKAKNLKRRVSSYFKKRHE-EIKTETLVSQVASIEVT
UVRC_ALCBS      -----------------PGVYRMLDAEGGVLYVGKARNLQARLNSYFQK-NVASVKTRALVGRIRDIQTT
UVRC_SYNJA      -------------IPAEPGVYLMRDATDQILYVGKSKKLRSRVRSYFRFTGDLSPRIQRMVVQVCEIEFI
UVRC_RHOS4      -----------------PGVYRMLDAQSQVLYVGKARNLRARVSNYARP-SGHSGRIARMIRETASMMFX
UVRC_CHLTE      -TAKSALAEKLATLPTSPGVYRFSNAAGTVIYVGKARNLRNRVRSYFNSQGRQPGKTAVMVSHIADLNVI
UVRC_PSEMY      -----------------PGVYRMFDADARLLYVGKAKNLKKRLSSYFRK-TGQAPKTAALVARIAQVETT
UVRC_NOSP7      ------LENRLAEIPPEPGVYFMRDNSDRIIYIGKSRKLRSRVRSYFRDGYNKTERIATMVKLVTEIEFI
UVRC_PELLD      -TTLPELRETVASLPTGPGIYQFKNSAGKVIYVGKAKNIRSRVRSYFRDPRQLTGKTQVLVGHITDLEII
UVRC_ACIBL      ------LHQKIRTLPTSPGVYLYKNAEGEIIYVGKAKNLRSRVGSYFVRGADENSKTGSLLREAVDVEYI
UVRC_CHLCH      --IKKVLTEKLATLPTSPGIYQFKNSAGRIIYVGKAKNLRNRVRSYFRNSHQLFGKTLVLVSHIDDLEVI
UVRC_THEP3      -----TIEEKLKLLPEKPGVYIMKDKSGKIIYVGKAVVLKNRVRQYFQNKEKQLPKVKVMLSHVEDFEYI
UVRC_PSEA7      -----------------PGVYRMFDADAKLLYVGKAKSLKKRLASYFRK-SGLAPKTAALVVRIAQVETT
UVRC_THEPX      -----TIEEKLKLLPEKPGVYIMKDKSGKIIYVGKAVVLKNRVRQYFQNKEKQLPKVKVMLSHVEDFEYI
UVRC_DESAP      --------------PDKPGVYLFRGARGEVLYVGKAVSLKNRVRSYFT--GARSDKVQALVGKTRDVECL
UVRC_METFK      ------------------GVYRMINAQDEVIYVGKARDLKKRVSSYFQK-NLPSARTRLMVSNIARIETT
UVRC_GEOMG      ------------TLPESPGVYLMKGSDGTILYVGKAKSLRKRVRSYFGAAGESRYHIRFLVARVAEVEVI
UVRC_PSEAE      -----------------PGVYRMFDAEAKLLYVGKAKSLKKRLASYFRK-SGLAPKTAALVARIAQVETT
UVRC_PSEAB      -----------------PGVYRMFDADAKLLYVGKAKSLKKRLASYFRK-SGLAPKTAALVARIAQVETT
UVRC_PSEA8      -----------------PGVYRMFDADAKLLYVGKAKSLKKRLASYFRK-SGLAPKTAALVARIAQVETT
UVRC_SYNAS      --------------PRTPGVYLMKDAAGKILYVGKAKNLKSRTRAYFSDSRAMIP---FLVSRIHDIEFI
UVRC_MAGSA      ------------TLPLSPGVYRMLSGKGDVLYVGKAKSLKKRVVAYTRP-DRMPLRIQRMIAETASMEVV
UVRC_CLOPH      -------------LPAKPGVYIMHNNKDEIIYVGKAISLKNRVRQYFQSSRNLSTKIQQMVSNIDHFEYI
UVRC_NITOC      -----------------PGVYRMLDAKGKVLYVGKAKNLKRRIKSYFRN-SKLAPKIHVLVKQICDIKIT
UVRC_METST      ----------PDEVPQKPGVYIMHNKEDEVIYVGKAKKLKSRLQSYFRDEDKLRPKTQFLMRHFSYFEYI
UVRC_ANASP      ------LEARLSEIPPEPGVYFMRDGSDRIIYIGKSRKLRSRVRSYFREGYNKTERIATMAKLVTEIEFI
UVRC_YERPS      ------------TVTSQPGVYRMYDTAGTVIYVGKAKDLKKRLTSYFRAQVA-NRKTETLVKNIAQIDVT
UVRC_PELPB      ---KKALVEKLGTLPPSPGVYQFRNSSGRVIYVGKAKNLRNRVRSYFRNQQQLYGKTLVLVTHIADFEVI
UVRC_GEOSL      ------------TLPDAPGVYLMKGNGGDILYVGKAKSLRKRVRSYFSKGGESRYHIRFLVGRVADIDVI
UVRC_YERE8      ------------TVTSQPGVYRMYDKAGTVIYVGKAKDLKKRLTSYFRAHVASR-KTETLVKNIAQIDVT
UVRC_CLONN      -------------IPEKPGVYLMKNSLGEVIYVGKAKVLKNRVRQYFQNSKNHGSKVRAMVKNIAEFEYI
UVRC_CLOBM      ------------NLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKSQKHSEKVKAMVKNIEEFEYI
UVRC_YERPN      ------------TVTSQPGVYRMYDTAGTVIYVGKAKDLKKRLTSYFRAQVA-NRKTETLVKNIAQIDVT
UVRC_YERPE      ------------TVTSQPGVYRMYDTAGTVIYVGKAKDLKKRLTSYFRAQVA-NRKTETLVKNIAQIDVT
UVRC_YERPA      ------------TVTSQPGVYRMYDTAGTVIYVGKAKDLKKRLTSYFRAQVA-NRKTETLVKNIAQIDVT
UVRC_YERP3      ------------TVTSQPGVYRMYDTAGTVIYVGKAKDLKKRLTSYFRAQVA-NRKTETLVKNIAQIDVT
UVRC_PSEFS      -----------------PGVYRMFDSEARLLYVGKAKNLKNRLASYFRK-SGLAPKTAALVARIAQVETT
UVRC_GLUOX      ------------TIPYSPGVYRMLSEKGEVLYVGKALSLKKRVSSYIR-INQLPERLRRMVSMTVSMEIV
UVRC_CLOBK      ------------NLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKSQKHSEKVKAMVKNIEEFEYI
UVRC_AZOVD      -----------------PGVYRMLDAKGELLYVGKAKNLRKRLSSYFRT-SGLAPKTAALVARIAQVETT
UVRC_PSE14      -----------------PGVYRMFDAEATLLYVGKAKNLKKRLASYFRK-TGHAPKTGALVSRIAQIETT
UVRC_CLOBL      ------------NLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKSQKHSEKVKAMVKNIEEFEYI
UVRC_CLOBJ      ------------NLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKSQKHSEKVKAMVKNIEEFEYI
UVRC_BDEBA      ------VRDKVKEFPTQSGVYLMKNTADKIIYIGKAKNLRNRVRSYFNDSKDHSPKTRLLVSNICEVEYI
UVRC_PSEU2      -----------------PGVYRMFDAEATLLYVGKAKNLKKRLASYFRK-TGHAPKTGALVSRIAQIETT
UVRC_PSEE4      -----------------PGVYRMFDAEARLLYVGKAKNLKKRLASYFRK-TGLAPKTAALVGRIAQVETT
UVRC_METCA      -----------------PGVYKMLDRNGEVIYVGKAKNLKKRVASHFAQRGS-SPKQNAMVARVQAIEVT
UVRC_SALHS      ------------TVTSQPGVYRMYDAGGAVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVT
UVRC_CLOBH      ------------NLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKSQKHSEKVKAMVKNIEEFEYI
UVRC_CLOB1      ------------NLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKSQKHSEKVKAMVKNIEEFEYI
UVRC_SACD2      -----------------PGVYQMYDADGAILYVGKAKNLKNRLSSYFRA-TGLTPKTHALVKRIQAIEVT
UVRC_CITK8      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVT
UVRC_ANASK      ------LRRKLDELPAEPGCYLMKDRAGEVVYVGKASSLRSRVRSYFDPGRGDQRAFVALLDELGDLEVI
UVRC_ESCF3      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVT
UVRC_ANADE      ------LRRKLDELPAEPGCYLMKDRAGEVVYVGKASSLRSRVRSYFDAGRGDQRAFVALLDLLGDLEVI
UVRC_ERWCT      ------------TVTSQPGVYRMYDAGNTVIYVGKAKDLKKRLASYFRSHVASR-KTEALVKSIKHIDVT
UVRC_DICNV      -------------VSTLSGVYQMRDQNGTVLYVGKAKNLRQRLSHYFQK-TGLSVKTRALMRAVYDIQTT
UVRC_CLOB6      ------------NLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKSQKHSEKVKAMVKNIEEFEYI
UVRC_SALPK      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVT
UVRC_SALPA      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVT
UVRC_PARUW      --------------PTLPGVYLMKNEEGEVLYVGKAKNLRQRVKQYFVPGRDGRLMIPYLVAKINYIETI
UVRC_SALTY      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVT
UVRC_SALTI      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVT
UVRC_SALPB      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVT
UVRC_PSEPF      -----------------PGVYRMFDSDARLLYVGKAKSLKKRLASYFRK-TGLAPKTAALVGRIAQVETT
UVRC_SYNS3      -------------IPTEPGCYLMRDADDRLLYVGKSKTLRSRVRSYFRSSHDLSPRIRLMVRQICEIEFI
UVRC_SALNS      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVT
UVRC_SALG2      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVT
UVRC_SALRD      ---------KLDALPTDPGVYKFLDDEESVLYVGKAKNLRNRVRTYFQQSRQRDGRIEVMVQKAVDVDII
UVRC_SALEP      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVT
UVRC_SALDC      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVT
UVRC_SALA4      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVT
UVRC_PSEP1      -----------------PGVYRMFDGEARLLYVGKAKNLKKRLASYFRK-AGLAPKTAALVARIAQVETT
UVRC_LEPBL      -----------------PGCYLWKSRKGEVLYIGKAKNLDKRVRNYLKEN---HPKTRALQKEIFDLDWI
UVRC_LEPBJ      -----------------PGCYLWKSRKGEVLYIGKAKNLDKRVRNYLKEN---HPKTRALQKEIFDLDWI
UVRC_DESPS      ------------STPHKPGVYLMLDAKARVIYVGKAKDLVKRLTSYTRHSSSEHNKTTVMLKKVEQVKTI
UVRC_ANAD2      ------LRRKLDELPAEPGCYLMKDRAGEVVYVGKASSLRSRVRSYFDPGRGDQRAFVALLDELGDLEVI
UVRC_SALSV      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVT
UVRC_SALPC      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVT
UVRC_SALCH      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVT
UVRC_PSEPK      -----------------PGVYRMFDGEARLLYVGKAKNLKKRLASYFRK-TGLAPKTAALVARIAQVETT
UVRC_LEGPL      -------------LPSEPGIYRMLDEEGTVLYVGKAANLKKRVNSYFSKQNT-GVKTRALVSQIKSIEIS
UVRC_GRABC      -------------LPDRPGVYRMLDGQGEALYVGKARSLKKRVASYTQ-IHRLPERLRRMVSETVSMEIV
UVRC_CHLPD      ---------KVASLPSSPGVYQFKNAQGRVIYIGKAKNLRNRVRSYFRNPQQLFGKTLVMVGKIADIEVI
UVRC_GEOLS      ------LRDSIRSFPTAPGVYLMRDATGTILYVGKARNLRQRVSNYFGATDG-RPQVRFLMARVTSIEFT
UVRC_ECO45      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVT
UVRC_ANAVT      ------LEARLSEIPPEPGVYFMRDGSDRIIYIGKSRKLRSRVRSYFREGYNKTERIATMAKLVTEIEFI
UVRC_JANSC      ------------TLDMSPGVYRMLDSQSRVLYVGKARALKRRVASYAKP-SGHSPRIARMIRDTASMMFX
UVRC_PSEPW      -----------------PGVYRMFDSETRLLYVGKAKNLKKRLASYFRK-TGLAPKTAALVGRIAQVETT
UVRC_PROMT      MELTPLIRDKSRDIPNDPGCYLMKDGEDRLLYVGKSKKLRNRVRSYFRSGNELSPRISLMVRQVADIELI
UVRC_PROM1      -------------IPNDPGCYLMKDGEDRLLYVGKSKKLRNRVRSYFRSGNELSPRISLMVRQVADIELI
UVRC_SILPO      -----------------PGVYRMLDAQARVLYVGKARNLKARVSNYARPGHS--PRIERMIRETASMMFX
UVRC_LEGPA      -------------LPSEPGIYRMLDEEGTVLYVGKAANLKKRVNSYFSKQNT-GVKTRALVSQIKSIEIS
UVRC_PROMP      ------LKSRLSEIPKSSGCYLFKDIDNNLLYIGKSKTLRNRVSSYFNNYAELSPRLSLMVRQITEIEII
UVRC_PROMM      -------------IPAEPGCYLMRDVEDRLLYVGKSKCLRNRVRSYFRSSSDHGPRIRLMVRQIAEIEFI
UVRC_LEGPH      -------------LPSEPGIYRMLDEEGTVLYVGKAANLKKRVNSYFSKQNT-GVKTRALVSQIKSIEIS
UVRC_ECOK1      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVT
UVRC_TRIEI      -------------IPQTPGVYLMRDRSDRILYIGKSKKLRNRVRSYFRDGKNHTHRISLMIQQIVEIEFI
UVRC_MESSB      -------------LPNAPGVYRMVNTEGDVLYVGKARSLKKRVTNYAQGRGHSN-RIERMIRETATMEFV
UVRC_ECOUT      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVT
UVRC_ECOSM      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVT
UVRC_SODGM      ------------TVTSQPGVYSMYDLSGTVIYVGKAKDLKKRLASYFRAQVASR-KTEALVKSIHHIDVT
UVRC_SHISS      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVT
UVRC_SHIB3      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVT
UVRC_ECOSE      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVT
UVRC_ECOLU      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVT
UVRC_ECOLI      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVT
