[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ56085.1

[Show Plain Result]


## Summary of Sequence Search
    1::399
    1::399       0.0 100%  399 aa  ASSY_THEFY RecName: Full=Argininosuccinate synthase;       
    1::398       0.0  76%  403 aa  ASSY_SALAI RecName: Full=Argininosuccinate synthase;       
    8::402     e-178  77%  404 aa  ASSY_STRAW RecName: Full=Argininosuccinate synthase;       
    1::395     e-177  77%  397 aa  ASSY_STRGG RecName: Full=Argininosuccinate synthase;       
    1::395     e-176  77%  397 aa  ASSY_STRCL RecName: Full=Argininosuccinate synthase;       
    1::399     e-175  73%  401 aa  ASSY_ARTS2 RecName: Full=Argininosuccinate synthase;       
    1::394     e-175  76%  401 aa  ASSY_ACIC1 RecName: Full=Argininosuccinate synthase;       
    1::399     e-174  72%  401 aa  ASSY_ARTAT RecName: Full=Argininosuccinate synthase;       
    1::398     e-174  73%  401 aa  ASSY_ARTCA RecName: Full=Argininosuccinate synthase;       
    1::396     e-173  73%  400 aa  ASSY_NOCFA RecName: Full=Argininosuccinate synthase;       
   16::414     e-170  71%  420 aa  ASSY_RENSM RecName: Full=Argininosuccinate synthase;       
    1::396     e-169  72%  399 aa  ASSY_RHOSR RecName: Full=Argininosuccinate synthase;       
    1::396     e-169  72%  399 aa  ASSY_RHOOB RecName: Full=Argininosuccinate synthase;       
    1::396     e-168  70%  399 aa  ASSY_RHOE4 RecName: Full=Argininosuccinate synthase;       
    1::396     e-167  70%  400 aa  ASSY_MYCSS RecName: Full=Argininosuccinate synthase;       
    1::396     e-167  70%  400 aa  ASSY_MYCSK RecName: Full=Argininosuccinate synthase;       
    1::396     e-166  68%  399 aa  ASSY_CORDI RecName: Full=Argininosuccinate synthase;       
    1::399     e-165  69%  400 aa  ASSY_FRASN RecName: Full=Argininosuccinate synthase;       
    1::395     e-164  68%  399 aa  ASSY_CORU7 RecName: Full=Argininosuccinate synthase;       
    1::395     e-163  68%  398 aa  ASSY_CORJK RecName: Full=Argininosuccinate synthase;       
    2::399     e-162  67%  399 aa  ASSY_MYCLE RecName: Full=Argininosuccinate synthase;       
    1::399     e-162  68%  400 aa  ASSY_FRAAA RecName: Full=Argininosuccinate synthase;       
    1::396     e-161  68%  398 aa  ASSY_CORK4 RecName: Full=Argininosuccinate synthase;       
    1::396     e-160  66%  401 aa  ASSY_COREF RecName: Full=Argininosuccinate synthase;       
    1::396     e-159  67%  400 aa  ASSY_MYCSJ RecName: Full=Argininosuccinate synthase;       
    1::384     e-158  69%  400 aa  ASSY_MYCVP RecName: Full=Argininosuccinate synthase;       
    1::396     e-158  67%  399 aa  ASSY_MYCS2 RecName: Full=Argininosuccinate synthase;       
    1::398     e-157  67%  398 aa  ASSY_MYCA1 RecName: Full=Argininosuccinate synthase;       
    1::399     e-157  66%  401 aa  ASSY_KOCRD RecName: Full=Argininosuccinate synthase;       
    1::384     e-157  68%  400 aa  ASSY_MYCGI RecName: Full=Argininosuccinate synthase;       
    1::398     e-157  67%  398 aa  ASSY_MYCPA RecName: Full=Argininosuccinate synthase;       
    1::396     e-156  66%  398 aa  ASSY_MYCMM RecName: Full=Argininosuccinate synthase;       
    1::395     e-156  68%  417 aa  ASSY_CLAMS RecName: Full=Argininosuccinate synthase;       
    1::396     e-156  66%  398 aa  ASSY_MYCUA RecName: Full=Argininosuccinate synthase;       
    1::394     e-156  67%  412 aa  ASSY_CLAM3 RecName: Full=Argininosuccinate synthase;       
    5::397     e-155  65%  412 aa  ASSY_BIFLO RecName: Full=Argininosuccinate synthase;       
    5::397     e-155  65%  412 aa  ASSY_BIFLD RecName: Full=Argininosuccinate synthase;       
    5::397     e-155  65%  412 aa  ASSY_BIFLI RecName: Full=Argininosuccinate synthase;       
    1::398     e-155  66%  398 aa  ASSY_MYCTU RecName: Full=Argininosuccinate synthase;       
    1::398     e-155  66%  398 aa  ASSY_MYCTA RecName: Full=Argininosuccinate synthase;       
    1::398     e-155  66%  398 aa  ASSY_MYCBT RecName: Full=Argininosuccinate synthase;       
    1::398     e-155  66%  398 aa  ASSY_MYCBP RecName: Full=Argininosuccinate synthase;       
    1::398     e-155  66%  398 aa  ASSY_MYCBO RecName: Full=Argininosuccinate synthase;       
    1::396     e-154  64%  401 aa  ASSY_CORGL RecName: Full=Argininosuccinate synthase;       
    1::396     e-153  64%  401 aa  ASSY_CORGB RecName: Full=Argininosuccinate synthase;       
    1::399     e-153  65%  400 aa  ASSY_FRASC RecName: Full=Argininosuccinate synthase;       
   12::403     e-153  64%  418 aa  ASSY_BIFAA RecName: Full=Argininosuccinate synthase;       
    1::398     e-148  64%  413 aa  ASSY_MICLC RecName: Full=Argininosuccinate synthase;       
    4::391     e-120  54%  419 aa  ASSY_BREBN RecName: Full=Argininosuccinate synthase;       
    5::390     e-119  54%  403 aa  ASSY_LACS1 RecName: Full=Argininosuccinate synthase;       
    5::390     e-119  56%  409 aa  ASSY_RUBXD RecName: Full=Argininosuccinate synthase;       
    5::399     e-119  54%  399 aa  ASSY_ACAM1 RecName: Full=Argininosuccinate synthase;       
