[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ56082.1

[Show Plain Result]


## Summary of Sequence Search
    1::140
  373::451     3e-04  25%  473 aa  MNME_CHLCH RecName: Full=tRNA modification GTPase mnmE;       
    1::140

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGLTDEEGEHLSAVASAFQSLARGTSRQFKGG
MNME_CHLCH      ---------------------------------------GIAAKEGDGLEALKQQMSNMVAGLDKLHEAS


                         .         .         *         .         .         .         .:140
query           RVLQTVVEMEHAYLFVTAAGEGACMAVLAAEDADVGMIAYEMNSRIKRVGQxxxxxxxxxxxxxxxxxxx
MNME_CHLCH      VLITSMRHYEALRRASDALENGAC---LVAEHAETELVAFELRSALEAVGE-------------------