UVRC_ECOLC      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVT
UVRC_ECOL6      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVT
UVRC_ECOHS      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVT
UVRC_ECODH      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVT
UVRC_ECOBW      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVT
UVRC_ECO8A      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVT
UVRC_ECO81      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVT
UVRC_ECO7I      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVT
UVRC_ECO5E      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVT
UVRC_ECO57      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVT
UVRC_ECO55      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVT
UVRC_ECO27      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVT
UVRC_ECO24      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVT
UVRC_LEGPC      -------------LPGEPGIYRMLDEEGTVLYVGKAANLKKRVNSYFSKQNT-GVKTRALVSQIKSIEIS
UVRC_NEIMA      ------------NLPKLPGVYRFFDEGGKVLYVGKAVNLKRRVSGYFQK-NDHSPRIALMVKQVHHIETT
UVRC_CALS8      -----TLQEKLANLPTTPGVYMMKDENGKVIYVGKAVNLRNRVRQYFQN-SDMTPKTRLMVKKIKDFEYI
UVRC_ERWT9      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRGNLGSR-KTEALVALIEQIDVT
UVRC_DESAH      ----PSVLERYQSAPQNPGVYLMKDKRGTIIYVGKALNLKKRLASYFARETGHDMKTGVLLKKVVDFDLI
UVRC_KLEP3      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVALIAQIDVT
UVRC_LEPIC      ------------NLGASPGCYLWKSKKGEVLYVGKAKNLDKRVRSYLKEN---HPKTKVLQREIFDLDWI
UVRC_ACIBY      ---RPHIEKILANLTQLPGVYKMLGKEGELLYVGKAKNLKNRVSSYFVK-TIEHPKTQALVARIYDIETL
UVRC_SYNP6      -------------LPAEPGVYFMRDASDRILYIGKSKKLRSRVRSYFRDLERLNPRINLMVRQVCEIEII
UVRC_SYNE7      -------------LPAEPGVYFMRDASDRILYIGKSKKLRSRVRSYFRDLERLNPRINLMVRQVCEIEII
UVRC_SHEHH      ------------TVTSSPGVYRMYDAKAVVIYVGKAKDLKKRLSSYFRK-NLTNVKTQALVSHIANIDVT
UVRC_PHOLL      ------------TVTSQPGVYRMYDTSGTVIYVGKAKDLKKRLASYFRA-QVTSRKTESLVKNIVQIDVT
UVRC_MYXXD      ------LLEKLDALPTEPGVYLMKDRRGQVIYVGKAINLRSRVRSYFNRTGDTRVFVSLLDQLLGDLETV
UVRC_NITEC      ------------TLPSQPGVYRMLNAAGDVIYVGKAIDLRKRVSSYFQK-SNLSPRIQLMVSQITGIETT
UVRC_IDILO      -----------------PGVYRMYDESGDVIYVGKAKDLRKRVSSYFRE-KVDRMKTQVLVKQIASMDVT
UVRC_NITMU      -------------LPSQPGVYRMMNSAGQVIYVGKAIDLKKRVSSYFQK-NGLAPRTQLMVSQIAGIETT
UVRC_LEPIN      ------------NLGASPGCYLWKSKKGEVLYVGKAKNLDKRVRSYLKEN---HPKTKVLQREIFDLDWI
UVRC_ACIBS      ---RPHIEKILANLTQLPGVYKMLGKEGELLYVGKAKNLKNRVSSYFVK-TIEHPKTQALVARIYDIETL
UVRC_HAHCH      -------------LTTRPGVYRMMDARGEVLYVGKARNLKNRVSSYFRN-TGVSIKTRALVEKIADIEIT
UVRC_ACAM1      ---RDRLEARLKEIPPEPGVYFMRDANDDILYIGKSKKLRNRVRSYFRQIQDHPPRIELMVHQVADIEFI
UVRC_PELCD      --------------PTASGVYLMKGEAGTVFYVGKAKNLRSRLRSYFSEHGDNRPQIRFLLKRVHDIETI
UVRC_ACTSZ      ------------NVPHDPGVYRMFDKTDTVIYVGKAKDLKKRLSSYFRP-NLSSKKTEALVAXXXXXXXX
UVRC_SILST      ------------TLDSSPGVYRMLDHESRVLYVGKARNLRARVSNYTRPGHT--QRIETMISQTSRMMFX
UVRC_BORA1      -------------LPHLPGVYRHLDAAGEVMYVGKARDLKKRVSSYFQKTLA-SPRIAQMVSKVVRLEVT
UVRC_PROMH      -------------VTSQPGVYRMYDASGTVIYVGKAKDLKKRLSSYFRA-QVNSRKTEALVKCIANIDVT
UVRC_ZYMMO      ------------TLPLRPGVYRMYDSKGNILYVGKARALRNRVANYTQ-ISGLSRRIQRMVSQTRSMTIV
UVRC_NEIG1      ------------NLPKLPGVYRFFDEGGNVLYVGKAVNLKRRVSGYFQK-NDHSPRIALMVKQVRHIETT
UVRC_ACIC5      ------LQEKIRTLPTGPGVYLYKNADGEVIYVGKAKNLRSRVRSYLLEASQANAKTGSLMREAVDLDYI
UVRC_PHOPR      ------------TVTHQPGVYRMYDAVGDVIYVGKAKDLKKRLSSYFR-INVAGEKTRALVKNICKVDVT
UVRC_ACIAD      ---RPHIEKILANMTQLPGVYRMLGKDGELLYVGKAKNLKNRVSSYFVK-TIEHPKTQALVARIHDIETL
UVRC_SHESH      ------------TVSSSPGVYRMYDEEGTVIYVGKAKDLKKRLSSYFR-VNLPNVKTQALVSHIANIDVT
UVRC_SHEPA      ------------TVTSSPGVYRMYDAKDAVIYVGKAKDLKKRLSSYFRKNLA-NVKTQALVSHIANIDVT
UVRC_PASMU      ------------NVSHDAGVYRMYDEKDTVIYVGKAKDLKKRLSSYFRTHLS-SKKTEALVSAIARIDTT
UVRC_ENTS8      ------------TVTSQPGVYRMYDASGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIHNIDVT
UVRC_CLOD6      -------------LPSEPGVYLMKDKYDHIIYVGKAISLKNRVRQYFQSSKNHTSKVKSMVKNIYKFEYI
UVRC_SHEPW      ------------TVTSSPGVYRMYDVDNIVIYVGKAKDLKKRLSSYFRK-NLTNVKTQALVARIANIDVT
UVRC_HAEI8      ----------------EPGVYRMYDDKDQVIYVGKAKDLKKRLSSYFRK-NLSSKKTEALVASIHHIDTM
UVRC_CHRVO      ------------NLPTLPGVYRMLDAAGKVLYVGKAIDLKRRVSSYFQK-NDLSPRIQLMVRQIASIETT
UVRC_BRUME      -------------LPNNPGVYRMFNSDGGVLYVGKARNLKKRVSNYARGIGHSN-RITRMIRETVTMEFV
UVRC_BRUAB      -------------LPNNPGVYRMFNSDGGVLYVGKARNLKKRVSNYARGIGHSN-RITRMIRETVTMEFV
UVRC_BRUA2      -------------LPNNPGVYRMFNSDGGVLYVGKARNLKKRVSNYARGIGHSN-RITRMIRETVTMEFV
UVRC_SHEFN      ------------NVTSAPGVYRMYDKHQQVIYVGKAKDLKKRLSSYFR-VNIANVKTQALVSHIDHIDVT
UVRC_NEIMB      ------------NLPNLPGVYRFFNESGNVLYVGKAVNLKRRVSGYFQK-NDHSPRIALMVKQVHHIETT
UVRC_METTH      ----------PEKLPDATGVYIFRDRDDRVLYVGKSISIRKRVSSYFREQE--NPRLRIMMRHLESIEYI
UVRC_BRUSU      -------------LPNNPGVYRMFNSDGDVLYVGKARNLKKRVSNYARGIGHSN-RITRMIRETVTMEFV
UVRC_GEOKA      ------LKEKLAVLPEQPGCYLMKDKHGTVIYVGKAKSLKARVRSYF---TGTHDKTQRLVEEIADFEYI
UVRC_SHESM      ------------TVSSSAGVYRMYDVKGDVIYVGKAKDLKKRLSSYFRK-NLGNVKTQALVSHIHHIDVT
UVRC_SHEON      ------------TVTSSAGVYRMYDVKGDVIYVGKAKDLKKRLSSYFRK-NLGNVKTQALVSHIHHIDVT
UVRC_PSEFL      -----------------PGVYRMFDSDTRLLYVGKAKNLKSRLASYFRK-TGLAPKTAALVGRXXXXXXX
UVRC_HAEIE      ----------------EPGVYRMYDDKDQVIYVGKAKDLKKRLSSYFRK-NLSSKKTEALVASIHHIDTM
UVRC_PSESM      -----------------PGVYRMFDADATLLYVGKAKNLKKRLASYFRK-TGHAPKTGALVARXXXXXXX
UVRC_EDWI9      ------------TVTNQPGVYRMYDAGAEVIYVGKAKDLKKRLSSYFRCQLASR-KTEALVRQIAQIDVT
UVRC_SOLUE      ------LRDKVGQLPFSPGVYLYKDSGGKVIYVGKAKSLRNRVRSYFSEDKLGDIKTGTLITEACDIDYI
UVRC_SHESA      -------------VSSSAGVYRMYDVKGDVIYVGKAKDLKKRLSSYFRK-NLGNVKTQALVSHIHHIDVT
UVRC_NOVAD      -----TLKPKPG-------VYRMLDARGDVLYVGKARALKNRVANYTQ-VERLPNRLRRMVSQTRSMTIV
UVRC_SHESR      ------------TVSSSAGVYRMYDVKGDVIYVGKAKDLKKRLSSYFRK-NLGNVKTQALVSHIHHIDVT
UVRC_BURM1      -------------LPHMPGVYRYYDAAGAVLYVGKARDLKKRVSSYFTK-TQLSPRIAMMVTRIARIETT
UVRC_BACLD      ------IKEKLALLPDQPGCYLMKDRQDTVIYVGKAKILKNRVRSYFS--GSHDAKTQRLVSEIEDFEYI
UVRC_SYNY3      -----------------PGVYFMGDRQGEILYIGKAKKLRTRVRSYFRDSQPHTARIALMVQQVAEIEFI
UVRC_DICT6      ------LKQKVENFPESTGVYIFYDHSGKVIYVGKAKNLRKRVLSYFNDDS---PKSNYILKKAKNIEFY
UVRC_FINM2      -------------VPHKPGVYIMHDKNDEIIYVGKAIDLRRRVGQYF-DSSKKLAKVAAMVSHVEYFEYI
UVRC_SHELP      ------------TVSSSAGVYRMYDAQGVVIYVGKAKDLKKRLSSYFRR-NLPNVKTQALVSHIANIDVT
UVRC_POLSJ      -----------------PGVYRYFDAEGGVLYVGKARNLKKRVSSYFQKNHGA-TRIGHMVTKIVRMETT
UVRC_CAUCR      -------------LPDAPGVYRMIGEADEVLYVGKAKSLKKRVVQYAQ--GRFHTRIANMVDATRAMEFI
UVRC_SERP5      ------------TVTSQPGVYRMYDATGTVIYVGKAKDLKKRLASYFRQQVGSR-KTETLVKNIAQIDVT
UVRC_OCEIH      ------IEKKLSILPQQPGCYLMKDKNGTVIYVGKSKKLRNRVRSYFR--GANDRKTQRLVQEIRDFEYM
UVRC_THIDA      ------------SLPTLPGVYRMVDAAGAVLYVGKAKDLRKRVGSYFLKTDQ-SPRIRLMLKSVDHIDTT
UVRC_BACSU      ------LKEKLALLPDQPGCYLMKDRQQTVIYVGKAKVLKNRVRSYFT--GSHDAKTQRLVTEIEDFEYI
UVRC_BACA2      ------LKEKLALLPDQPGCYLMKDRQKTVIYVGKAKVLKNRVRSYFT--GSHDAKTQRLVSEIEDFEYI
UVRC_PROM9      ------LKSRLSEIPKSSGCYLFKDIDNNLLYIGKSKKLRSRVSSYFNNYSDLTPRLSLMVRQITEIEII
UVRC_LISMH      ------IQNKLALLPDQPGCYLMKDRQGTIIYVGKAKILKNRVRSYF---SGTHDKTQRLVQEIVDFEYI
UVRC_LISIN      ------IQNKLALLPDQPGCYLMKDRQGTIIYVGKAKVLKNRVRSYF---SGTHDKTQRLVQEIVDFEYI
UVRC_RHORT      --IRAALR----TMPSSPGVYRMIDGKGDVLYVGKARNLKRRVINYTQPHR-LPVRIQRMIAATLTMXXX
UVRC_GEOSF      -----------GHFPSSPGVYIMKDAEATVLYVGKARDLRKRIRSYFAASGDSRYQIRFLMARVTDIQFI
UVRC_SHEB9      ------------TVSSSAGVYRMYDVKNDVIYVGKAKDLKKRLTSYFRKNLA-NVKTQALVSHIHHIDVT
UVRC_RHILO      -------------LPNAPGVYRMMNAAGDVLYVGKARSLKKRVTNYAQ--GRFHTRIGRMVRETSTMEFV
UVRC_LISMO      ------IQNKLALLPDQPGCYLMKDRQGTIIYVGKAKILKNRVRSYF---SGTHDKTQRLVQEIVDFEYI
UVRC_LISW6      ------IQNKLALLPDQPGCYLMKDRQGTIIYVGKAKVLKNRVRSYF---SGTHDKTQRLVQEIVDFEYI
UVRC_SHEB8      ------------TVSSSAGVYRMYDVKNDVIYVGKAKDLKKRLTSYFRKNLA-NVKTQALVSHIHHIDVT
UVRC_LISMC      ------IQNKLALLPDQPGCYLMKDRQGTIIYVGKAKILKNRVRSYF---SGTHDKTQRLVQEIVDFEYI
UVRC_SHESW      ------------TVSSSAGVYRMYDVKGDVIYVGKAKDLKKRLSSYFRK-NLDNVKTQALVSHIHHIDVT
UVRC_PROM4      ------------TIPSEPGCYLMRDKNETLLYIGKSKSLKSRVRSYFNNNTALSPRISLMVRQVYDIEFI
UVRC_BREBN      -----SLKDKLAVLPDKPGCYLMKNASGEIIYVGKAKVLKNRVRSYFT--GSHNGKTQLLVSEIVDFEYI
UVRC_BARHE      -------------LPHKPGVYRMVDENGKVLYVGKARNLKKRVSNYTRE-QGHNNRITRMIRATSHMEFV
UVRC_SPHAL      -------------LPARPGVYRMLDARGDVLYVGKARALRNRVTSYTQ-VARLPQRLQRMVAQTRAMEIV
UVRC_SYNSC      -------------IPAEPGCYLMRDCDDRILYVGKSKALRSRVRSYFRSRHDLSPRIRLMTRQVCEIEFI
UVRC_LISMF      ------IQNKLALLPDQPGCYLMKDRQGTIIYVGKAKILKNRVRSYF---SGTHDKTQRLVQEIVDFEYI
UVRC_SHEB5      ------------TVSSSAGVYRMYDVKNDVIYVGKAKDLKKRLTSYFRKNLA-NVKTQALVSHIHHINVT
UVRC_BURS3      -------------LPHMPGVYRYYDTAGAVLYVGKARDLKKRVSSYFTK-TQLSPRIAMMVTRIARIETT
UVRC_SYNPX      LTQPEVLERRLKEIPPEPGCYLMRDGEDRILYVGKSKSLRSRVRSYFRSRHDLSPRIRLMTRQVCEIEFI
UVRC_SHEPC      ------------TVSSSAGVYRMYDVKGDVIYVGKAKDLKKRLSSYFRK-NLDNVKTQALVSHIHHIDVT
UVRC_PSEF5      -----------------PGVYRMFDSDARLLYVGKAKNLKNRLSSYFRK-TGQAPKTAALVARXXXXXXX
UVRC_HAEIN      ----------------EPGVYRMYDDKDQVIYVGKAKDLKKRLSSYFRK-NLSSKKTEALVASIHHIDXX