    5::398     e-119  55%  403 aa  ASSY_BACLD RecName: Full=Argininosuccinate synthase;       
    4::392     e-118  54%  398 aa  ASSY_GLOVI RecName: Full=Argininosuccinate synthase;       
    5::391     e-118  55%  403 aa  ASSY_BACSU RecName: Full=Argininosuccinate synthase;       
    6::393     e-116  52%  400 aa  ASSY_TRIEI RecName: Full=Argininosuccinate synthase;       
    5::399     e-116  52%  400 aa  ASSY_ANAVT RecName: Full=Argininosuccinate synthase;       
    5::399     e-116  53%  400 aa  ASSY_ANASP RecName: Full=Argininosuccinate synthase;       
    4::391     e-116  54%  404 aa  ASSY_LISMH RecName: Full=Argininosuccinate synthase;       
    4::391     e-116  54%  404 aa  ASSY_LISMF RecName: Full=Argininosuccinate synthase;       
    4::391     e-116  54%  404 aa  ASSY_LISMC RecName: Full=Argininosuccinate synthase;       
    4::390     e-116  54%  401 aa  ASSY_BACCZ RecName: Full=Argininosuccinate synthase;       
    4::390     e-116  54%  401 aa  ASSY_BACC3 RecName: Full=Argininosuccinate synthase;       
    4::390     e-116  54%  401 aa  ASSY_BACAH RecName: Full=Argininosuccinate synthase;       
    4::393     e-116  54%  409 aa  ASSY_BACHD RecName: Full=Argininosuccinate synthase;       
    4::390     e-115  54%  401 aa  ASSY_BACAN RecName: Full=Argininosuccinate synthase;       
    4::390     e-115  54%  401 aa  ASSY_BACAC RecName: Full=Argininosuccinate synthase;       
    4::390     e-115  54%  401 aa  ASSY_BACAA RecName: Full=Argininosuccinate synthase;       
    5::390     e-115  54%  402 aa  ASSY_ANOFW RecName: Full=Argininosuccinate synthase;       
    4::390     e-115  54%  401 aa  ASSY_BACCR RecName: Full=Argininosuccinate synthase;       
    4::390     e-115  54%  401 aa  ASSY_BACC4 RecName: Full=Argininosuccinate synthase;       
    4::390     e-115  54%  401 aa  ASSY_BACC1 RecName: Full=Argininosuccinate synthase;       
    4::390     e-115  54%  401 aa  ASSY_BACHK RecName: Full=Argininosuccinate synthase;       
    4::390     e-115  54%  401 aa  ASSY_BACC0 RecName: Full=Argininosuccinate synthase;       
    4::390     e-115  54%  401 aa  ASSY_BACCQ RecName: Full=Argininosuccinate synthase;       
    4::390     e-115  54%  401 aa  ASSY_BACWK RecName: Full=Argininosuccinate synthase;       
    4::390     e-115  54%  401 aa  ASSY_BACC7 RecName: Full=Argininosuccinate synthase;       
    4::390     e-115  54%  404 aa  ASSY_LISMO RecName: Full=Argininosuccinate synthase;       
    5::393     e-115  52%  401 aa  ASSY_MICAN RecName: Full=Argininosuccinate synthase;       
    4::390     e-115  54%  401 aa  ASSY_BACC2 RecName: Full=Argininosuccinate synthase;       
    5::393     e-115  54%  401 aa  ASSY_THEEB RecName: Full=Argininosuccinate synthase;       
    4::391     e-115  53%  404 aa  ASSY_LISW6 RecName: Full=Argininosuccinate synthase;       
    4::391     e-114  51%  417 aa  ASSY_OCEIH RecName: Full=Argininosuccinate synthase;       
    5::389     e-114  53%  399 aa  ASSY_STRU0 RecName: Full=Argininosuccinate synthase;       
    4::389     e-114  54%  397 aa  ASSY_STRSY RecName: Full=Argininosuccinate synthase;       
    4::389     e-114  54%  397 aa  ASSY_STRS2 RecName: Full=Argininosuccinate synthase;       
    5::393     e-114  52%  400 aa  ASSY_NOSP7 RecName: Full=Argininosuccinate synthase;       
    5::397     e-114  53%  406 aa  ASSY_GEOKA RecName: Full=Argininosuccinate synthase;       
    4::393     e-114  54%  403 aa  ASSY_BACSK RecName: Full=Argininosuccinate synthase;       
    5::397     e-113  53%  406 aa  ASSY_GEOTN RecName: Full=Argininosuccinate synthase;       
    4::389     e-113  54%  399 aa  ASSY_STRGC RecName: Full=Argininosuccinate synthase;       
    4::389     e-113  54%  399 aa  ASSY_STRSV RecName: Full=Argininosuccinate synthase;       
    4::391     e-113  53%  404 aa  ASSY_LISIN RecName: Full=Argininosuccinate synthase;       
    4::390     e-113  52%  410 aa  ASSY_LACRJ RecName: Full=Argininosuccinate synthase;       
    4::390     e-113  52%  410 aa  ASSY_LACRD RecName: Full=Argininosuccinate synthase;       
    5::403     e-113  52%  403 aa  ASSY_SYNSC RecName: Full=Argininosuccinate synthase;       
    5::399     e-112  51%  401 aa  ASSY_CYAP4 RecName: Full=Argininosuccinate synthase;       
    4::389     e-112  52%  399 aa  ASSY_STRTD RecName: Full=Argininosuccinate synthase;       
    4::389     e-112  52%  399 aa  ASSY_STRT2 RecName: Full=Argininosuccinate synthase;       
    4::389     e-112  52%  399 aa  ASSY_STRT1 RecName: Full=Argininosuccinate synthase;       
    1::390     e-112  50%  406 aa  ASSY_DEHE1 RecName: Full=Argininosuccinate synthase;       
    1::390     e-112  50%  406 aa  ASSY_DEHSC RecName: Full=Argininosuccinate synthase;       
    1::390     e-112  50%  406 aa  ASSY_DEHSB RecName: Full=Argininosuccinate synthase;       
    4::389     e-112  52%  396 aa  ASSY_STRMU RecName: Full=Argininosuccinate synthase;       
    5::391     e-112  52%  403 aa  ASSY_BACA2 RecName: Full=Argininosuccinate synthase;       
    5::390     e-112  53%  402 aa  ASSY_GEOSW RecName: Full=Argininosuccinate synthase;       