UVRC_COXBN      ------------TLPTGSGVYQIQDAQGKVIYVGKARNLQKRVSSYFR--RQLDSKTQAMMAQVQSIQTT
UVRC_BURCH      -------------LPHMPGVYRYYDTTGAVLYVGKARDLKKRVSSYFTK-TQLSPRIAMMVTRIARIETT
UVRC_BURCA      -------------LPHMPGVYRYYDTTGAVLYVGKARDLKKRVSSYFTK-TQLSPRIAMMVTRIARIETT
UVRC_ACTP7      -------------VPHLPGVYRMYDAKNTIIYVGKAKDLKKRLSSYFRSQLA-SKKTEALVANXXXXXXX
UVRC_ACTPJ      -------------VPHLPGVYRMYDAKNTIIYVGKAKDLKKRLSSYFRSQLA-SKKTEALVANXXXXXXX
UVRC_BURCC      -------------LPHMPGVYRYYDTAGAVLYVGKARDLKKRVSSYFTK-TQLSPRIAMMVTRIARIETT
UVRC_VIBPA      ------------TVTHQPGVYRMYNADAVVIYVGKAKDLQKRLSSYFRK-KVDSEKTRALVSNIAKIDVT
UVRC_COXB1      ------------TLPTGSGVYQMQDAQGKVIYVGKARNLQKRVSSYFR--RQLDSKTQAMMAQVQSIQTT
UVRC_BORPA      -------------LPHLPGVYRHLDAAGEVMYVGKARDLKKRVSSYFQKNLA-SPRIAQMVAKVASVDVT
UVRC_BORBR      -------------LPHLPGVYRHLDAAGEVMYVGKARDLKKRVSSYFQKNLA-SPRIAQMVAKVASVDVT
UVRC_SHEDO      ------------NLSSSAGVYRMYDAKGEVIYVGKAKDLKKRLSSYFRA-NLGNIKTQALVSHITNIDVT
UVRC_BORPE      -------------LPHLPGVYRHLDAAGEAMYVGKARDLKKRVSSYFQKNLA-SPRIAQMVAKVASVDVT
UVRC_AZOSE      ------------TVPEEPGVYRMIGADERVLYVGKAKNLKRRVSSYFQRTQP-SPRIAMMVAQILRVDIT
UVRC_VIBVU      ------------TVTHQPGVYRMYNAEAVVIYVGKAKDLKKRLSSYFRK-KVDSEKTKALVSNIAKIDVT
UVRC_PSEA6      -------------LTNQPGVYRMYNHKQDVIYVGKAKNLKNRVSSYFRS-QVDSIKTQSLVKQIAHMDVT
UVRC_VIBVY      ------------TVTHQPGVYRMYNAEAVVIYVGKAKDLKKRLSSYFRK-KVDSEKTKALVSNIAKIDVT
UVRC_COXBU      ------------TLPTGSGVYQMQDAQGKVIYVGKARNLQKRVSSYFR--RQLDSKTQAMMAQVQSIQTT
UVRC_COXBR      ------------TLPTGSGVYQMQDAQGKVIYVGKARNLQKRVSSYFR--RQLDSKTQAMMAQVQSIQTT
UVRC_COXB2      ------------TLPTGSGVYQMQDAQGKVIYVGKARNLQKRVSSYFR--RQLDSKTQAMMAQVQSIQTT
UVRC_BURVG      -------------LPHMPGVYRYYDATGAVLYVGKARDLKKRVSSYFTK-TQLSPRIAMMVTRIARIETT
UVRC_NITEU      ------------TLPAQPGVYRMLNAAGDVIYVGKAIDLRKRVSSYFQK-SGLSPRIQLMVSQIAGIETT
UVRC_DECAR      -----------------PGVYRMLDIGGNVLYVGKAKNLKKRVASYFRE-NLSSPRIAHMVSQIASIXXX
UVRC_SHIDS      ------------TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVT
UVRC_RALSO      -------------LPSLPGVYRYFDAQGSVLYVGKARDLKKRVSSYFTK-TLLSPRIAMMVAKIAHIETT
UVRC_BACHD      ------IKQKLTVLPDQPGCYLMKDRQGTIIYVGKAKVLKNRVRSYFT--GSHDAKTQRLVGEIADFEYI
UVRC_ACTP2      -------------VPHLPGVYRMYDAKNTIIYVGKAKDLKKRLSSYFRSQLA-SKKTEALVANXXXXXXX
UVRC_HYPNA      -------------LPSRPGVYRMFGEAGEVLYVGKARDLKARVSNYTR-MGGHTQRIARMISLTRAMEFV
UVRC_DESHY      ------LREKLSLLPDKPGVYLMKDASGQIIYVGKAKVLKNRVRSYFT--GSHNGKTQLMISLIADFETI
UVRC_CHRSD      ------------TVSESPGVYRMLDAEGNVLYVGKAKRLKARLASYFR--GALNAKTQALVSRIEDIQVX
UVRC_THEEB      -------------LPLAPGVYFLKDKTDQILYIGKSKRLRSRVRSYFREPAQLGPRLERMVYQVAEIEFI
UVRC_RHIL3      -------------LPNSPGVYRMFNAEGDVLYVGKARSLKKRVNNYA--VGRVHSRIAQMVRQTANMEFV
UVRC_ANADF      ------LRKTLDELPAEPGCYLMKDRRGAVVYVGKASSLRSRVRSYF-DASRGDDRAFVALELLGDVEVI
UVRC_HAEDU      -------------VPHLPGVYRMYDANQAIIYVGKAKDLKKRLASYFRSQVA-SKKIEALVGNIHHIDTT
UVRC_LEPBP      --VLKTIQEKIKNLGSLPGCYLWKNELGQVIYVGKALKLQSRVRSYLNP-NQKDRKTRALFVELYDLDWI
UVRC_LEPBA      --VLKTIQEKIKNLGSLPGCYLWKNELGQVIYVGKALKLQSRVRSYLNP-NQKDRKTRALFVELYDLDWI
UVRC_BRAJA      --------------PTSPGVYRMLNANADVLYVGKAKNVKKRLSNYARQSAPQPARILRMIAATVTVEIV
UVRC_SYNS9      -------------IPAEPGCYLMRDGDDRILYVGKSKTLRSRVRSYFRSRHDLSPRIRLMTRQVCEIEFI
UVRC_RALEJ      -------KPVIARLPGLPGVYRYIDSAGNVLYVGKARNLKKRVSSYFNK-TQLSPRIAMMVAKIARIDTT
UVRC_HERAR      -------------LPNLPGVYRYFDAENNLLYVGKARDLKKRVSSYFLKNLA-SPRTALMVEKIARLETT
UVRC_RHIME      -------------LPNGPGVYRMLNEAGDVLYVGKARSLKKRVSNYAQGRGHSN-RIARMVRETAHMEFV
UVRC_AGRT5      -------------LPNSPGVYRMFNEAGDVLYVGKARSLKKRVGNYAQ--GRVHSRIAQMVRFTTHMEFV
UVRC_BACC2      ------LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFT--GSHDGKTLRLVGEIVDFEYI
UVRC_RHOPA      --------------PTSPGVYRMLNAERDVLYVGKAKNVKKRLASYARPTGQVL-RIARMIALXXXXXXX
UVRC_JANMA      -------------LPNLPGVYRYFDAEDNLLYVGKARDLKKRVSSYFLKNLA-SPRTALMVERIARLETT
UVRC_HAES2      ------------NVTHQPGVYRMFDEKGQVIYVGKAKDLKKRLSSYFRT-NLNSKKTSALVXXXXXXXXX
UVRC_HAES1      ------------NVTHQPGVYRMFDEKGQVIYVGKAKDLKKRLSSYFRT-NLNSKKTSALVXXXXXXXXX
UVRC_GEOSM      ------------NFPSSPGVYLMKSADDTVIYVGKARNLKKRVRSYAGDTRDSRIHIRFMVQLVHSVDYL
UVRC_RHOPB      --------------PTSPGVYRMLNAASDVLYVGKAKNVKKRLASYARPTGHV-VRISRMIAATVSVEII
UVRC_RHOFD      -------------LPPLPGVYRYFDFDGAVLYVGKAINLKKRVSSYFQKNHG-GTRIGHMVSKIVRLETT
UVRC_VIBCM      ------------TVTNQPGVYRMYNAEAEVIYVGKAKDLKKRLTSYFRK-NLDSEKTKALVSNIAKIDVT
UVRC_VIBCH      ------------TVTNQPGVYRMYNAEAEVIYVGKAKDLKKRLTSYFRK-NLDSEKTKALVSNIAKIDVT
UVRC_VIBC3      ------------TVTNQPGVYRMYNAEAEVIYVGKAKDLKKRLTSYFRK-NLDSEKTKALVSNIAKIDVT
UVRC_NITHX      --------------PTSPGVYRMMNAARDVLYVGKAKNVRKRLSSYARPTGQVM-RIARMIAAXXXXXXX
UVRC_RHOPS      --------------PTSPGVYRMLNAADDVLYVGKAKNVKKRLSSYARPTGHV-VRIARMIAATVTVEII
UVRC_GEOBB      ------------NFPPSPGVYLMKSADDTVIYVGKARNLKKRVRSYAGDTRDSRIHIRFMVQLVHSVDYL
UVRC_STRU0      -------------LPDSPGCYLHKDKHGTIIYVGKAKNLRNRVRSYFR--GSHDTKTEMLVSEIEDFEFI
UVRC_MANSM      ------------NVTHDPGVYRMFDDKDTVIYVGKAKDLKKRLSSYFRA-NLSSKKTEALVASICRIXXX
UVRC_ALISL      ------------SVTHQPGVYRMYNAEAEVIYVGKAKDLKKRLSSYFRS-NIPSEKTKALVTHIAQIDVT
UVRC_MARMM      ------------NLPPKPGVYRMFGEDGAVLYVGKARNLKNRVSNYANGRGHSN-RIALMIGLTRKMEFV
UVRC_BACWK      ------LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFT--GSHDGKTLRLVGEIVDFEYI
UVRC_RHOP2      --------------PTSPGVYRMLNAAHDVLYVGKAKNVKKRLSSYARPTGHVM-RIARMIAAXXXXXXX
UVRC_BACHK      ------LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFT--GSHDGKTLRLVGEIVDFEYI
UVRC_BACCZ      ------LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFT--GSHDGKTLRLVGEIVDFEYI
UVRC_BACC3      ------LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFT--GSHDGKTLRLVGEIVDFEYI
UVRC_BACC0      ------LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFT--GSHDGKTLRLVGEIVDFEYI
UVRC_BACAH      ------LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFT--GSHDGKTLRLVGEIVDFEYI
UVRC_BACC4      ------LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFT--GSHDGKTLRLVGEIVDFEYI
UVRC_BACAN      ------LKEKLAILPDQPGCYLMKDRQGTVIYVGKAKVLKNRVRSYFT--GSHDGKTLRLVGEIVDFEYI
UVRC_BACAC      ------LKEKLAILPDQPGCYLMKDRQGTVIYVGKAKVLKNRVRSYFT--GSHDGKTLRLVGEIVDFEYI
UVRC_BACAA      ------LKEKLAILPDQPGCYLMKDRQGTVIYVGKAKVLKNRVRSYFT--GSHDGKTLRLVGEIVDFEYI
UVRC_STREM      -------------LPDSPGCYLHKDKAGTIIYVGKAKNLRNRVRSYFR--GSHDTKTELLVSEIADFEFI
UVRC_COLP3      ------------------GVYRMYDSKQVVIYVGKAKQLKKRLASYFRDVGSV--KTQVLVKQIAAIEVT
UVRC_LYSSC      ------IKRKLDILPDQPGCYLMKDRQGTIIYVGKAKVLKNRVRSYFT--GTHEGKTQRLVSEIEDFEYI
UVRC_BACCR      ------LKEKLAISPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFT--GSHDGKTLRLVGEIVDFEYI
UVRC_BARQU      -------------LPHKPGVYRMFDENGNVLYIGKARNLKKRVSNYTCE-QRHNNRITRMIRATYHMEFV
UVRC_BACCQ      ------LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFT--GSHDGKTLRLVGEIVDFEYI
UVRC_BACC7      ------LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFT--GSHDGKTLRLVGEIVDFEYI
UVRC_STRE4      -------------LPDSPGCYLHKDKAGTIIYVGKAKNLRNRVRSYFR--GSHDTKTELLVSEIADFEFI
UVRC_PROMA      ------------NIPKAPGCYLMKDNEDNIIYIGKSINLNSRVKSYFRRRNDNNPKNSLMLKQVSLIDFI
UVRC_PORGI      ------------TLPEKPGCYQYFDEDGKVIYVGKAKNLRRRVSSYFYKEHA-DRKTRILVRQIRSIKYI
UVRC_PORG3      ------------TLPEKPGCYQYFDEDGKVIYVGKAKNLRRRVSSYFYKEHA-DRKTRILVRQIRSIKYI
UVRC_PELUB      ---KDVIRKELPLIPKSPGVYRMLDHKDVILYVGKAKNLPNRLKSYVAEKNHII-RTARMLSQTFKLEIX
UVRC_STRS7      -------------LPDSPGCYLHKDKAGTIIYVGKAKNLRNRVRSYFR--GSHDTKTELLVSEIADFEFI
UVRC_ENTFA      ------IKNKLALLPDQPGCYLMKDKNGTIIYVGKAKILKNRVRSYFR--GSHDTKTERLVSEIDDFEYI
UVRC_BACC1      ------LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFT--GSHDGKTLRLVGEIVDFEYI
UVRC_RALME      ----PAFDPRPARMPGLPGVYRYFDADGNILYVGKARDLKKRVSSYFNK-TQLSPRIAMMVAKIARIDTT
UVRC_NITWN      --------------PTSPGVYRMMNAARDVLYVGKAKNVRKRLSSYARP-TGQXXXXXXXXXXXXXXEIV
UVRC_FLAJ1      ---KPSLDLQILTLPDNPGVYQYYDKDGKILYVGKAKNLKKRVSSYFNKIHDT-AKTNXXXXXXXXXXXX
UVRC_RHIEC      -------------LPNSPGVYRMLNAEGDVLYVGKARSLKKRVGNYA--VGRVHSRIAQMVRQTANMEFV
UVRC_PEDPA      -------------LPDKPGCYQMKNLNSQIIYVGKAKNLKNRVRSYFK--SSHEGKTAKLVSEIADFDYI
UVRC_LACLM      -----TIKAKLELLPDSPGCYLHKDKNGTVIYVGKAKNLKNRVRSYFH--GSHNTKTELLVSEIEDLEWI
UVRC_LACBA      ------LEHKLALLPGLPGCYLMKNINSQIIYVGKAKNLKNRVRSYFK--SSHTGKTAQLVSEIVDFETI
UVRC_VIBF1      ------------SVTHQPGVYRMYNAEADVIYVGKAKDLKKRLSSYFRS-NVPSEKTKALVSHIHQVDVT
UVRC_GRAFK      ---KPALEVQLKTLPNSPGVYQYFDKNGKILYVGKAKNLKKRVTSYFNKNHDSH-RIGVMVKKICEIKHI
UVRC_STRA3      -------------LPDSPGCYLHKDKNGTIIYVGKAKNLKNRVKSYFH--GSHNTKTELLVSEIEDFEYI
UVRC_STRA5      -------------LPDSPGCYLHKDKNGTIIYVGKAKNLKNRVKSYFH--GSHNTKTELLVSEIEDFEYI
UVRC_STRA1      -------------LPDSPGCYLHKDKNGTIIYVGKAKNLKNRVRSYFH--GSHNTKTELLVSEIEDFEYI
UVRC_BACSK      -----TITNKLALLPDKPGCYLMKDRQGTIIYVGKAKVLKNRVRSYFT--GSHDSKTQRLVGEICDFEYI
UVRC_STRGC      -------------LPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFR--GSHDTKTEALVSEIVDFEFI
UVRC_OENOB      ------IEQKLALLPSQPGSYQMKDKNGKIIYVGKAKNLKNRVRSYFK---AEHTKTAELVANIHDFEFI
UVRC_STRP6      -------------LPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYFR--GSHDTKTELLVSEIVDFEYI
UVRC_FRAP2      ------------NLTTHSGVYRMLDKHGEIIYVGKAKNLKNRVNSYFSK-GAKDSKTLMMVEQVARIEIT
UVRC_STRPZ      -------------LPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYFR--GSHDTKTELLVSEIVDFEYI
UVRC_STRPM      -------------LPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYFR--GSHDTKTELLVSEIVDFEYI
UVRC_STRPG      -------------LPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYFR--GSHDTKTELLVSEIVDFEYI
UVRC_STRPF      -------------LPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYFR--GSHDTKTELLVSEIVDFEYI
UVRC_STRPD      -------------LPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYFR--GSHDTKTELLVSEIVDFEYI
UVRC_STRPC      -------------LPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYFR--GSHDTKTELLVSEIVDFEYI
UVRC_STRPB      -------------LPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYFR--GSHDTKTELLVSEIVDFEYI
UVRC_STACT      ------IKEKLSVVPFEPGCYLMKDRNNQVIYVGKAKRLRNRLRSYFT--GAHDAKTTRLVGEIRNFEFI
UVRC_STRP8      -------------LPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYFR--GSHDTKTELLVSEIVDFEYI
UVRC_STRP3      -------------LPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYFR--GSHDTKTELLVSEIVDFEYI
UVRC_STRP1      -------------LPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYFR--GSHDTKTELLVSEIVDFEYI
UVRC_XANOR      -------------LSTAPGVYRMYAGDDTLLYVGKAGALRKRVGSYFNG-TPKNARLTSMLSQVARMDVT
UVRC_XANOP      -------------LSTAPGVYRMYAGDDTLLYVGKAGALRKRVGSYFNG-TPKNARLTSMLSQVARMDVT
UVRC_XANOM      -------------LSTAPGVYRMYAGDDTLLYVGKAGALRKRVGSYFNG-TPKNARLTSMLSQVARMDVT
UVRC_STRMU      -------------LPDSPGCYIHKDKNGTIIYVGKAKNLKNRVRSYFH--GSHNTKTELLVSEIEDFEYI
UVRC_STRP7      ------IKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFR--GSHDTKTEALVSEIVDFEFI
UVRC_STRZT      ------IKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFR--GSHDTKTEALVSEIVDFEFI
UVRC_STRP4      ------IKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFR--GSHDTKTEALVSEIVDFEFI
UVRC_LACLA      -----TIKAKLELLPDSPGCYLHKDKNGTVIYVGKAKNLKNRVRSYFH--GSHNTKTELLVSEIEDLEWI
UVRC_DEIRA      -------------LPTTPGVYIFR-KGGVPIYIGKANNLRSRVSQHFKAGG----KSGKFTKLAESLEFI
UVRC_STRZJ      ------IKSKLELLPTSPGCYIHKDKNGSIIYVGKAKNLRNRVRSYFR--GSHDTKTEALVSEIVDFEFI
UVRC_STRPN      ------IKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFR--GSHDTKTEALVSEIVDFEFI
UVRC_STRPI      ------IKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFR--GSHDTKTEALVSEIVDFEFI
UVRC_LAWIP      -------RPHPSSIPTTPGVYLYKDSQGRIIYVGKARNLRKRVLSYFRDGLVITPKTKAMMNHANLLETI
UVRC_STRR6      ------IKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFR--GSHDTKTEALVSEIVDFEFI
UVRC_STRPS      ------IKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFR--GSHDTKTEALVSEIVDFEFI
UVRC_STRPJ      ------IKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFR--GSHDTKTEALVSEIVDFEFI
UVRC_STRP2      ------IKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFR--GSHDTKTEALVSEIVDFEFI
UVRC_STRZP      ------IKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFR--GSHDTKTEALVSEIVDFEFI
UVRC_XANCP      -------------LSTAPGVYRMYAADDSLLYVGKAGALRKRVGSYFNG-TPKNARLTSMLSQVARMDVT
UVRC_XANC8      -------------LSTAPGVYRMYAADDSLLYVGKAGALRKRVGSYFNG-TPKNARLTSMLSQVARMDVT
UVRC_FUSNN      -------------IPESSGVYLMK-KNNKVIYVGKAKNLKNRVSSYFNRVHESE-KTNELVKNIEDIEFF
UVRC_STRT1      -------------LPSNPGCYLHKDKFGNIIYVGKAKNLKNRVRSYFR--GSHDTKTELLVSEIADFEFI
UVRC_PSYCK      -------------LPNLPGVYKMLGKNGDILYVGKAKSLKSRVNSYFAK-TIDHPKTRALVARIHNIETI
UVRC_STRT2      -------------LPNNPGCYLHKDKFGNIIYVGKAKNLKNRVRSYFR--GSHDTKTELLVSEIADFEFI
UVRC_XANCB      -------------LSTAPGVYRMYAADDSLLYVGKAGALRKRVGSYFNG-TPKNARLTSMLSQVARMDVT
UVRC_STRSV      -------------LPTSPGCYIHKDKNDTIIYVGKAKNLRNRVRSYFR--GSHDTKTEALVSEIEDFEFI
UVRC_XANAC      -------------LSTAPGVYRMYAGDDTLLYVGKAGALRKRVGSYFNG-TPKNARLTSMLSQVARMDVT
UVRC_STAEQ      ------IKEKLNVVPLEPGCYLMKDRNDQVIYVGKAKRLRNRLRSYFT--GAHDAKTTRLVGEIRNFEFI
UVRC_FLAPJ      ------------TLPDNPGVYQYYDKDGKILYVGKAKNLKKRVSSYFNKVHDT-AKTNXXXXXXXXXXXX
UVRC_XANC5      -------------LSTAPGVYRMYAGDDTLLYVGKAGALRKRVGSYFNG-TPKNARLTSMLSQVARMDVT
UVRC_STRTD      -------------LPSNPGCYLHKDKFGNIIYVGKAKNLKNRVRSYFR--GSHDTKTELLVSEIADFEFI
UVRC_STAES      ------IKEKLNVVPLEPGCYLMKDRNDQVIYVGKAKRLRNRLRSYFT--GAHDAKTTRLVGEIRNFEFI
UVRC_LACPL      -------------LPDLPGCYLMKNLNSQIIYVGKAKNLKNRVRSYFK--SSHTGKTARLVSEIADFEFI
UVRC_VEREI      ------------------GVYRYFDSQGLLLYVGKARHLKRRVASYFTKNHG-GTRIGHMVCKIARLETT
UVRC_BACP2      ------IKEKLSVLPDQPGCYLMKDRQNTVIYVGKAKILKNRVRSYFT--GSHDAKTQRLVSEIEDFEYI
UVRC_LACS1      -------------LPDLPGCYMMKDINSRIIYVGKAKNLKNRVRSYFK--SSHEGKTAKLVSEIRNFETI
UVRC_PSEHT      ------------TLSSEPGVYCMLDSDNQVIYVGKAKHLKKRVSSYFRS-NITDSKTRVLVSNICXXXXX
UVRC_FRATO      ------------NLTTHSGVYRMLDKHGEIIYVGKAKNLKNRINSYFSK-GAKDSKTLMMVEQIARIEIT
UVRC_FRATH      ------------NLTTHSGVYRMLDKHGEIIYVGKAKNLKNRINSYFSK-GAKDSKTLMMVEQIARIEIT
UVRC_FRATF      ------------NLTTHSGVYRMLDKHGEIIYVGKAKNLKNRINSYFSK-GAKDSKTLMMVEQIARIEIT
UVRC_STAAU      ------IKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFT--GAHDAKTTRLVGEIRRFEFI
UVRC_STAAR      ------IKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFT--GAHDAKTTRLVGEIRRFEFI
UVRC_STAAB      ------IKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFT--GAHDAKTTRLVGEIRRFEFI
UVRC_FRATN      ------------NLTTHSGVYRMLDKHGEIIYVGKAKNLKNRVNSYFSK-GAKDSKTLMMVEQIARIEIT
UVRC_STAAT      ------IKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFT--GAHDAKTTRLVGEIRRFEFI
UVRC_STAAE      ------IKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFT--GAHDAKTTRLVGEIRRFEFI
UVRC_STAAC      ------IKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFT--GAHDAKTTRLVGEIRRFEFI
UVRC_STAA8      ------IKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFT--GAHDAKTTRLVGEIRRFEFI
UVRC_STAA3      ------IKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFT--GAHDAKTTRLVGEIRRFEFI
UVRC_FRATM      ------------NLTTHSGVYRMLDKHGEIIYVGKAKNLKNRVNSYFSK-GAKDSKTLMMVEQIARIEIT
UVRC_STAAW      ------IKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFT--GAHDAKTTRLVGEIRRFEFI
UVRC_STAAS      ------IKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFT--GAHDAKTTRLVGEIRRFEFI
UVRC_STAAN      ------IKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFT--GAHDAKTTRLVGEIRRFEFI
UVRC_STAAM      ------IKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFT--GAHDAKTTRLVGEIRRFEFI
UVRC_STAA9      ------IKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFT--GAHDAKTTRLVGEIRRFEFI
UVRC_STAA2      ------IKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFT--GAHDAKTTRLVGEIRRFEFI
UVRC_STAA1      ------IKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFT--GAHDAKTTRLVGEIRRFEFI
UVRC_TREDE      ITTREKLHEVALSAPKTSGVYLWKDKAGTVIYVGKAKSLKNRLSSYFTSNRDI--KTRILVSRAESIEYI
UVRC_FRATW      ------------NLTTHSGVYRMLDKHGEIIYVGKAKNLKNRVNSYFSK-GAKDSKTLMMVEQIARIEIT
UVRC_STAS1      -TYQEKIKQKLTVVPIEPGCYLMKDRNDQIIYVGKAKKLRNRLRSYFT--GAHDAKTTRLVGEIRNFEFI
UVRC_CYTH3      MLEKEDIRSLLKELPSSPGVYRFYSIEKELIYVGKAKSLRKRVANYFTNKKNLDQKTRSMVRKIYHAEYT
UVRC_METMP      -------------IPKNPGCYIYKNESGTVIYVGKAKNLKKRVSSYFNKKNH-DPKTEKLVKSIYEMEFI
UVRC_STAHJ      ------IKNKLSVVPFEPGCYLMKDRNDQVIYVGKAKRLRNRLRSYFT--GAHDAKTTRLVGEIRNFEFI
UVRC_LACSS      -------------LPALPGCYLMKDINAQIIYVGKAKNLKNRVRSYFK--SSHEGKTAKLVSEIVDFETI
UVRC_LACRJ      ------LEHKLALLPDKPGCYLMKNINDQIIYVGKAKNLKNRVRSYFK--SSHTGKVAKMVSEVADFETI
UVRC_LACRD      ------LEHKLALLPDKPGCYLMKNINDQIIYVGKAKNLKNRVRSYFK--SSHTGKVAKMVSEVADFETI
UVRC_FRATT      ------------NLTTHSGVYRMLDKHGEIIYVGKAKNLKNRVNSYFSK-GAKDSKTLMMVEQIARIEIT
UVRC_FRAT1      ------------NLTTHSGVYRMLDKHGEIIYVGKAKNLKNRVNSYFSK-GAKDSKTLMMVEQIARIEIT
UVRC_METHJ      ------------TIPEEPGCYQFKDETGTILYVGKAKNLKKRVSSYFQK-KSITPRIDILVSLIRDIDVI
UVRC_LACJO      -------------LPDKPGCYLMKDVNGNVIYVGKSKNLKNRVRSYFK--SKQVGRRAELVREIRDFDII
UVRC_BACTN      ------LRGIVANLPEKPGVYQYLNTEGTIIYVGKAKNLKKRVYSYF---SKEHEKTRVLVSKIADIRYI
UVRC_XYLF2      -------------LSTAPGVYRMYAADDTLLYVGKAGALRKRVASYFNG-TPKNTRLTAMLAQVVRMDVT
UVRC_XYLFT      -------------LSTAPGVYRMYAADDTLLYVGKAGALRKRVASYFNG-TPKNTRLTAMLAQVVRMDVT
UVRC_LACCB      -------------LPDLPGSYQMKDINGKIIYVGKAKNLKNRVRSYFK--SSHDGKVAAMVSQVADFDFI
UVRC_LACC3      -------------LPDLPGSYQMKDINGKIIYVGKAKNLKNRVRSYFK--SSHDGKVAAMVSQVADFDFI
UVRC_LACGA      -------------LPDKPGCYLMKDINGNVIYVGKSKNLKNRVRSYFK--SKQVGRRAELVREIRDFDII
UVRC_CHLTR      -------------VSSSPGVYLMKDSQGTVLYVGKAKNLRNRLSSYLQKKGDSRKRIPFLMKKTTDIDTI
UVRC_CHLTA      -------------VSSSPGVYLMKDSQGTVLYVGKAKNLRNRLSSYLQKKGDSRKRIPFLMKKTTDIDTI
UVRC_THEP1      --MKEKIRKKILLAPEEPGVYIFKNK-GVPIYIGKAKRLSSRLRSY------LNPQTEKVVEEADELETI
UVRC_PSYA2      -------------LPNLPGVYKMLGKNGDILYVGKAKSLKSRVNSYFAK-TIDHPKTRALVARIHNIETI
UVRC_LACDB      -------------LPEKAGCYLMKDVNGKVIYVGKSKNLKNRVRSYFK--SSQEGRRAELVKNIADYDII
UVRC_LACDA      -------------LPEKAGCYLMKDVNGKVIYVGKSKNLKNRVRSYFK--SSQEGRRAELVKNIADYDII
UVRC_XYLFA      -----------------PGVYCMYAADDTLLYVGKAGALRKRVASYFNG-TPKNTRLTAMLAQVVRMDVT
UVRC_METMA      ------------ALPHLPGCYLFKDEEGIVLYVGKAKDLKKRVSSYFQKRDH-DPKTASLMQFARGLDFI