    5::394     e-111  52%  403 aa  ASSY_SYNS9 RecName: Full=Argininosuccinate synthase;       
    5::392     e-111  52%  403 aa  ASSY_SYNJA RecName: Full=Argininosuccinate synthase;       
    5::393     e-111  52%  400 aa  ASSY_SYNY3 RecName: Full=Argininosuccinate synthase;       
    6::401     e-111  51%  401 aa  ASSY_SYNS3 RecName: Full=Argininosuccinate synthase;       
    5::393     e-111  51%  399 aa  ASSY_SYNP2 RecName: Full=Argininosuccinate synthase;       
    5::393     e-110  51%  400 aa  ASSY_SYNJB RecName: Full=Argininosuccinate synthase;       
    4::389     e-110  52%  398 aa  ASSY_STRR6 RecName: Full=Argininosuccinate synthase;       
    4::389     e-110  52%  398 aa  ASSY_STRP2 RecName: Full=Argininosuccinate synthase;       
    6::389     e-110  51%  411 aa  ASSY_LACPL RecName: Full=Argininosuccinate synthase;       
    4::389     e-110  52%  398 aa  ASSY_STRPI RecName: Full=Argininosuccinate synthase;       
    5::398     e-110  52%  403 aa  ASSY_BACP2 RecName: Full=Argininosuccinate synthase;       
    5::394     e-109  52%  401 aa  ASSY_PROM3 RecName: Full=Argininosuccinate synthase;       
    5::393     e-109  51%  399 aa  ASSY_CYAP8 RecName: Full=Argininosuccinate synthase;       
    1::392     e-109  50%  401 aa  ASSY_STAS1 RecName: Full=Argininosuccinate synthase;       
    5::394     e-109  52%  401 aa  ASSY_PROMM RecName: Full=Argininosuccinate synthase;       
    5::399     e-109  51%  400 aa  ASSY_SYNP6 RecName: Full=Argininosuccinate synthase;       
    5::399     e-109  51%  400 aa  ASSY_SYNE7 RecName: Full=Argininosuccinate synthase;       
    4::384     e-109  51%  397 aa  ASSY_DICT6 RecName: Full=Argininosuccinate synthase;       
    6::400     e-109  50%  405 aa  ASSY_SYNR3 RecName: Full=Argininosuccinate synthase;       
    1::387     e-109  51%  410 aa  ASSY_LEUCK RecName: Full=Argininosuccinate synthase;       
    5::394     e-108  51%  404 aa  ASSY_PROM0 RecName: Full=Argininosuccinate synthase;       
    5::394     e-108  51%  404 aa  ASSY_PROMP RecName: Full=Argininosuccinate synthase;       
    5::394     e-108  51%  404 aa  ASSY_PROM5 RecName: Full=Argininosuccinate synthase;       
    4::390     e-108  52%  401 aa  ASSY_BACCN RecName: Full=Argininosuccinate synthase;       
    4::393     e-107  52%  400 aa  ASSY_PROM4 RecName: Full=Argininosuccinate synthase;       
    4::382     e-107  51%  401 aa  ASSY_EXIS2 RecName: Full=Argininosuccinate synthase;       
    5::401     e-107  50%  401 aa  ASSY_SYNPW RecName: Full=Argininosuccinate synthase;       
    4::389     e-107  50%  396 aa  ASSY_STRA5 RecName: Full=Argininosuccinate synthase;       
    3::395     e-107  50%  396 aa  ASSY_IGNH4 RecName: Full=Argininosuccinate synthase;       
    6::394     e-107  51%  403 aa  ASSY_SYNPX RecName: Full=Argininosuccinate synthase;       
    4::389     e-107  50%  396 aa  ASSY_STRA3 RecName: Full=Argininosuccinate synthase;       
    4::389     e-107  50%  396 aa  ASSY_STRA1 RecName: Full=Argininosuccinate synthase;       
    1::389     e-107  49%  401 aa  ASSY_STAES RecName: Full=Argininosuccinate synthase;       
    1::389     e-107  49%  401 aa  ASSY_STAEQ RecName: Full=Argininosuccinate synthase;       
    5::393     e-106  51%  400 aa  ASSY_CYAA5 RecName: Full=Argininosuccinate synthase;       
    1::392     e-106  49%  401 aa  ASSY_STAAW RecName: Full=Argininosuccinate synthase;       
    1::392     e-106  49%  401 aa  ASSY_STAAS RecName: Full=Argininosuccinate synthase;       
    1::391     e-106  49%  406 aa  ASSY_LACC3 RecName: Full=Argininosuccinate synthase;       
    5::394     e-106  50%  404 aa  ASSY_PROMS RecName: Full=Argininosuccinate synthase;       
    5::394     e-106  50%  402 aa  ASSY_PROMA RecName: Full=Argininosuccinate synthase;       
    5::394     e-106  50%  404 aa  ASSY_PROM2 RecName: Full=Argininosuccinate synthase;       
    1::392     e-106  49%  401 aa  ASSY_STAAT RecName: Full=Argininosuccinate synthase;       
    1::392     e-106  49%  401 aa  ASSY_STAAN RecName: Full=Argininosuccinate synthase;       
    1::392     e-106  49%  401 aa  ASSY_STAAM RecName: Full=Argininosuccinate synthase;       
    1::392     e-106  49%  401 aa  ASSY_STAAE RecName: Full=Argininosuccinate synthase;       
    1::392     e-106  49%  401 aa  ASSY_STAAC RecName: Full=Argininosuccinate synthase;       
    1::392     e-106  49%  401 aa  ASSY_STAA9 RecName: Full=Argininosuccinate synthase;       
    1::392     e-106  49%  401 aa  ASSY_STAA8 RecName: Full=Argininosuccinate synthase;       
    1::392     e-106  49%  401 aa  ASSY_STAA3 RecName: Full=Argininosuccinate synthase;       
    1::392     e-106  49%  401 aa  ASSY_STAA2 RecName: Full=Argininosuccinate synthase;       
    1::392     e-106  49%  401 aa  ASSY_STAA1 RecName: Full=Argininosuccinate synthase;       
    6::394     e-106  51%  404 aa  ASSY_PROM9 RecName: Full=Argininosuccinate synthase;       
    1::389     e-105  49%  400 aa  ASSY_STAHJ RecName: Full=Argininosuccinate synthase;       
    4::390     e-105  50%  397 aa  ASSY_LACLM RecName: Full=Argininosuccinate synthase;       