UVRC_THESQ      ----------------EPGVYIFKNK-GVPIYIGKAKRLSSRLRSY------LNPQTEKVVEEADELETI
UVRC_PSYWF      -------------LPNLPGVYKMLGKNGDILYVGKAKSLKSRVNSYFAK-TIDHPKTRALVSRIHDIETI
UVRC_CHLAB      ----------PKLIPASPGVYLMKDSSGEVLYIGKAKNLRNRISTYFRKDGDSRERIPFLMKKTTDIETI
UVRC_THEMA      --MKEKIRKKILLAPEEPGVYIFKNK-GVPIYIGKAKRLSNRLRSY------LNPQTEKVFEEADELETI
UVRC_DEIGD      -------------LPASPGVYIFR-RGGTPIYIGKAVNLRSRVAQHFKAGG----KSGKFTALADSLDFI
UVRC_METAC      ------------ALPHLPGCYLFKDEEGVVLYVGKAKDLKKRVSSYFQKRDH-DPKTTSLVQAARGLDFI
UVRC_BACFR      ------------NLPEKPGIYQYLNAEGTIIYVGKAKNLKRRVYSYF---SKEHQKTRVLVSKIADIRYI
UVRC_BACFN      ------------NLPEKPGIYQYLNAEGTIIYVGKAKNLKRRVYSYF---SKEHQKTRVLVSKIADIRYI
UVRC_RICPR      --------------PECSGVYKMLDVNKQVIYIGKAKILKKRLTNYIK--SDLDNKTLRMISNTYFLEYI
UVRC_RICTY      ---RELIKSKIIDAPECSGVYKMLDVSKQVIYVGKAKILKKRLTNYIK--SDLDNKTLRMIANTYFLEYI
UVRC_LACF3      ------LEHKLALLPDQPGCYLMKNANAQIIYVGKAKNLKNRVRSYFK--SSHTGKVAAMVEEVADFETI
UVRC_DESVH      -------RPDLSTIPLTPGVYLYKDESGRIIYVGKARCLRRRVASYFRDVSALTPKTVAMLRHAVTIDTL
UVRC_ANAMM      LIARDAVKKALNSIPCDAGVYKMLGANGLVLYVGKAKDLKKRLRSYY-NFNQMSDRILAMVGHITELDVI
UVRC_RICBR      LTGNELIKSKLIDIPERSGVYRMFDANKQVIYVGKAKNLKKRLTNYIK--TDLDTKTLRMVANTCSLEYS
UVRC_NAUPA      ------------SLPDQPGIYQYFDENGKLLYIGKAKSLKKRVKSYFRPADNLSPRIYKMISEAKDLNYI
UVRC_CHLFF      ----------PKIIPPSPGVYLMKDSSGEVLYIGKAKNLRNRITTYFQKQGDSRERIPFLMKKTTDIETI
UVRC_THELT      ------------------GVYIFYGKNKEYIYVGKAKRLRNRLLSYFNRSNGKYKKIQAIVNEAEELDYI
UVRC_RICPU      --------------PERSGVYRMFDVNKQVLYVGKAKNLKKRLTNYIK--SNLDNKTLRMIANTCFLEYS
UVRC_RICAE      --------------PERSGVYRMFDVNKQVLYVGKAKNLKKRLTNYIK--SNLDNKTLRMIANTCFLEYS
UVRC_HALMA      ------VRERAGSLPREPGVYLFRDDKRRVLYVGKAVDLRDRVRSYADPRSE---RIAKMVERAETIDFA
UVRC_CHLCV      ----------PKLVPTSPGVYLMKDDSGEVLYIGKAKNLRNRITTYFQKQGDSRERIPFLMKKTTTIETI
UVRC_RICCN      --------------PERSGVYRMFDVNKQVLYVGKAKNLKKRLTNYIK--SNLDNKTLRMIANTCFLEYS
UVRC_PETMO      ------------NIPKKPGVYIFKNNKGDPIYIGKAKNLKNRVSSYFNKKNYINEKTYEMLEKATNLDYI
UVRC_RICRS      --------------PERSGVYRMFDVNKQVLYVGKAKNLKKRLTNYIK--SNLDNKTLRMIANTCFLEYS
UVRC_RICRO      --------------PERSGVYRMFDVNKQVLYVGKAKNLKKRLTNYIK--SNLDNKTLRMIANTCFLEYS
UVRC_CHLMU      ------------NVSSSPGVYLMKDSQGVVLYVGKAKNLRNRLSSYLQKNGDSRERIPFLMKRTADIDTI
UVRC_WOLTR      --------------PQSCGVYQMIGDKDKVLYVGKAKNLKSRLSNYLR-YENLSERTKFMLSQVIKVEVL
UVRC_METBF      ------------ALPHLPGCYLFKNEEGTVIYVGKAKDLKKRVSSYFQK-REHDPKTASLIEAVRGFDFI
UVRC_LACH4      -------------LPEKPGCYLMKDINGTVIYVGKSKNLKNRVRSYFK--SKQVGRRAELVREIRDYDII
UVRC_CHLPN      -------------IPSSPGVYLMKDVHDQVLYIGKAKNLKNRLASYFHEKGDSRERIPFLMKKTASIETI
UVRC_LACAC      -------------LPEKPGCYLMKDINGTVIYVGKSKNLKNRVRSYFK--SKQVGRRAELVREIRDYDII
UVRC_STRMK      -------------LSTAPGVYRMYAADDTLLYVGKARALRNRVGSYFNG-SPKNARIMSMISQIVRMDVT
UVRC_STRM5      -------------LSTAPGVYRMYAADDTLLYVGKARALRNRVGSYFNG-SPKNARIMSMISQITRMDVT
UVRC_RICCK      ------IKSKLVDAPECAGVYQMFDVNKQVIYVGKAKNLKKRLTNYIK--LDLDNKTLRMIANTCFLEYS
UVRC_HALWD      ------------------GVYQFLEDN-TVRYVGKALELRDRVRSYADPRSE---RIRQMVARADDIDIX
UVRC_WOLPP      ------------SSPQSCGVYKMIGDKSKVLYIGKAKNLKSRLSDYLQ-FENLSERIRVMISQVIKVEIF
UVRC_RICFE      --------------PERCGVYRMFDVNKQVIYVGKAKNLKKRLTNYIK--SDLDNKTLRMIANTCFLEYS
UVRC_ANAPZ      -----------------PGVYKMFGTEDRLLYVGKAKDLKKRLSSYL-SINRMSVNVYTMVKQIVRLEIT
UVRC_WOLWR      ------------SSPQSCGVYKMVGDKNKVLYVGKAKNLKSRLSDYLQ-FENLSERIRVMLSQVIKVEIF
UVRC_WOLPM      ------------SSPQSCGVYKMVGDKNKVLYVGKAKNLKSRLSDYLQ-FENLSERIRVMLLQVIKVEIF
UVRC_THET8      -------------LPETPGVYLWKRGE-EVLYVGKAKSLRARVKSYFH----AEGKARRIAEEATGLDFI
UVRC_RICAH      --------------PERCGVYRMFDVNKQVIYVGKAKNLKKRLTHYIK--SDLDNKTLRMIANTCFLEYS
UVRC_HELPJ      ------------------GVYQYFDKNRQLLYIGKAKNLKKRIKSYFSNEITPNPRTQMMVKQIAFLETI
UVRC_NATPD      ------VRKRAAELPAEPGVYQFEAGES-VLYVGKAVDLRERVRSYVAPRS---DRIRRMXXXXXXXXXX
UVRC_HELPY      ------------------GVYQYFDKNRQLLYIGKAKNLKKRIKSYFSEITPNHRRIQMMVKQIAFLETI
UVRC_HELP2      ------------------GVYQYFDKNRQLLYIGKAKNLKKRIKSYFSEITPNHRRVQMMVKQIAFLETI
UVRC_HELPG      ------------------GVYQYFDKNRQLLYIGKAKNLKKRIKSYFSEITPNHRRIQMMVKQIAFLETI
UVRC_HELPH      ------------------GVYQYFDKNRQLLYIGKAKNLKKRIKSYFSEITPNHRRIQMMVKQIAFLETI
UVRC_HELAH      -------------------VYQYFDKNRQLLYIGKAKNLKKRIKSYFSEITPNHRRIQMMVKQIAFLETI
UVRC_ARCB4      ------LQEKLQQLPNDAGVYQYFDKNGHLLYIGKAKILKNRVKSYFQPADKLSPRIYKMISEVESCEWI
UVRC_HELPS      ------------------GVYQYFDKNHQLLYIGKAKNLKKRIKSYFSRNNEITPRIQMMVKQIAFLETI
UVRC_CAMJD      ------------TLPNSAGVYEYFNQEGKLLYVGKAKNLKNRVKSYFAFTPNLHARIQKMIQETVHLEFI
UVRC_MESFL      ------LKNKVSNLPSKPGCYLYLNKDKHVIYVGKAKNLKKRVSSYFD--RAQNLKTTRLVREIADLEYF
UVRC_CAMJ8      ------------TLPNSAGVYQYFNQEGKLLYVGKAKNLKNRVKSYFAFTPNLHARIQKMIEETVHLEFI
UVRC_CAMJJ      ------------TLPNSAGVYQYFNQEGKLLYVGKAKNLKNRVKSYFAFTPNLHARIQKMIEETVHLEFI
UVRC_HALSA      ------VRARASELPAEPGVYQFRDPDGRVLYVGKAVDIRDRVRSYGDPRSE---RIAGMXXXXXXXXXX
UVRC_HALS3      ------VRARASELPAEPGVYQFRDPDGRVLYVGKAVDIRDRVRSYGDPRSE---RIAGMXXXXXXXXXX
UVRC_CAMJE      ------------TLPNSTGVYQYFNQEGKLLYVGKAKNLKNRVRSYFAFTPNLHARIQKMIEETVHLEFI
UVRC_CAMJR      --IKENLENELKTLPNSAGVYQYFNQEGKLLYVGKAKNLKNRVKSYFAFTPNLHARIQKMIEETVHLEFI
UVRC_THET2      ------------------------------------------------------------------LDFI
UVRC_FERNB      -------------IPNKSGVYIFKKGE-EYIYIGKAKELKKRLTSHFK---AKDGKSKLIVEEADDLQVI
UVRC_BORGA      -----SLFEKVTKLPTTSGCYKMLNENKKILYIGKAKNLRSRIKSYFLEKKS--HKIKILMKNVKSIEVI
UVRC_BORHD      ------LHKKVQELPTTSGCYKMYSQNNKILYIGKAKNLRARVKNYF--LKRISHKTKILMRNVANIEVI
UVRC_WOLSU      ------------NLPDQSGVYHYFDSRSKLLYVGKAKSLKKRVKSYFQPSPKLSPRIHKMISEAAFIRYI
UVRC_BORAP      -------------LPTTSGCYKMLNENKKILYIGKAKNLRSRIKSYFLEKKS--HKIKILMKNVKSIEVI
UVRC_SULDN      -----TLRECIKQLPDSAGVYQYFDKDGHLLYIGKAKSLAKRVKSYFKPNSNLSSRISKMISQTHTLQYI
UVRC_BURPP      -------------LPHLPGVYRYYDTHGAVLYVGKARDLKKRVSSYFTK-TLLSPRIAMMVTRIARIETT
UVRC_BURXL      -------------LPHLPGVYRYYDTHGAVLYVGKARDLKKRVSSYFTK-TQLSPRIAMMVTRIARVETT
UVRC_MYCPE      ------IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFLKDRDL--KTKKLANEICDVDYX
UVRC_BURTA      --------PKPAQLPHLPGVYRYYDAQEAVLYVGKARDLKKRVSSYFTK-TQLSPRIAMMVTRIARIETT
UVRC_BORBZ      -------------LPTTSGCYKMLNENKKILYIGKAKNLRSRVKSYFLEKNS--HKIKILMKNVKSIEVI
UVRC_BORBU      -------------LPTTSGCYKMLNENKKILYIGKAKNLRSRVKSYFLEKNS--HKIKILMKNVKSIEVI
UVRC_BURCM      -------------LPHMPGVYRYYDTAGAVLYVGKARDLKKRVSSYFTK-TQLSPRIAMMVTRIARIETT
UVRC_BURA4      -------------LPHMPGVYRYYDTAGAVLYVGKARDLKKRVSSYFTK-TQLSPRIAMMVTRIARIETT
UVRC_BORT9      ------LHKKVQEFPTTSGCYKMYSQDNKILYIGKAKNLRSRLKNYFLEKISL--KTKILMRNVVNIEVI
UVRC_THEAB      ------------NVSEKPGVYIFKNG-SEYIYIGKAKNLKRRLNSHF---SLKEEKSRLIVEESNSLEVI
UVRC_HYDS0      --------------PEEPGVYIFKNQK-HYIYIGKAINIKKRLLQHLKEREQ-SKKEANIFNHSKELEWI
UVRC_BURPS      --------PKPAQLPHLPGVYRYYDAQDAVLYVGKARDLKKRVSSYFTK-TQLSPXXXXXXXXXXXXETT
UVRC_BURP6      --------PKPAQLPHLPGVYRYYDAQDAVLYVGKARDLKKRVSSYFTK-TQLSPXXXXXXXXXXXXETT
UVRC_BURP1      --------PKPAQLPHLPGVYRYYDAQDAVLYVGKARDLKKRVSSYFTK-TQLSPXXXXXXXXXXXXETT
UVRC_BURP0      --------PKPAQLPHLPGVYRYYDAQDAVLYVGKARDLKKRVSSYFTK-TQLSPXXXXXXXXXXXXETT
UVRC_BURMS      --------PKPAQLPHLPGVYRYYDVQDAVLYVGKARDLKKRVSSYFTK-TQLSPXXXXXXXXXXXXETT
UVRC_BURMA      --------PKPAQLPHLPGVYRYYDVQDAVLYVGKARDLKKRVSSYFTK-TQLSPXXXXXXXXXXXXETT
UVRC_BURM9      --------PKPAQLPHLPGVYRYYDVQDAVLYVGKARDLKKRVSSYFTK-TQLSPXXXXXXXXXXXXETT
UVRC_BURM7      --------PKPAQLPHLPGVYRYYDVQDAVLYVGKARDLKKRVSSYFTK-TQLSPXXXXXXXXXXXXETT
UVRC_HALLT      ------VRERAADLPTEPGVYQFRAGE-TTLYVGKAVNLRNRVRSYADPRSG---RIRGMVGRADRIEFA
UVRC_BORDL      --------------PKTSGCYKMYSKDNKILYIGKAKNLRSRVKNYFSKRTS--HKTKILMXXXXXXXXX
UVRC_BORRA      --------------PKTSGCYKMYSKDNKILYIGKAKNLRSRVKNYFSKRTS--HKTKILMXXXXXXXXX
UVRC_UREPA      ------LKNKLKLIPHKPGCYLWKDQFNQIIYIGKAKDLYNRTHSYFN--GCKDNKTSKLVNNINDLEYI
UVRC_UREP2      ------LKNKLKLIPHKPGCYLWKDQFNQIIYIGKAKDLYNRTHSYFN--GCKDNKTSKLVNNINDLEYI
UVRC_HELHP      -------------LPTQSGIYQFFDNEDTLLYVGKAKNLKNRIKSYLSPKNNLSPRIALMVSQITRIHTL
UVRC_DESDG      -------------IPTTPGVYLYKDPAGKVVYVGKAKHLRRRVASYFRDIQRHTPKTRAMLRSAATVETL
UVRC_UREU1      ------LKTKLKLIPHKPGCYLWKDEFDQIIYIGKAKDLYNRTHSYFN--GPKDNKTSKLVSNIKDLEYI
UVRC_AQUAE      --------------PEKPGVYLFK-KGNRPIYIGKAKNLKKRLLQHLKA-SEYDSKERAIISNSDNLEWI
UVRC_AYWBP      ------LLEKIKTLPPNPGCYLFKNTKDTIIYVGKAKNLKKRVQSYFTKRNNL--KTAMLIEETQDFFYI
UVRC_TREPS      ----------------------------------------------------------------------
UVRC_TREPA      ----------------------------------------------------------------------
UVRC_MYCMS      -----SLKQQVDLLPNKPGCYLFFNKDNDVIYVGKAKNLKKRVSTYFN--KAYNIKTTRLVREITDLKYF
UVRC_MYCGA      ------LKQKLDLAPKKPGCYLWKNHLNEIIYIGKAKNIYKRVHQYFNGPKDL--KTSKLVNEIFYVEFI
UVRC_MYCCT      ------LKEQVDLLTNKPGCYLFLNKDNEVIYVGKAKNLKKRVSTYFN--KAYNIKTTRLIREITHLKYF
UVRC_MYCPN      --VNNTLAFKLKNAPHKPGCYLWKDDAGQVLYVGKAKDIFKRVHHYFNPNRSF--KTRALVERIADVEYV
UVRC_MYCGE      ------LKQKLKTAPKKPGCYLWKDSNGKVLYVGKASNIFNRVHQYFQKNNPY--KTQLLSSQISDVDFF
UVRC_MYCBV      ------------NVSTSPGVYLWKDAKQNVLYVGKAKNLRKRMLQYF-DGAINSYKTNKLVSLIYDFDVY