    1::392     e-105  48%  401 aa  ASSY_STAAB RecName: Full=Argininosuccinate synthase;       
    1::392     e-105  48%  401 aa  ASSY_STAAR RecName: Full=Argininosuccinate synthase;       
    4::390     e-105  50%  397 aa  ASSY_LACLS RecName: Full=Argininosuccinate synthase;       
    5::391     e-104  49%  398 aa  ASSY_LACLA RecName: Full=Argininosuccinate synthase;       
    5::394     e-104  49%  400 aa  ASSY_PROM1 RecName: Full=Argininosuccinate synthase;       
    6::394     e-104  49%  400 aa  ASSY_PROMT RecName: Full=Argininosuccinate synthase;       
    1::392     e-104  49%  401 aa  ASSY_STACT RecName: Full=Argininosuccinate synthase;       
    1::391     e-104  48%  406 aa  ASSY_OENOB RecName: Full=Argininosuccinate synthase;       
    1::387     e-104  50%  408 aa  ASSY_LEUMM RecName: Full=Argininosuccinate synthase;       
    4::384     e-103  49%  397 aa  ASSY_DICTD RecName: Full=Argininosuccinate synthase;       
    4::391     e-103  49%  400 aa  ASSY_CHLPD RecName: Full=Argininosuccinate synthase;       
    2::386     e-102  50%  410 aa  ASSY_PYRFU RecName: Full=Argininosuccinate synthase;       
    5::393     e-102  49%  410 aa  ASSY_THETN RecName: Full=Argininosuccinate synthase;       
    4::392     e-102  50%  401 aa  ASSY_SYMTH RecName: Full=Argininosuccinate synthase;       
    7::404     e-101  47%  408 aa  ASSY_MOOTA RecName: Full=Argininosuccinate synthase;       
    4::391     e-101  47%  400 aa  ASSY_PROVI RecName: Full=Argininosuccinate synthase;       
    4::391     e-101  48%  402 aa  ASSY_CHLPB RecName: Full=Argininosuccinate synthase;       
    5::393     e-101  48%  410 aa  ASSY_THEPX RecName: Full=Argininosuccinate synthase;       
    1::397     e-100  47%  401 aa  ASSY_CARHZ RecName: Full=Argininosuccinate synthase;       
    4::391     e-100  47%  400 aa  ASSY_PELPB RecName: Full=Argininosuccinate synthase;       
    5::393     1e-99  48%  410 aa  ASSY_THEP3 RecName: Full=Argininosuccinate synthase;       
    1::397     1e-99  47%  401 aa  ASSY_CLOK5 RecName: Full=Argininosuccinate synthase;       
    1::397     1e-99  47%  401 aa  ASSY_CLOK1 RecName: Full=Argininosuccinate synthase;       
    4::391     2e-99  48%  401 aa  ASSY_PROA2 RecName: Full=Argininosuccinate synthase;       
    4::391     4e-99  47%  400 aa  ASSY_CHLL2 RecName: Full=Argininosuccinate synthase;       
    4::393     3e-98  48%  401 aa  ASSY_AQUAE RecName: Full=Argininosuccinate synthase;       
    4::391     1e-97  46%  400 aa  ASSY_PELLD RecName: Full=Argininosuccinate synthase;       
    3::397     2e-97  47%  401 aa  ASSY_PELTS RecName: Full=Argininosuccinate synthase;       
   10::405     7e-97  44%  409 aa  ASSY_DESHY RecName: Full=Argininosuccinate synthase;       
    2::397     7e-97  44%  401 aa  ASSY_DESHD RecName: Full=Argininosuccinate synthase;       
   17::408     9e-97  43%  413 aa  ASSY_UNCTG RecName: Full=Argininosuccinate synthase;       
    4::392     9e-97  47%  401 aa  ASSY_CHLP8 RecName: Full=Argininosuccinate synthase;       
    4::398     1e-96  44%  398 aa  ASSY_CLOTE RecName: Full=Argininosuccinate synthase;       
    4::392     1e-96  48%  401 aa  ASSY_CHLTE RecName: Full=Argininosuccinate synthase;       
    4::394     3e-96  45%  399 aa  ASSY_CHLCH RecName: Full=Argininosuccinate synthase;       
    7::404     1e-94  44%  408 aa  ASSY_HELMO RecName: Full=Argininosuccinate synthase;       
    5::395     2e-93  47%  397 aa  ASSY_PYRAE RecName: Full=Argininosuccinate synthase;       
    7::395     2e-93  45%  414 aa  ASSY_ALKMQ RecName: Full=Argininosuccinate synthase;       
    1::394     2e-93  45%  402 aa  ASSY_CLONN RecName: Full=Argininosuccinate synthase;       
    7::402     2e-92  44%  407 aa  ASSY_ROSS1 RecName: Full=Argininosuccinate synthase;       
    6::400     2e-92  44%  400 aa  ASSY_DESAA RecName: Full=Argininosuccinate synthase;       
    1::395     5e-92  44%  400 aa  ASSY_CLOAB RecName: Full=Argininosuccinate synthase;       
    6::400     1e-91  45%  401 aa  ASSY_SYNAS RecName: Full=Argininosuccinate synthase;       
    8::395     1e-91  45%  403 aa  ASSY_LEPIN RecName: Full=Argininosuccinate synthase;       
    8::395     1e-91  45%  403 aa  ASSY_LEPIC RecName: Full=Argininosuccinate synthase;       
    8::395     2e-91  44%  403 aa  ASSY_LEPBL RecName: Full=Argininosuccinate synthase;       
    8::395     2e-91  44%  403 aa  ASSY_LEPBJ RecName: Full=Argininosuccinate synthase;       
    5::394     1e-90  44%  405 aa  ASSY_CLOTH RecName: Full=Argininosuccinate synthase;       
    3::397     4e-90  44%  401 aa  ASSY_DESRM RecName: Full=Argininosuccinate synthase;       
    8::408     5e-90  44%  409 aa  ASSY_SACD2 RecName: Full=Argininosuccinate synthase;       
    7::402     6e-90  42%  402 aa  ASSY_ROSCS RecName: Full=Argininosuccinate synthase;       
    5::404     6e-90  43%  405 aa  ASSY_PSEMY RecName: Full=Argininosuccinate synthase;       
    1::390     6e-90  43%  397 aa  ASSY_METMP RecName: Full=Argininosuccinate synthase;       
   97::489     8e-90  43%  494 aa  ASSY_ARATH RecName: Full=Argininosuccinate synthase, chloroplastic;