UVRC_MYCAP      ---------------TSPGVYLWKDAKQNVLYVGKAKNLRKRLLQYF-DGAINSYKTSKLMSLVADFEVY
CHO_ECOLI       ------LRSFLNDLPTRPGVYLFHGESDTMLYIGKSVNIRSRVLSHLRT-----PDEAAMLRQSRRISWI
CHO_ECO57       ------LRSFLNDLPTRPGVYLFHGESDTMLYIGKSVNIRSRVLSHLRT-----PDEAAMLRQSRRISWI
CHO_SHIFL       -------------LPTRPGVYLFHGESDTMLYIGKSVNIRSRVLSHLRT-----PDEAAMLRQSRRISWI
CHO_ECOL6       ------LRSFLNDLPTRPGVYLFHGESDTMLYIGKSINIRSRVLSHLRT-----PDEAAMLRQSRRISWI
Y2191_MYCTU     ------------TLPHRPGVYLFRGPSGEVLYVGTAADLRRRVSQYFNG-TDRRKRMTEMVMLASSIDHV
CHO_SALTY       ------LRPFLSEAPALPGVYIFHSESDTLLYIGKSVNIRSRVLSHLRT-----PDEATMLRQARRISWI
CHO_SALTI       ------LRPFLSEAPALPGVYIFHSESDTLLYIGKSVNIRSRVLSHLRT-----PDEAAMLRQARRISWI
DNLJ_COPPD      ----------------------------------------------------------------------
DNLJ_CORJK      ----------------------------------------------------------------------
DNLJ_PROAC      ----------------------------------------------------------------------
DNLJ_HERA2      ----------------------------------------------------------------------
FAP24_MOUSE     ----------------------------------------------------------------------
Y1505_METJA     ----------------------------------------------------------------------
DNLJ_THERP      ----------------------------------------------------------------------
CHLN_SYNE7      ----------------------------------------------------------------------
DNLJ_FERNB      ----------------------------------------------------------------------
DISA_PROAC      ----------------------------------------------------------------------
CHLN_SYNP6      ----------------------------------------------------------------------
YURQ_BACSU      ----PKIKPIHGQIPRDKGIFMFYNIHDELLFVGKARKLRQRIKKHFED---------------------
RUVA_BURCJ      ----------------------------------------------------------------------
FAP24_HUMAN     ----------------------------------------------------------------------
YEGI_ECOLI      ----------------------------------------------------------------------
YEGI_ECO57      ----------------------------------------------------------------------
RUVA_DESMR      ----------------------------------------------------------------------
HELS_PYRCJ      ----------------------------------------------------------------------
FAP24_BOVIN     ----------------------------------------------------------------------
DNLJ_MICAN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYAWAI
UVRC_THEFY      VVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYAWAI
UVRC_BEUC1      VVGTEVEALQLEYSWIKEFDPRFNVKYRDDKSYPYLAVTMGEEVPRVQVMRGAKRKGTRYFGPYGHAWAI
UVRC_STRAW      XXXXXXXALQLEYSWIKEYDPRFNVKYRDDKSYPYLAVTMNEEFPRVQVMRGHKRKGVRYFGPYGHAWAI
UVRC_RENSM      IVGSELEALQLEYTWIKEFAPRYNLAFRDDKSYPYLAVTMGEEFPRVQVMRGERRKGTRYFGPFT-AGAI
UVRC_ARTCA      VVGSELESLQLEYTWIKEFKPRFNVVFRDDKTYPYLAVTLGEKYPRVQVMRGDKRKGTRYFGPYT-AGAI
UVRC_STRCO      XXXXXXXALQLEYSWIKEYDPRFNVKYRDDKSYPYLAVTMNEEFPRVQVMRGQKKKGVRYFGPYGHAWAI
UVRC_NOCFA      XXXXXXXALQLEYNWIKEFDPRFNVRYRDDKSYPVLAVTLNEEYPRLFVYRGARKKGVRYFGPYAHAWAI
UVRC_MYCPA      VVNTEVEALQLEYNWIKEFDPRFNVRYRDDKSYPVLAVTLNEEFPRLMVYRGPRRKGVRYFGPYSHAWAI
UVRC_FRASN      XXXXXXXALQLEYTWIKEFDPRFNVRYRDDKSYPSLAVTLYEEFPRLQVMRGPKRRGVRYFGPYAHAWAI
UVRC_MYCTU      VVGTEVEALQLEYTWIKEFDPRFNVRYRDDKSYPVLAVTLGEEFPRLMVYRGPRRKGVRYFGPYSHAWAI
UVRC_MYCTA      VVGTEVEALQLEYTWIKEFDPRFNVRYRDDKSYPVLAVTLGEEFPRLMVYRGPRRKGVRYFGPYSHAWAI
UVRC_MYCBT      VVGTEVEALQLEYTWIKEFDPRFNVRYRDDKSYPVLAVTLGEEFPRLMVYRGPRRKGVRYFGPYSHAWAI
UVRC_MYCBP      VVGTEVEALQLEYTWIKEFDPRFNVRYRDDKSYPVLAVTLGEEFPRLMVYRGPRRKGVRYFGPYSHAWAI
UVRC_MYCBO      VVGTEVEALQLEYTWIKEFDPRFNVRYRDDKSYPVLAVTLGEEFPRLMVYRGPRRKGVRYFGPYSHAWAI
UVRC_PROAC      VVQNEVESLQLEYTWIKEFDPRFNVMYRDDKSYPWLCFTWTDEYPRVFVGRGAHHKGWRYYGPFGQAWAI
UVRC_SALTO      SVATEVEALQQEFTEIKQYDPRFNVRYRDDKSYPYLAVTVSEEFPRLQVMRGAKRKGVRYFGPYSHAWAI
UVRC_ACIC1      IVRTEVEALQLEYNWIKQYEPRFNIKYRDDKSYPYLAVTLAEPVPRLMVYRGKRKKGNRYFGPFAHAWAI
UVRC_SALAI      SVATEVEALQQEFTEIKQYDPRFNVRYRDDKSYPYLAVTVDEEFPRLQVMRGAKRRGVRYFGPYSHAWAI
UVRC_FRASC      VVSTEVEALQLEYTWIKQFDPRFNVRYRDDKSYPSLAVTLHEEFPRLQVMRGPKRKGVRYFGPYAHAWAI
UVRC_COREF      VVGSEVEALQLEYTWIKRFDPRFNVKYRDDKSYPMLAVSTGERFPRAFFYRGPRRKGVRYYGPYSHAWAV
UVRC_MYCA9      VVGTEVEALQLEYNWIKEFDPRFNVRYRDDKSYPVLAVTLNEEYPRLFVYRGPRRKGVRYFGPYSHAWAI
UVRC_MYCLE      VVNTEVEALQLEYNWIKEFDPRFNIRYRDDKSYPVLAVTLGEEFPRLMVYRGPRRKGVRYFGPYSHAWAI
UVRC_MYCLB      VVNTEVEALQLEYNWIKEFDPRFNIRYRDDKSYPVLAVTLGEEFPRLMVYRGPRRKGVRYFGPYSHAWAI
UVRC_MYCMM      VVNTEVEALQLEYNWIKEFDPRFNVRYRDDKSYPVLAVTLNEDFPRLMVYRGPRRKGVRYFGPYSHAWAI
UVRC_ARTAT      VVGSELESLQLEYTWIKEFKPRFNVVFRDDKTYPYLAVTMGEKYPRVQVMRGERRKGTRYFGPYT-AGAI
UVRC_MYCGI      VVGTEVEALQLEYNWIKEFDPRFNIRYRDDKSYPVLAVTLNEEYPRLKVYRGPRRKGVRYFGPYSHAWAI
UVRC_ARTS2      VVASELESLQLEYTWIKEFKPRFNVVFRDDKTYPYLAVTMGEKFPRVQVLRGERRKGTRYFGPYT-AGAI
UVRC_RHOE4      XXXXXXXALQLEYNWIKEFDPRFNVRYRDDKTYPVLAVTLNEEFPRLFVYRGPRRKGVRYFGPYSHAWAI
UVRC_MYCSS      VVNTEVEALQLEYNWIKEFDPRFNIRYRDDKSYPVLAVTLNEEFPRLKVYRGPRKKGVRYFGPYSHAWAI
UVRC_MYCSK      VVNTEVEALQLEYNWIKEFDPRFNIRYRDDKSYPVLAVTLNEEFPRLKVYRGPRKKGVRYFGPYSHAWAI
UVRC_MYCSJ      VVNTEVEALQLEYNWIKEFDPRFNIRYRDDKSYPVLAVTLNEEFPRLKVYRGPRKKGVRYFGPYSHAWAI
UVRC_SACEN      VVGTEVEALQLEYSWIKEYDPRFNVRYRDDKSYPVLAVTLHEDFPRLYVTRGPRRKGVRYFGPYAHAWAI
UVRC_KOCRD      XXGSEFESLQLEYTWIKEFAPRFNIAYRDDKSYPYLAVTMSEDVPRAMVTRGEKKPGNRYFGPYSQAWAI
UVRC_CORJK      VVSSELEALNLEYTWIKRFNPRFNVMYRDDKTYPMLAISVKEQIPRAFMYRGPRRKGVRYFGPYPKAWAI
UVRC_RHOSR      XXXXXXXALQLEYNWIKEFDPRFNVRYRDDKTYPVLAVTLNEEYPRLFVYRGPRRKGVRYFGPYSHAWAI
UVRC_RHOOB      XXXXXXXALQLEYNWIKEFDPRFNVRYRDDKTYPVLAVTLNEEYPRLFVYRGPRRKGVRYFGPYSHAWAI
UVRC_MYCVP      XXXXXXXALQLEYNWIKEFDPRFNIRYRDDKSYPVLAVTLNEEYPRLKVYRGPRRKGVRYFGPYSHAWAI
UVRC_CORDI      VVASEVEALQLEYTWIKKFDPHFNVKYRDDKTYPVLAVSVGERFPRAYFYRGPQRKGVRYYGPYSHAWAV
UVRC_MYCS2      XXXXXXXALQLEYNWIKEFDPRFNVRYRDDKSYPVLAVTLNEEYPRLMVYRGPRRKGVRYFGPYSHAWAI
UVRC_CORA7      VVASEVEALQLEYTWIKRFDPRFNVMYRDDKTYPMLAVSVGESIPRAFFYRGPRRKGVRYFGPYSHAWAV
UVRC_CORGB      XXXXXXXXLQLEYTWIKRFDPRFNVKYRDDKTYPMLAVSTGEXXXXXXXXXXXXXKGVRYFGPYSHAWAV
UVRC_CORGL      XXXXXXXXLQLEYTWIKRFDPRFNVKYRDDKTYPMLAVSTGEXXXXXXXXXXXXXKGVRYFGPYSHAWAV
UVRC_LEIXX      VVGSEFEALQLEYTWIKEYNPPFNVQFRDDKSYPYLAVTLGERIPRVLVTRNRIAKGARYFGPYTKVWAI
UVRC_BIFLO      VVATELESLTLEYTWIKEFDPRFNVQFRDDKTYPYLAVSTGERIPRVWVTRSRKRRDTRYFGPYAKVWEL
UVRC_BIFLD      VVATELESLTLEYTWIKEFDPRFNVQFRDDKTYPYLAVSTGERIPRVWVTRSRKRRDTRYFGPYAKVWEL
UVRC_STRGG      XXXXXXXALQLEYSWIKEFDPRFNVKYRDDKSYPYLAVTLNEEFPRVQVMRGAKKKGVRYFGPYGHAWAI
UVRC_SYMTH      VTDTETEALVLESNLIKKHKPKYNIRLRDDKHYPYLRLTLTEQWPRLVVARSMKKDGSRYFGPYTSSQAM
UVRC_ALKOO      VTDTELEALILECNLIKENRPKYNVLLRDDKTYPYIKITTNEEYPRILKTRKVIKDKAKYFGPYTNIGAL
UVRC_DEHE1      ITGSEQEALILELNLIKRHRPYFNVRLKDDKGFPYLKITLNEKWPRIYITRSMADDGGRYFGPFASTRSV
UVRC_CARHZ      ITSTEVEALILEQNLIKRYRPRYNILLKDDKSYPYLKIT-GEEFPRLLITRRVVNDGGRYFGPYPDAGAL
UVRC_CLOAB      VTDSEIEALILECNLIKKYKPRYNILLKDDKHYPFIKVTMNEDFPRIIVTRNMVKDGSKYFGPYPDVSAV
UVRC_CLOTE      ITDSEMEALILECNLIKKYRPKYNILLKDDKGYPYIKITINEDFPRVFISRTIAKDGSRYFGPYTDYSAV
UVRC_DEHSC      ITGSEQEALILELNLIKRHRPYFNVRLKDDKGFPYLKITLNEKWPRIYITRSMADDGGRYFGPFANTRSV
UVRC_DEHSB      ITGSEQEALILELNLIKRHRPYFNVRLKDDKGFPYLKITLNEKWPRIYITRSMADDGGRYFGPFANTRSV
UVRC_ALKMQ      VTDSELEALILECNLIKENRPKYNVLLRDDKTYPYIKVTMNETFPRVLKTRKVLKDKAKYFGPYTNISAL
UVRC_CLOTH      VTDTELEALILECNLIKKHRPKFNILLKDDKNYPYIKVTMNEDFPRILMTRRVEKDGAKYFGPYTSAYAV
UVRC_TROW8      CVADDIEALRLEYSWIKEFAPPCNVKLKDDKAYPFLAVTIGEQVPRLLITR-RKIQYATHFGPYPKVFHL
UVRC_TROWT      CVADDIEALRLEYSWIKEFAPPCNVKLKDDKAYPFLAVTIGEQVPRLLITR-RKIQYATHFGPYPKVFHL
UVRC_EUBE2      ITDSELEALVLECNLIKEHRPKYNTMLKDDKSYPFIKITVGEEYPRVLFARKMKHGAGKYFGPYTSAAAV
UVRC_CLOPS      VTDSEMEALILECNLIKKYSPRYNIALKDDKFYPFIKITTNEDFPRVYVTRNFAKDGNRYFGPYTNGTAV
UVRC_MOOTA      LTDNEVEALILECNLIKQHRPRYNVSLKDDKSYPYIKITTQEDFPRIQITRSVTRDGSRYFGPYTSAGSL
UVRC_CLOP1      VTDSEMEALILECNLIKKYSPRYNIALKDDKFYPFIKITTNEDFPRVYVTRNFAKDGNRYFGPYTNGTAV
UVRC_CLOPE      VTDSEMEALILECNLIKKYSPRYNIALKDDKFYPFIKITTNEDFPRVYVTRNFAKDGNRYFGPYTNGTAV
UVRC_GLOVI      LTDTEAEALVLEDNLIKTHKPRYNVLLKDDKQYPYLCITWSEEYPRIFVTRGSGHPEDRYFGPYTDAGAL
UVRC_CLOK5      VTDSEMEALVLECNLIKKYRPRYNILLKDDKIYPLIKITLNEDFPRIICARNKIKDGAKYFGPYISTGAV
UVRC_GEMAT      VVPSEAHALILEATLIKEYHPRFNIALRDDKSYPYIRVTVNEPFPRVMVTRRLLDDGARYFGPYTDVGAM
UVRC_CLOCE      VVDSEVEALMLECTLIKKYKPKYNILLKDDKHYPYIKVTLNEEYPRILKTRRVEKDGARYFGPYSSGFAV
UVRC_RUBXD      AARGETEALVLEANLIKRHRPRFNASLRDDKSYPYIVVTTGDEYPRVFATRGPHDPRHRYFGPFPSAGSV
UVRC_SYNWW      VTHSEMEALILENNLIKSYKPRYNIDLRDDKSYPYIKVTVADKFPRVYLAREKKDGVSRYFGPYTDVTSL
UVRC_CLOB8      VTDSEMEALILECNLIKKYSPKYNISLKDDKFYPFIKVTTNEDFPRVFITRNYAKDGNKYFGPYPNAGDV
UVRC_METBU      VTESEVAALILEANLVKKNRPHYNIDLKDDKRYPYVKVTVNTKFPKIFITRRRLMDGALYFGPYTNVKPV
UVRC_THETN      VTDTELEALMLECNLIKKYKPKYNVLLKDDKNYPYIKITVAEDYPRIMFTRKIDMDGSKYFGPYGSAFAV
UVRC_SYNJB      VTDNESEALALEDNLIKTHQPPYNVLLKDDKKYPYLCITWSEPYPQLYITRHRRRNQDKYYGPYTDVGLL
UVRC_MICAN      VTDTEAESLALEANLIKQHQPHFNTLLKDDKKYPYICITWSETYPRIFITRKRRNQKDRYYGPYVDTRLL
UVRC_PROA2      LTSSEVEALILENNLIKDLKPRYNINLKDDKTYPYLVIT-NEAFPRILITRQVKRDGSTYFGPYTEARQL