    5::404     1e-89  44%  406 aa  ASSY_CHRSD RecName: Full=Argininosuccinate synthase;       
    5::405     2e-89  43%  405 aa  ASSY_PSEAE RecName: Full=Argininosuccinate synthase;       
    5::405     2e-89  43%  405 aa  ASSY_PSEAB RecName: Full=Argininosuccinate synthase;       
    5::405     2e-89  43%  405 aa  ASSY_PSEA8 RecName: Full=Argininosuccinate synthase;       
    5::405     2e-89  43%  405 aa  ASSY_PSEA7 RecName: Full=Argininosuccinate synthase;       
    5::400     2e-89  44%  405 aa  ASSY_CALS8 RecName: Full=Argininosuccinate synthase;       
    6::407     2e-89  44%  407 aa  ASSY_ALCBS RecName: Full=Argininosuccinate synthase;       
    5::400     5e-89  43%  403 aa  ASSY_ANATD RecName: Full=Argininosuccinate synthase;       
    6::403     7e-89  43%  404 aa  ASSY_HAHCH RecName: Full=Argininosuccinate synthase;       
    4::392     9e-89  43%  398 aa  ASSY_DESPS RecName: Full=Argininosuccinate synthase;       
    5::402     1e-88  42%  405 aa  ASSY_PSEU5 RecName: Full=Argininosuccinate synthase;       
    7::390     2e-88  44%  404 aa  ASSY_WOLSU RecName: Full=Argininosuccinate synthase;       
    6::404     2e-88  43%  405 aa  ASSY_PSEF5 RecName: Full=Argininosuccinate synthase;       
    7::397     2e-88  43%  412 aa  ASSY_PSEA6 RecName: Full=Argininosuccinate synthase;       
    1::396     2e-88  42%  397 aa  ASSY_CLOBL RecName: Full=Argininosuccinate synthase;       
    5::403     6e-88  42%  410 aa  ASSY_MARMS RecName: Full=Argininosuccinate synthase;       
    5::403     6e-88  42%  403 aa  ASSY_MARAV RecName: Full=Argininosuccinate synthase;       
    1::396     6e-88  41%  397 aa  ASSY_CLOBM RecName: Full=Argininosuccinate synthase;       
    1::396     6e-88  41%  397 aa  ASSY_CLOBK RecName: Full=Argininosuccinate synthase;       
    1::396     6e-88  41%  397 aa  ASSY_CLOBH RecName: Full=Argininosuccinate synthase;       
    1::396     6e-88  41%  397 aa  ASSY_CLOB6 RecName: Full=Argininosuccinate synthase;       
    1::396     6e-88  41%  397 aa  ASSY_CLOB1 RecName: Full=Argininosuccinate synthase;       
    6::404     7e-88  43%  405 aa  ASSY_PSEFS RecName: Full=Argininosuccinate synthase;       
    1::396     1e-87  41%  397 aa  ASSY_CLOBJ RecName: Full=Argininosuccinate synthase;       
    1::397     2e-87  42%  408 aa  ASSY_EUBE2 RecName: Full=Argininosuccinate synthase;       
    5::402     2e-87  43%  406 aa  ASSY_AZOVD RecName: Full=Argininosuccinate synthase;       
    5::388     3e-87  45%  403 aa  ASSY_HALHL RecName: Full=Argininosuccinate synthase;       
    6::404     5e-87  43%  405 aa  ASSY_PSEPF RecName: Full=Argininosuccinate synthase;       
    7::390     6e-87  44%  399 aa  ASSY_METTH RecName: Full=Argininosuccinate synthase;       
    7::403     6e-87  43%  408 aa  ASSY_METCA RecName: Full=Argininosuccinate synthase;       
    8::395     6e-87  44%  402 aa  ASSY_LEPBP RecName: Full=Argininosuccinate synthase;       
    8::395     6e-87  44%  402 aa  ASSY_LEPBA RecName: Full=Argininosuccinate synthase;       
    8::404     1e-86  42%  406 aa  ASSY_PELCD RecName: Full=Argininosuccinate synthase;       
    1::390     1e-86  42%  397 aa  ASSY_METVA RecName: Full=Argininosuccinate synthase;       
    2::382     1e-86  44%  400 aa  ASSY_THET2 RecName: Full=Argininosuccinate synthase;       
    4::395     1e-86  43%  401 aa  ASSY_SYNFM RecName: Full=Argininosuccinate synthase;       
    7::390     2e-86  44%  405 aa  ASSY_NITSB RecName: Full=Argininosuccinate synthase;       
    2::380     3e-86  43%  390 aa  ASSY_SULTO RecName: Full=Argininosuccinate synthase;       
    5::404     4e-86  42%  405 aa  ASSY_PSEPK RecName: Full=Argininosuccinate synthase;       
    5::404     4e-86  42%  405 aa  ASSY_PSEP1 RecName: Full=Argininosuccinate synthase;       
    5::404     4e-86  42%  405 aa  ASSY_PSEE4 RecName: Full=Argininosuccinate synthase;       
    6::394     4e-86  44%  405 aa  ASSY_LEGPH RecName: Full=Argininosuccinate synthase;       
    5::404     5e-86  42%  405 aa  ASSY_PSEPW RecName: Full=Argininosuccinate synthase;       
    6::394     5e-86  44%  405 aa  ASSY_LEGPC RecName: Full=Argininosuccinate synthase;       
    6::394     5e-86  44%  405 aa  ASSY_LEGPA RecName: Full=Argininosuccinate synthase;       
    4::392     5e-86  42%  402 aa  ASSY_DEIRA RecName: Full=Argininosuccinate synthase;       
    8::390     7e-86  45%  407 aa  ASSY_RHILO RecName: Full=Argininosuccinate synthase;       
   11::405     7e-86  40%  416 aa  ASSY_AERS4 RecName: Full=Argininosuccinate synthase;       
    7::407     1e-85  43%  407 aa  ASSY_NITMU RecName: Full=Argininosuccinate synthase;       
    5::401     1e-85  44%  402 aa  ASSY_ALHEH RecName: Full=Argininosuccinate synthase;       
    2::385     2e-85  43%  391 aa  ASSY_SULSO RecName: Full=Argininosuccinate synthase;       
    1::390     2e-85  42%  405 aa  ASSY_ACIBL RecName: Full=Argininosuccinate synthase;       
    8::389     3e-85  44%  410 aa  ASSY_MARMM RecName: Full=Argininosuccinate synthase;       
    6::400     3e-85  44%  407 aa  ASSY_MAGSM RecName: Full=Argininosuccinate synthase;       
    9::403     4e-85  40%  403 aa  ASSY_VIBFM RecName: Full=Argininosuccinate synthase;       
    5::404     4e-85  42%  405 aa  ASSY_PSEPG RecName: Full=Argininosuccinate synthase;       
    7::400     4e-85  42%  406 aa  ASSY_GEOSF RecName: Full=Argininosuccinate synthase;       
    6::400     4e-85  41%  411 aa  ASSY_AERHH RecName: Full=Argininosuccinate synthase;       
    2::382     6e-85  44%  400 aa  ASSY_THET8 RecName: Full=Argininosuccinate synthase;       
    2::385     6e-85  42%  391 aa  ASSY_SULAC RecName: Full=Argininosuccinate synthase;       
   13::403     6e-85  41%  403 aa  ASSY_ALISL RecName: Full=Argininosuccinate synthase;       
    7::412     8e-85  43%  413 aa  ASSY_ARCB4 RecName: Full=Argininosuccinate synthase;       
    7::399     1e-84  42%  406 aa  ASSY_GEOUR RecName: Full=Argininosuccinate synthase;       
    1::398     1e-84  42%  408 aa  ASSY_EUBR3 RecName: Full=Argininosuccinate synthase;       
    5::385     1e-84  44%  396 aa  ASSY_DESVH RecName: Full=Argininosuccinate synthase;       
    9::403     2e-84  40%  403 aa  ASSY_VIBF1 RecName: Full=Argininosuccinate synthase;       
    5::387     2e-84  43%  402 aa  ASSY_THICR RecName: Full=Argininosuccinate synthase;       
    5::385     2e-84  44%  396 aa  ASSY_DESVV RecName: Full=Argininosuccinate synthase;       
    6::405     2e-84  43%  407 aa  ASSY_CAMC1 RecName: Full=Argininosuccinate synthase;       
    9::401     2e-84  42%  406 aa  ASSY_GEOSL RecName: Full=Argininosuccinate synthase;       
    1::396     2e-84  42%  399 aa  ASSY_CLOD6 RecName: Full=Argininosuccinate synthase;       
   11::411     4e-84  42%  411 aa  ASSY_PSYWF RecName: Full=Argininosuccinate synthase;       
    6::394     4e-84  44%  405 aa  ASSY_LEGPL RecName: Full=Argininosuccinate synthase;       
    6::391     4e-84  44%  400 aa  ASSY_DESDG RecName: Full=Argininosuccinate synthase;       
   10::398     4e-84  43%  414 aa  ASSY_DEIGD RecName: Full=Argininosuccinate synthase;       
    2::380     6e-84  42%  391 aa  ASSY_METS5 RecName: Full=Argininosuccinate synthase;       
    8::390     6e-84  44%  408 aa  ASSY_MESSB RecName: Full=Argininosuccinate synthase;       
    8::403     8e-84  40%  404 aa  ASSY_VIBHB RecName: Full=Argininosuccinate synthase;       
    5::398     8e-84  43%  404 aa  ASSY_NITEC RecName: Full=Argininosuccinate synthase;       
    1::387     8e-84  43%  395 aa  ASSY_METBF RecName: Full=Argininosuccinate synthase;       
    6::395     1e-83  43%  395 aa  ASSY_METHJ RecName: Full=Argininosuccinate synthase;       
    9::391     1e-83  44%  410 aa  ASSY_PARL1 RecName: Full=Argininosuccinate synthase;       
    9::398     1e-83  42%  406 aa  ASSY_GEOMG RecName: Full=Argininosuccinate synthase;       
    8::403     2e-83  40%  404 aa  ASSY_VIBPA RecName: Full=Argininosuccinate synthase;       
    1::399     2e-83  45%  409 aa  ASSY_THENN RecName: Full=Argininosuccinate synthase;       
    6::386     2e-83  44%  401 aa  ASSY_DESVM RecName: Full=Argininosuccinate synthase;       
    6::404     2e-83  41%  405 aa  ASSY_PSE14 RecName: Full=Argininosuccinate synthase;       
    2::383     2e-83  46%  396 aa  ASSY_HYPBU RecName: Full=Argininosuccinate synthase;       
    7::399     2e-83  41%  406 aa  ASSY_GEOSM RecName: Full=Argininosuccinate synthase;       
    7::399     2e-83  41%  406 aa  ASSY_GEOBB RecName: Full=Argininosuccinate synthase;       
    6::403     2e-83  41%  403 aa  ASSY_CLOP1 RecName: Full=Argininosuccinate synthase;       
    6::404     3e-83  41%  405 aa  ASSY_PSEU2 RecName: Full=Argininosuccinate synthase;       
    4::392     3e-83  42%  408 aa  ASSY_DEIDV RecName: Full=Argininosuccinate synthase;       
    8::403     4e-83  40%  403 aa  ASSY_VIBVY RecName: Full=Argininosuccinate synthase;       
    8::403     4e-83  40%  403 aa  ASSY_VIBVU RecName: Full=Argininosuccinate synthase;       
    6::401     4e-83  43%  404 aa  ASSY_MAGSA RecName: Full=Argininosuccinate synthase;       
    6::394     4e-83  41%  407 aa  ASSY_CLOBB RecName: Full=Argininosuccinate synthase;       
    7::396     5e-83  41%  404 aa  ASSY_VIBCM RecName: Full=Argininosuccinate synthase;       
    7::396     5e-83  41%  404 aa  ASSY_VIBCH RecName: Full=Argininosuccinate synthase;       
    7::396     5e-83  41%  404 aa  ASSY_VIBC3 RecName: Full=Argininosuccinate synthase;       
    1::386     5e-83  42%  394 aa  ASSY_METBU RecName: Full=Argininosuccinate synthase;       
   11::411     7e-83  42%  412 aa  ASSY_PSYCK RecName: Full=Argininosuccinate synthase;       
    5::406     7e-83  42%  410 aa  ASSY_POLSQ RecName: Full=Argininosuccinate synthase;       
    6::407     7e-83  42%  409 aa  ASSY_NITHX RecName: Full=Argininosuccinate synthase;       
   11::411     9e-83  42%  412 aa  ASSY_PSYA2 RecName: Full=Argininosuccinate synthase;       
    6::404     9e-83  41%  405 aa  ASSY_PSESM RecName: Full=Argininosuccinate synthase;       
   14::400     9e-83  44%  416 aa  ASSY_GRABC RecName: Full=Argininosuccinate synthase;       