UVRC_DESAA      LVTTEKEALILEANLIRKHKPRYNILLKDGKRFPSLRIDVRTSYPRLEVVRKVKKDGAIYFGPFSSAGKL
UVRC_CYAP4      VTDTXXXXXXXXXXXIKQHQPHFNVLLKDDKKYPYLCITWSEAYPRIFIKRRAEAKDDRYYGPYTDTHLL
UVRC_ALHEH      VTHTEAEALILENTLIKELRPRYNVLLRDDKSYPWIYLSSHQDFPRLSFHRGARKGPGRWFGPFPSGHAV
UVRC_THICR      VTDTESEALILENTLIKRHKPRYNILFRDDKSYPYIFVSTGKKFPSLSYHRGAKRKVGRYFGPFPNASAV
UVRC_ALCBS      VTGSEVEALLLEQSLIKELKPPYNILLRDDKSYPYIRITRSDRFPRVTFHRGTRRAGSQYFGPYPSGSAV
UVRC_SYNJA      VTDNESEALALEDNLIKTYQPPYNVLLKEDKKYPYLCITWSEPYPQIYITRHRRQNQDKYYGPYTDVGLL
UVRC_RHOS4      XXXXXXXXXXXXQNLIKQLKPRYNVLLRDDKSFPNILIAKDHPFPMLKKHRGKKSEKGSYFGPFASAGAV
UVRC_CHLTE      ITSSEVEALILENNLIKELKPRYNVNLKDDKSYPWLVIT-NERFPRIFLTRQVRRDGSLYFGPYTEASQL
UVRC_PSEMY      ITANETEALLLEQTLIKEWRPPYNILLRDDKSYPYVFLS-DGEFPRLGIHRGAKKAKGRYFGPYPSALAI
UVRC_NOSP7      VTDTXXXXXXXXXXXIKQHQPYFNVLLKDDKKYPYLCITWSEDYPRIFITRKRQKEKDKFYGPYTDAGLL
UVRC_PELLD      ITSSEVEALILENNLIKELKPRYNVNLKDDKTYPWLVIT-GEPFPRVFISRNRTRDKSTWFGPYTEAGQL
UVRC_ACIBL      VVDNEKEALALENNLIKQKKPRFNILLRDDKTYPYIKLTMGEKWPRVYVTRRLKKDGSEYYGPFFPANLA
UVRC_CHLCH      ITSSEVEALILENNLIKELKPRYNVNLKDDKTYPYLVIT-NEPYPRILFTRHRRNDGSIAFGPYTEARQL
UVRC_THEP3      VTDTELEALMLECNLIKKYKPKYNVLLKDDKNYPYIKVTVNEEYPRIMFTRRIEPDGAKYFGPYSSAFAV
UVRC_PSEA7      ITANETEALLLEQTLIKEWRPPYNILLRDDKSYPFVFLSSEDEYPRLSLHRGAKKRKGRYFGPYPSAGAI
UVRC_THEPX      VTDTELEALMLECNLIKKYKPKYNVLLKDDKNYPYIKVTVNEEYPRIMFTRRIEPDGAKYFGPYSSAFAV
UVRC_DESAP      VTGSEIEALILESNLIKEHRPRYNVVLKDDKSYPYLKVTVQEEYPRIFLTRAQPRDGARYFGPYPSAAAV
UVRC_METFK      VTRSXXXXXXXXXXXIKGFMPRYNVLFRDDKSYPYIALT-GDTFPRLAFHRGAQRKGSSYFGPFPNAVAV
UVRC_GEOMG      VTDTEKEALILENTLIKKHRPRYNLDLRDDKTYFSLRMDMNEEFPRLTIIRKVRQDGARYFGPYSSAASA
UVRC_PSEAE      ITANETEALLLEQTLIKEWRPPYNILLRDDKSYPFVFLSSEDEYPRLSLHRGAKKRKGRYFGPYPSAGAI
UVRC_PSEAB      ITANETEALLLEQTLIKEWRPPYNILLRDDKSYPFVFLSSEDEYPRLSLHRGAKKRKGRYFGPYPSAGAI
UVRC_PSEA8      ITANETEALLLEQTLIKEWRPPYNILLRDDKSYPFVFLSSEDEYPRLSLHRGAKKRKGRYFGPYPSAGAI
UVRC_SYNAS      LTETEKEALILENNLIKEHHPRYNICFRDDKAYFNIRADLNEPFPRFQLVRRPRKDGAKYFGPYPSSASA
UVRC_MAGSA      TTRTEVEALLLESNLIKSLGPRYNILLKDDKTFPHILITADHDWPQVLKHRGARNRKGEYFGPFASAGAV
UVRC_CLOPH      IVDSEMEALVLECNLIKEHRPKYNTMLKDDKSYPYIKVTVNEAYPRVLFARQQKKDKAKYFGPYTSLGAV
UVRC_NITOC      VTHTENEALILESNLIKALQPRYNVLLRDDKSYPYIFLSA-DDFPRLGFHRGVKQVSGQYFGPYPNIRSV
UVRC_METST      LTNTEKEALILEANLIKKYRPHYNISLKDGKQYPYIKIT-NEDFPRIYITRNIVNDKASYYGPYTDSTHA
UVRC_ANASP      VTDTXXXXXXXXXXXIKQHQPYFNVLLKDDKKYPYVCITWSEDYPRIFITRKRQKEKDKYYGPYTDSGLL
UVRC_YERPS      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPLIFLSADEH-PRLAVHRGAKHEKGEYFGPFPNSYAV
UVRC_PELPB      ITSSEVEALILENNMIKELKPRYNVNLKDDKTYPYLVIT-NEPFPRILISRQRRKDGSTWFGPYTESRQL
UVRC_GEOSL      VTDTEKEALLLENTLIKEHRPRYNLDLRDDKTYFSLRLDMNEEFPRLTIVRRPGRDGARYFGPYSSASAA
UVRC_YERE8      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPLIFLSA-DKHPRLAIHRGAKHEKGEYFGPFPNSYAV
UVRC_CLONN      ITDSEMEALILECNLIKKYRPRYNILLKDDKHYPFLKITTNEDFPRIFVTRVRAKDGARYLGPYPETSAV
UVRC_CLOBM      ITDSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVISTRKVTKDGSKYFGPYVDGSSV
UVRC_YERPN      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPLIFLSADEH-PRLAVHRGAKHEKGEYFGPFPNSYAV
UVRC_YERPE      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPLIFLSADEH-PRLAVHRGAKHEKGEYFGPFPNSYAV
UVRC_YERPA      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPLIFLSADEH-PRLAVHRGAKHEKGEYFGPFPNSYAV
UVRC_YERP3      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPLIFLSADEH-PRLAVHRGAKHEKGEYFGPFPNSYAV
UVRC_PSEFS      ITANETEALLLEQTLIKEWRPPYNILLRDDKSYPYVFLS-DGNFPRLSIHRGAKKQKGKYFGPYPSAGAI
UVRC_GLUOX      ITRTEADALLLEANYIKRMKPRFNILLRDDKSYPWLMLTESHEFPQITKQRGKPVKGATYWGPFANAWAV
UVRC_CLOBK      ITDSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVVSTRKVTKDGSKYFGPYVDGSSV
UVRC_AZOVD      ITANETEALLLEQTLIKEWRPPYNILLRDDKSYPYVFLS-DGAFPRLGIHRGAKQRKGRYFGPYPSAGSI
UVRC_PSE14      ITGNETEALLLEQTLIKEWRPPYNILLRDDKSYPYVFLS-DGNYPRLSIHRGAKKAKGRYFGPYPSAGAI
UVRC_CLOBL      ITDSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVVSTRKVTKDGSKYFGPYVDGSSV
UVRC_CLOBJ      ITDSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVVSTRKVTKDGSKYFGPYVDGSSV
UVRC_BDEBA      LTKTEVEAFLLEASLIKKHRPKYNIRLRDDKAYPYIRFSWGDQAPRLYLARKVKKDGSLYFGPYTSGLAV
UVRC_PSEU2      ITGNETEALLLEQTLIKEWRPPYNILLRDDKSYPYVFLSDNA-FPRLSIHRGTKKAKGRYFGPYPSAGAI
UVRC_PSEE4      ITANETEALLLEQTLIKEWRPPYNILLRDDKSYPYVFLS-DGEFPRLGIHRGAKKAKGRYFGPYPSAGAI
UVRC_METCA      VTRTEGEALLLENQLIKRHKPRYNINLRDDKSYPYIYVSTHQEFPRLAFHRGSRARPGRFFGPFPSAAAV
UVRC_SALHS      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_CLOBH      ITDSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVISTRKVTKDGSKYFGPYVDGSSV
UVRC_CLOB1      ITDSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVISTRKVTKDGSKYFGPYVDGSSV
UVRC_SACD2      VTPSEAEALVLEHNLIKSQKPPFNILLRDDKSFPYIFISEGEPYPKLAFHRGPKKKKGQYFGPFPNASAV
UVRC_CITK8      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_ANASK      VTRSEKEAVLLENELIKKHRPRFNVRLRDDKDFIVLKLDERHPYPRLEVRRAREKRGARYFGPYSSASSI
UVRC_ESCF3      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_ANADE      VTRSEKEAVLLENELIKKHRPRFNVRLRDDKDFIVLKLDERHPYPRLEVRRAREKRGARYFGPYSSASSI
UVRC_ERWCT      ITHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPMIFLS-GDAHPRLTVHRGAKHAKGEYFGPFPNGNAV
UVRC_DICNV      STPTXXXXXXXXXXXIKQYQPKFNILLRDDKSYPYICLS-QHDFPRLFLYRGARKNG-DFFGPYPNVQSA
UVRC_CLOB6      ITDSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVISTRKVTKDGSKYFGPYVDGSSV
UVRC_SALPK      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_SALPA      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_PARUW      VVTSEKEALLLENNLIKQHKPRYNALLKDDKSYIALKISQNDAWATVRLVRGTPEPDGLYFGPYTSAQAA
UVRC_SALTY      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_SALTI      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_SALPB      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLSMHRGAKHAKGEYFGPFPNGYAV
UVRC_PSEPF      ITSNETEALLLEQTLIKEWRPPYNILLRDDKSYPYVFLS-DGQFPRLSIHRGAKKAKGKYFGPYPSAGAI
UVRC_SYNS3      VTDSEAEALALESNLIKNQQPHFNVLLKDDKKYPYLCITWSEDYPXXXXXXXXXXXSPRFYGPYVDVGLL
UVRC_SALNS      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_SALG2      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_SALRD      VTDTEAEALILENNQIKELQPRYNVNLRDDKTYPYICIK-NERFPRVFKTRTVKQDGSEYFGPYADVSKM
UVRC_SALEP      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_SALDC      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_SALA4      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_PSEP1      ITANETEALLLEQNLIKEWRPPYNILLRDDKSYPYVFLS-DGEFPRLGIHRGAKKAKGRYFGPYPSAGAI
UVRC_LEPBL      ATGTEKEALILEATLIKKHNPRFNVRFKDDKKYPYICVSLSESFPMVYITRKLKDNGDRYFGPYSDVKST
UVRC_LEPBJ      ATGTEKEALILEATLIKKHNPRFNVRFKDDKKYPYICVSLSESFPMVYITRKLKDNGDRYFGPYSDVKST
UVRC_DESPS      ITTTEKEALILEASLIKKHKPRYNIILRDDKNYPYIAVTVGEEWPRVMMVRRKRRDNSRYFGPYSSATAM
UVRC_ANAD2      VTRSEKEAVLLENELIKKHRPRFNVRLRDDKDFIVLKLDERHPYPRLEVRRAREKRGARYFGPYSSASSI
UVRC_SALSV      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_SALPC      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_SALCH      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_PSEPK      ITANETEALLLEQNLIKEWRPPYNILLRDDKSYPYVFLS-DGEFPRLGIHRGAKKAKGRYFGPYPSAGAI
UVRC_LEGPL      VTRSETEALLLESNLIKALRPKYNVLLRDDKSYPYIHLSNHPDFPRVELYRSKKKPSGNFFGPYPGVAAV
UVRC_GRABC      TTHTXXXXXXXXXNLIKRLKPRFNIVLRDDKSYPWLMLTEDHAFPQIMKHRGAQRKAASYWGPFASAWAV
UVRC_CHLPD      ITSSEVEALILENNLIKELKPRYNVNLKDDKTYPYLVIT-NEPFPRILVTRQVKKDGSTWFGPYTEARQL
UVRC_GEOLS      ITDTEKEALLLENTLIKQHQPRYNLNLKDDKTFFSLRIDLTERFPRFTVVRKVSRDGARYFGPYASASAA
UVRC_ECO45      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_ANAVT      VTDTXXXXXXXXXXXIKQHQPYFNVLLKDDKKYPYVCITWSEDYPRIFITRKRQKEKDKYYGPYTDSGLL
UVRC_JANSC      XXXXXXXXXXXXQNLIKQLKPKFNVLLRDDKSFPNILVSDEHAFPQIKKHRGSKKEKGSYFGPFASAGAV
UVRC_PSEPW      ITANETEALLLEQNLIKQWRPPYNILLRDDKSYPYVFLS-DGQFPRLGIHRGAKKAKGRYFGPYPSAGAI
UVRC_PROMT      VTDNESEALTLESNLIKSHQPYFNVLLKDDKKYPYVCITWGDKYPRIFLTRKRRQRQLKYYGPYVDVYLL
UVRC_PROM1      VTDNESEALTLESNLIKSHQPYFNVLLKDDKKYPYVCITWGDKYPRIFLTRKRRQRQLKYYGPYVDVYLL
UVRC_SILPO      XXXXXXXXXXXXQNLIKQLKPKYNVLLRDDKSFPNILVAKDHSFAQIKKHRGAKKEKGTYFGPFASAGAV
UVRC_LEGPA      VTRSETEALLLESNLIKALRPKYNVLLRDDKSYPYIHLSNHPDFPRIELYRSKKKPSGNFFGPYPGVAAV
UVRC_PROMP      VTDSEYEALNLESNLIKTNKPYFNILLKDDKKYPYLCITWSEQYPRIFITRKRRNRNNRYYGPYVDVGLL
UVRC_PROMM      VTDSEAESLVLESNLIKNQQPHFNVLLKDDKKYPYLCITWSEEYPXXXXXXXXXNKNDRFYGPYVDVGLL
UVRC_LEGPH      VTRSETEALLLESNLIKALRPKYNVLLRDDKSYPYIHLSNHPDFPRIELYRSKKKPSGNFFGPYPGVAAV
UVRC_ECOK1      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_TRIEI      VTDTXXXXXXXXXXXVKQHQPYFNVLLKDDKKYPYLCITWSEDYPRIFITRKRRKAKDRYYGPYVDTRLL
UVRC_MESSB      VTRXXXXXXXXXXNLIKRLRPRFNVLMRDDKSFPYILLTGNHPAPGIFKHRGARSRRGDYFGPFASAGAV
UVRC_ECOUT      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_ECOSM      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_SODGM      ITHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDAHPRITSHRGAKHAKGDYFGPFPNGYAV