    8::405     9e-83  41%  405 aa  ASSY_CLOPE RecName: Full=Argininosuccinate synthase;       
    5::407     9e-83  43%  408 aa  ASSY_BURXL RecName: Full=Argininosuccinate synthase;       
    9::395     1e-82  46%  416 aa  ASSY_METSB RecName: Full=Argininosuccinate synthase;       
    7::405     1e-82  42%  409 aa  ASSY_GLUDA RecName: Full=Argininosuccinate synthase;       
    6::406     1e-82  41%  406 aa  ASSY_CAMHC RecName: Full=Argininosuccinate synthase;       
    1::392     1e-82  41%  406 aa  ASSY_BRAHW RecName: Full=Argininosuccinate synthase;       
    6::407     2e-82  42%  409 aa  ASSY_NITWN RecName: Full=Argininosuccinate synthase;       
    6::401     2e-82  41%  407 aa  ASSY_CLOB8 RecName: Full=Argininosuccinate synthase;       
    7::406     2e-82  42%  407 aa  ASSY_CAMFF RecName: Full=Argininosuccinate synthase;       
    6::394     2e-82  41%  407 aa  ASSY_CLOBA RecName: Full=Argininosuccinate synthase;       
    9::388     3e-82  42%  408 aa  ASSY_PELPD RecName: Full=Argininosuccinate synthase;       
    6::406     3e-82  42%  408 aa  ASSY_PARDP RecName: Full=Argininosuccinate synthase;       
    7::391     3e-82  44%  409 aa  ASSY_ACICJ RecName: Full=Argininosuccinate synthase;       
    5::401     4e-82  42%  405 aa  ASSY_NITOC RecName: Full=Argininosuccinate synthase;       
    1::399     5e-82  44%  409 aa  ASSY_THESQ RecName: Full=Argininosuccinate synthase;       
    8::392     5e-82  42%  410 aa  ASSY_GLUOX RecName: Full=Argininosuccinate synthase;       
    5::398     6e-82  42%  404 aa  ASSY_NITEU RecName: Full=Argininosuccinate synthase;       
    1::399     8e-82  44%  409 aa  ASSY_THEMA RecName: Full=Argininosuccinate synthase;       
    6::405     8e-82  43%  406 aa  ASSY_RHOCS RecName: Full=Argininosuccinate synthase;       
    5::407     8e-82  42%  408 aa  ASSY_BURPP RecName: Full=Argininosuccinate synthase;       
    5::407     1e-81  42%  409 aa  ASSY_THIDA RecName: Full=Argininosuccinate synthase;       
    8::404     1e-81  42%  407 aa  ASSY_RHIEC RecName: Full=Argininosuccinate synthase;       
    5::405     1e-81  43%  407 aa  ASSY_JANSC RecName: Full=Argininosuccinate synthase;       
    5::402     1e-81  41%  404 aa  ASSY_HELHP RecName: Full=Argininosuccinate synthase;       
    6::405     1e-81  42%  406 aa  ASSY_CAMC5 RecName: Full=Argininosuccinate synthase;       
    7::390     2e-81  42%  403 aa  ASSY_RUTMC RecName: Full=Argininosuccinate synthase;       
    1::387     2e-81  43%  394 aa  ASSY_METAC RecName: Full=Argininosuccinate synthase;       
    5::404     2e-81  44%  404 aa  ASSY_ERYLH RecName: Full=Argininosuccinate synthase;       
    1::399     2e-81  44%  409 aa  ASSY_THEP1 RecName: Full=Argininosuccinate synthase;       
    5::389     2e-81  44%  407 aa  ASSY_SILST RecName: Full=Argininosuccinate synthase;       
    5::387     3e-81  43%  406 aa  ASSY_DINSH RecName: Full=Argininosuccinate synthase;       
    6::405     3e-81  41%  406 aa  ASSY_CAMJR RecName: Full=Argininosuccinate synthase;       
    6::408     4e-81  42%  409 aa  ASSY_XANP2 RecName: Full=Argininosuccinate synthase;       
    8::389     4e-81  42%  447 aa  ASSY_SULNB RecName: Full=Argininosuccinate synthase;       
    6::390     4e-81  42%  404 aa  ASSY_SULDN RecName: Full=Argininosuccinate synthase;       
    5::401     4e-81  38%  403 aa  ASSY_IDILO RecName: Full=Argininosuccinate synthase;       
    6::405     4e-81  41%  406 aa  ASSY_CAMJE RecName: Full=Argininosuccinate synthase;       
    6::405     4e-81  41%  406 aa  ASSY_CAMJD RecName: Full=Argininosuccinate synthase;       
    8::392     4e-81  43%  407 aa  ASSY_AGRT5 RecName: Full=Argininosuccinate synthase;       
    6::406     5e-81  42%  408 aa  ASSY_ZYMMO RecName: Full=Argininosuccinate synthase;       
    7::402     5e-81  39%  405 aa  ASSY_ENTS8 RecName: Full=Argininosuccinate synthase;       
    6::405     5e-81  41%  406 aa  ASSY_CAMJJ RecName: Full=Argininosuccinate synthase;       
    8::392     5e-81  42%  407 aa  ASSY2_RHIL3 RecName: Full=Argininosuccinate synthase 2;       
    7::400     7e-81  41%  404 aa  ASSY_RHORT RecName: Full=Argininosuccinate synthase;       
    3::387     7e-81  42%  395 aa  ASSY_RHOFA RecName: Full=Argininosuccinate synthase;       
    6::405     7e-81  41%  406 aa  ASSY_CAMJ8 RecName: Full=Argininosuccinate synthase;       
    9::410     9e-81  40%  418 aa  ASSY_COLP3 RecName: Full=Argininosuccinate synthase;       
    8::392     1e-80  41%  403 aa  ASSY_VESOH RecName: Full=Argininosuccinate synthase;       
    5::406     1e-80  42%  410 aa  ASSY_POLNS RecName: Full=Argininosuccinate synthase;       
    8::392     1e-80  43%  406 aa  ASSY_OCHA4 RecName: Full=Argininosuccinate synthase;       
    5::406     2e-80  42%  408 aa  ASSY_RHOSK RecName: Full=Argininosuccinate synthase;       
    5::406     2e-80  42%  408 aa  ASSY_RHOS4 RecName: Full=Argininosuccinate synthase;       
    5::406     2e-80  42%  408 aa  ASSY_RHOS1 RecName: Full=Argininosuccinate synthase;       
    8::390     2e-80  43%  405 aa  ASSY_RHIME RecName: Full=Argininosuccinate synthase;       