UVRC_SHISS      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_SHIB3      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_ECOSE      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_ECOLU      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_ECOLI      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_ECOLC      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_ECOL6      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_ECOHS      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_ECODH      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_ECOBW      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_ECO8A      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_ECO81      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_ECO7I      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_ECO5E      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_ECO57      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_ECO55      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_ECO27      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_ECO24      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_LEGPC      VTRSETEALLLESNLIKALRPKYNVLLRDDKSYPYIHLSNHPDFPRIELYRSKKKPSGNFFGPYPGVAAV
UVRC_NEIMA      ITRSEAEALILENNFIKALSPKYNILFRDDKSYPYLMLS-GHQYPQMAYYRGTLKKPNQYFGPYPNSNAV
UVRC_CALS8      VTDTEVEALILECNLIKEYRPKYNVLLRDDKNYQYIKIT-NEMFPRLVTTRKVEKDGAKYFGPYVSGYSV
UVRC_ERWT9      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPYIFLSADHH-PRLASHRGAKHAKGEYFGPFPNGYAV
UVRC_DESAH      VTATEHEALILESTLIKKHSPRYNVILKDGKSYPCLRIDTSKPFPALEVVRKIGDDNAVYFGPYSSVQSV
UVRC_KLEP3      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFGPFPNGYAV
UVRC_LEPIC      ATGTEKEALILEATLIKKHNPRFNVRLKDDKKYPYICVSLSEPYPMVYVTRKLKDNGDRYFGPYSDVKST
UVRC_ACIBY      VTRSETEALLLEQNLIKQHRPPYNIMLRDDKSYVYIFVSADKPYPRIASGRGKGKHQIKFFGPYPSAYSA
UVRC_SYNP6      VTDTXXXXXXXXXXXIKQHQPHFNVLLKDDKKYPYLCITWSDDYPRIFITR-KRRLGNRYYGPYVDTRLL
UVRC_SYNE7      VTDTXXXXXXXXXXXIKQHQPHFNVLLKDDKKYPYLCITWSDDYPRIFITR-KRRLGNRYYGPYVDTRLL
UVRC_SHEHH      VTHSETDALILENDYIKQYMPKYNVLLRDDKSYPYILLS-NHKHPRLAYHRGPKRDKGLYFGPYPNGGAV
UVRC_PHOLL      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPYIFLSA-DKHPRLAMYRGAKHFKGEYFGPFPNTHAV
UVRC_MYXXD      LVSNXXXXXXXXXXXXXXHRPRFNVLLKDDKQFISLRLDRTQPYPRLEVVRKYERDGARYFGPYSSAGAI
UVRC_NITEC      VTRSXXXXXXXXXXXIKSLAPRYNILFRDDKSYPYLLLT-NHAFPRLAFYRGALDNRHQYFGPFPNAGVV
UVRC_IDILO      VTNTEAEALILENSFIKKYRPRYNVLLRDDKSYPYIILT-SHQHPKLGFHRGARRAKGDYFGPFPNGSAV
UVRC_NITMU      VTRSXXXXXXXXXXXIKSLNPRYNILFRDDKSYPYVILS-GHRFPRLGFHRGPLDKKHHYFGPFPNAGMV
UVRC_LEPIN      ATGTEKEALILEATLIKKHNPRFNVRLKDDKKYPYICVSLSEPYPMVYVTRKLKDNGDRYFGPYSDVKST
UVRC_ACIBS      VTRSETEALLLEQNLIKQHRPPYNIMLRDDKSYVYIFVSADKPYPRIASGRGKGKHQIKFFGPYPSAYSA
UVRC_HAHCH      ITHSETEALLLEQNLIKTLKPPYNILLRDDKSYPYIYLSSHDEYPSLTFRRVRQKKTGRFFGPYTSAAAV
UVRC_ACAM1      VTDTXXXXXXXXXXXIKQHQPHFNVLLKDDKKYPYLCVTWSQTYPRIFITRKRRKAQDKYYGPYVDVWQL
UVRC_PELCD      VTDTEKEALILENTLIKKYRPRYNINLRDDKTYLSLRLDPRQEFPMLQLVRRVRRDGALYFGPYASSTAV
UVRC_ACTSZ      XXXXXXXALLLEHNYIKTFQPRYNVLLRDDKSYPYILLT-KERHPRIAAYRGAKKIQGEYFGPYPHAGAV
UVRC_SILST      XXXXXXXXXXXXQNLIKQLKPKYNVLLRDDKSFPYIMVSKNHAFPQLKKHRGARKGKXXXXXXXXXXXXV
UVRC_BORA1      VTRSEAEALILENNLIKSLRPRYNILFRDDKSYPYLLITAHE-WPRIAYYRGSTSKRGQYFGPYPNSWAV
UVRC_PROMH      VTHTETEALLLEHSYIQRYQPRYNVLLRDDKSYPYIYLSADKH-PRLASYRGAKHAKGEYFGPFPNSLAV
UVRC_ZYMMO      TTVTESEALLLEAQLIKRYRPPYNILLRDDKSFPYILLKEDPQFPSLQRHRGVKRAKGKYYGPFASADSV
UVRC_NEIG1      ITRSEAEALILENNFIKALSPKYNILFRDDKSYPYLMLS-GHQYPQMAYYRGTLKNPNQYFGPYPNSNAV
UVRC_ACIC5      TVGNEHEALALENNLIKQRKPRFNVLLRDDKTYPYVKLTLGDRYPKVFVTRRLRKDGAAYYGPFFPGNLA
UVRC_PHOPR      VTHTETEALILEHNYIKLYLPKYNVLLRDDKSYPYIFLS-NHHHPRLSIHRGTKKRKGEYFGPYPDAGAV
UVRC_ACIAD      VTRSETEALLLEQNLIKQHRPPYNIMLRDDKSYVYIFVSSDKPYPRIASGRGKGKHQIKFFGPYPSAYSA
UVRC_SHESH      VTHSETDALILENDYIKQYMPRYNVLLRDDKSYPYILLS-DHKHPRLAYHRGPKRDKGSYFGPYPNGGAV
UVRC_SHEPA      VTHSETDALILENDYIKQYMPKYNVLLRDDKSYPYILLS-NHQHPRLAYHRGPKRDKGQYFGPYPNGGAV
UVRC_PASMU      ITSSETEALLLEHNYIKTYQPRYNVLLRDDKSYPYILLTA-ERHPRISAYRGSKKIKGEYFGPYPHASAV
UVRC_ENTS8      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPYIFLS-GDTHPRLAIHRGAKHAKGEYFGPFPNGYAV
UVRC_CLOD6      ITDSELEALILECNLIKRYRPKYNVVLRDDKTYPYIKVTTNEDYPRILKVRRVLKDKAKYFGPYTNITAV
UVRC_SHEPW      ITHSETDALILENDYIKQYMPKYNVLLRDDKSYPYILLS-NHKHPRLSYHRGPKRAKGQYFGPYPNGGAV
UVRC_HAEI8      XXXXXXXXXXXXHNFIKLYQPRYNVLLRDDKSYPFILLT-KERHPRITSYRGSKKFAGEYFGPYPHAGAV
UVRC_CHRVO      VTRSEAEALILENNLIKALAPRYNILFRDDKSYPYLMFS-GHAFPQMAYYRGEPKKPNQYFGPYPNGYAV
UVRC_BRUME      VTRXXXXXXXXXXNLIKRLRPRFNVLMRDDKSFPYILLTGGHRAPGIFKHRGARSRKGDYFGPFASAGAV
UVRC_BRUAB      VTRXXXXXXXXXXNLIKRLRPRFNVLMRDDKSFPYILLTGGHRAPGIFKHRGARSRKGDYFGPFASAGAV
UVRC_BRUA2      VTRXXXXXXXXXXNLIKRLRPRFNVLMRDDKSFPYILLTGGHRAPGIFKHRGARSRKGDYFGPFASAGAV
UVRC_SHEFN      VTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLS-GHKHPRLAYHRGPKREKGHYFGPYPNGGAV
UVRC_NEIMB      ITRSESEALILENNFIKALSPKYNILFRDDKSYPYLMLS-GHQYPQMAYYRGTLKKPNQYFGPYPNSNAV
UVRC_METTH      LTQNEKEALILESNLIKRYRPPYNVRLKDDKRYPFIKIT-DEEYPRVLIVRTIGRDSARYYGPFTDTGAV
UVRC_BRUSU      VTRXXXXXXXXXXNLIKRSRPRFNVLMRDDKSFPYILLTGGHRAPGIFKHRGARSRKGDYFGPFASAGAV
UVRC_GEOKA      VTSSNAEALILEMNLIKKHDPKYNVMLKDDKSYPFIKITA-EKHPRLLITRKVKKDGGKYFGPYPNVQAA
UVRC_SHESM      LTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYIFLSQHEH-PRLAYHRGPQREKGYYFGPYPNGGAV
UVRC_SHEON      LTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLSQHEH-PRLAYHRGPQREKGHYFGPYPNGGAV
UVRC_PSEFL      XXXXXXXXXXXXXXXXKEWRPPYNILLRDDKSYPYVFLS-DGEFPRFSIHRGAKKQKGKYFGPYPSAGAI
UVRC_HAEIE      XXXXXXXXXXXXHNFIKLYQPRYNVLLRDDKSYPFILLT-KERHPRITSYRGSKKFAGEYFGPYPHAGAV
UVRC_PSESM      XXXXXXXXXXXXXXXXKEWRPPYNILLRDDKSYPYVFLS-DGTYPRLSIHRGAKKAKGRYFGPYPSAGAI
UVRC_EDWI9      VTHTETEALLLEHNYIKRYQPRYNVLLRDDKSYPLIFLSA-DRHPRLAVHRGARRARGDYFGPFPNANAV
UVRC_SOLUE      LVDNEKEALALENNLIKQYKPRFNILLRDDKTYPYVKVT-NEKYPRVYVTRRLRKDGAQYFGPFFPANLA
UVRC_SHESA      LTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYIFLSQHEH-PRLAYHRGPQREKGYYFGPYPNGGAV
UVRC_NOVAD      TTNSXXXXXXXXXQLIKRFRPPYNVLLRDDKSFPFILLRGDHAFPRISKHRGARKAKGNYYGPFASAGSV
UVRC_SHESR      LTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYIFLSQHEH-PRLAYHRGPLREKGYYFGPYPNGGAV
UVRC_BURM1      VTRSXXXXXXXXXXXXXXXXPRYNILFRDDKSYPYLKLT-SHRFPRMAYYRGAVDKQNQYFGPFPSAWAV
UVRC_BACLD      VTSSNIEALILEMNLIKKYDPKYNVMLKDDKSYPFIKIT-NERHPKLVVTRKVKKDKGRYFGPYPNVQAA
UVRC_SYNY3      VTDTXXXXXXXXXXXIKQHQPHFNVLLKDDKKYPYVCITWSETYPRIFITRKRRLNQARYYGPYVDSFSL
UVRC_DICT6      ITDTETEALILESVLIKKYRPIMNVQLRDDKQYPMLKLTLYEEYPRLVLARRFEDDGARYYGPYTQSGTV
UVRC_FINM2      IVNNECEALVLESNLIKKNSPKYNIVLRDDKQYPYIKIT-NEKFPRVLKTRRVLKDKAKYFGPFPNAYAV
UVRC_SHELP      LTPSETDALILENDYIKQYMPRYNVLLRDDKSYPYIFLS-GHRHPRLAYHRGPQREKGHYFGPYPNGGAV
UVRC_POLSJ      VVRSXXXXXXXXXXXIKTLNPKYNILFRDDKSYPYLKLTAVQPFPRIAYYRGAVEKKHRYFGPYPSAWAV
UVRC_CAUCR      TTRTEADALLLEINLIKQLKPRFNVLLRDDKSFPEIVIRRDHDAPQLRKHRGAHTIKGDYFGPFASAWAV
UVRC_SERP5      VTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPLIFLSA-DSHPRLAVHRGAKHAKGEYFGPFPNSYAV
UVRC_OCEIH      VTSSEIEALILEMNLIKKYDPRYNVMLKDDKSYPYLKIT-SERHPRLIVTRRLKKDKGKYFGPYPNVIAA
UVRC_THIDA      VTRTXXXXXXXXXXXIKGLKPRFNILFRDDKSYPYLLLT-GHGYPRLAYFRGAPKKRDQAFGPYPNSYAV
UVRC_BACSU      VTSSNLEALILEMNLIKKHDPKYNVMLKDDKTYPFIKLT-HERHPRLIVTRNVKKDKGRYFGPYPNVQAA
UVRC_BACA2      VTSSNLEALILEMNLIKKYDPKYNVMLKDDKTYPFIKIT-HERHPRLIVTRNVKKDKGRYFGPYPNVQAA
UVRC_PROM9      VTDSEYEALNLESNLIKTNKPYFNILLKDDKKYPYLCITWSEKYPRIFITXXXXXXXXRYYGPYVDVGLL
UVRC_LISMH      VTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKIT-NERHPRLIITRQVKKDKGKYFGPYPNVYAA
UVRC_LISIN      VTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKIT-NERHPRLIITRQVKKDKGKYFGPYPNVYAA
UVRC_RHORT      XXXXXXXXXXXXSNLIKKLKPRYNILLRDDKSFPYIEITSDHAFPRIVKFRGTLRKGGEYFGPFASAGAV
UVRC_GEOSF      VTDTEKEALILENTLIKKYRPKYNFNLRDDKTYFSLRMDMSSDFPRLSIIRKVTRDGARYFGPYSSASDA
UVRC_SHEB9      LTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLSQHEH-PRLAYHRGPQREKGHYFGPYPNGGAV
UVRC_RHILO      VTRTXXXXXXXXXXXXKRLRPRFNVLMRDDKSFPYILLTGDHVSPGIYKHRGARSRKGDYFGPFASAGAV
UVRC_LISMO      VTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKIT-NERHPRLIITRQVKKDKGKYFGPYPNVYAA
UVRC_LISW6      VTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKIT-NERHPRLIITRQVKKDKGKYFGPYPNVYAA
UVRC_SHEB8      LTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLSQHEH-PRLAYHRGPQREKGHYFGPYPNGGAV
UVRC_LISMC      VTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKIT-NERHPRLIITRQVKKDKGKYFGPYPNVYAA
UVRC_SHESW      LTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLSQHEH-PRLAYHRGPQREKGHYFGPYPNGGAV
UVRC_PROM4      LTDSDSEALNLESNLIKEHQPYFNILLKDDKKYPYLCITWSEEYPRIFITXXXXXXNSRYYGPYVDVXXX
UVRC_BREBN      VVSSAIEALILECNLIKEHDPRYNVMLRDDKTYPYIKIT-NEAQPRLEITRKVLKDKAKYFGPYPNAGDA
UVRC_BARHE      VTHTXXXXXXXXXXXXKRLHPRFNVLLRDDKSFPYIIITDDHRAPALYKHRGARTRKAHYFGPFASSSAV
UVRC_SPHAL      TTTSXXXXXXXXXQLIKRYRPPYNVLLRDDKSFPFILLRTDHDFPRVQKHXXXXXXXXXXXXPFASAGSV
UVRC_SYNSC      VTDSEAEALVLESNLIKNHQPHFNVLLKDDKKYPYLCITWSEAYPXXXXXXXXXXXSPRFYGPYVDVGLL
UVRC_LISMF      VTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKIT-NERHPRLIITRQVKKDKGKYFGPYPNVYAA
UVRC_SHEB5      LTHSETDALLLENDYIKQYMPKYNVLLRDDKS