    8::393     2e-80  44%  420 aa  ASSY_HALMA RecName: Full=Argininosuccinate synthase;       
    5::395     3e-80  41%  404 aa  ASSY_RHOBA RecName: Full=Argininosuccinate synthase;       
    2::394     4e-80  41%  395 aa  ASSY_METJA RecName: Full=Argininosuccinate synthase;       
    8::392     4e-80  42%  406 aa  ASSY_BRUSI RecName: Full=Argininosuccinate synthase;       
    8::392     4e-80  42%  406 aa  ASSY_BRUO2 RecName: Full=Argininosuccinate synthase;       
    8::392     4e-80  42%  406 aa  ASSY_BRUME RecName: Full=Argininosuccinate synthase;       
    8::392     4e-80  42%  406 aa  ASSY_BRUMB RecName: Full=Argininosuccinate synthase;       
    8::392     4e-80  42%  406 aa  ASSY_BRUC2 RecName: Full=Argininosuccinate synthase;       
    8::392     4e-80  42%  406 aa  ASSY_BRUAB RecName: Full=Argininosuccinate synthase;       
    8::392     4e-80  42%  406 aa  ASSY_BRUA2 RecName: Full=Argininosuccinate synthase;       
    8::392     4e-80  42%  406 aa  ASSY_BRUA1 RecName: Full=Argininosuccinate synthase;       
    5::406     6e-80  42%  408 aa  ASSY_RHOS5 RecName: Full=Argininosuccinate synthase;       
    6::401     6e-80  40%  404 aa  ASSY_PHOPR RecName: Full=Argininosuccinate synthase;       
    6::388     6e-80  43%  406 aa  ASSY_METFK RecName: Full=Argininosuccinate synthase;       
    1::399     7e-80  39%  407 aa  ASSY_CLOPH RecName: Full=Argininosuccinate synthase;       
    8::390     1e-79  43%  405 aa  ASSY_SINMW RecName: Full=Argininosuccinate synthase;       
    5::387     1e-79  43%  406 aa  ASSY_ROSDO RecName: Full=Argininosuccinate synthase;       
    1::388     1e-79  42%  396 aa  ASSY_METBA RecName: Full=Argininosuccinate synthase;       
    8::392     1e-79  42%  406 aa  ASSY_BRUSU RecName: Full=Argininosuccinate synthase;       
    5::387     2e-79  41%  403 aa  ASSY1_RHIL3 RecName: Full=Argininosuccinate synthase 1;       
    6::393     3e-79  43%  414 aa  ASSY_DANRE RecName: Full=Argininosuccinate synthase;       
    5::407     3e-79  42%  408 aa  ASSY_CHRVO RecName: Full=Argininosuccinate synthase;       
   11::401     4e-79  41%  407 aa  ASSY_SHEAM RecName: Full=Argininosuccinate synthase;       
    7::396     6e-79  39%  409 aa  ASSY_BUCBP RecName: Full=Argininosuccinate synthase;       
    6::390     1e-78  43%  405 aa  ASSY_SPHAL RecName: Full=Argininosuccinate synthase;       
   11::405     1e-78  40%  407 aa  ASSY_SHESH RecName: Full=Argininosuccinate synthase;       
    5::407     1e-78  42%  409 aa  ASSY_SILPO RecName: Full=Argininosuccinate synthase;       
   11::401     1e-78  41%  409 aa  ASSY_SHEPW RecName: Full=Argininosuccinate synthase;       
    7::407     1e-78  42%  408 aa  ASSY_CAUCR RecName: Full=Argininosuccinate synthase;       
    7::407     1e-78  42%  408 aa  ASSY_CAUCN RecName: Full=Argininosuccinate synthase;       
    6::392     1e-78  43%  408 aa  ASSY_AZOC5 RecName: Full=Argininosuccinate synthase;       
    7::402     2e-78  39%  406 aa  ASSY_SERP5 RecName: Full=Argininosuccinate synthase;       
    8::396     2e-78  38%  403 aa  ASSY_BUCAT RecName: Full=Argininosuccinate synthase;       
    8::396     2e-78  38%  403 aa  ASSY_BUCAI RecName: Full=Argininosuccinate synthase;       
    8::396     2e-78  38%  403 aa  ASSY_BUCA5 RecName: Full=Argininosuccinate synthase;       
    7::404     2e-78  38%  404 aa  ASSY_ERWT9 RecName: Full=Argininosuccinate synthase;       
   16::412     3e-78  40%  412 aa  ASSY_SHEPA RecName: Full=Argininosuccinate synthase;       
   11::401     3e-78  41%  407 aa  ASSY_SHEFN RecName: Full=Argininosuccinate synthase;       
   15::412     4e-78  40%  412 aa  ASSY_SHEHH RecName: Full=Argininosuccinate synthase;       
   13::398     7e-78  39%  404 aa  ASSY_MORPR RecName: Full=Argininosuccinate synthase;       
    6::389     7e-78  41%  397 aa  ASSY_LAWIP RecName: Full=Argininosuccinate synthase;       
   11::407     9e-78  40%  408 aa  ASSY_SHEWM RecName: Full=Argininosuccinate synthase;       
   11::401     9e-78  40%  407 aa  ASSY_SHEPC RecName: Full=Argininosuccinate synthase;       
    8::392     9e-78  42%  407 aa  ASSY_BARBK RecName: Full=Argininosuccinate synthase;       
   11::401     1e-77  40%  412 aa  ASSY_SHEB8 RecName: Full=Argininosuccinate synthase;       
   11::401     1e-77  40%  412 aa  ASSY_SHEB5 RecName: Full=Argininosuccinate synthase;       
   11::401     1e-77  40%  412 aa  ASSY_SHEB2 RecName: Full=Argininosuccinate synthase;       
    5::407     1e-77  41%  408 aa  ASSY_LARHH RecName: Full=Argininosuccinate synthase;       
   11::401     2e-77  40%  407 aa  ASSY_SHEON RecName: Full=Argininosuccinate synthase;       
    5::391     2e-77  42%  405 aa  ASSY_SPHWW RecName: Full=Argininosuccinate synthase;       
   11::401     2e-77  40%  407 aa  ASSY_SHESW RecName: Full=Argininosuccinate synthase;       
   11::401     2e-77  40%  407 aa  ASSY_SHESR RecName: Full=Argininosuccinate synthase;       
   11::401     2e-77  40%  407 aa  ASSY_SHESM RecName: Full=Argininosuccinate synthase;       
   11::401     2e-77  40%  407 aa  ASSY_SHESA RecName: Full=Argininosuccinate synthase;       
    2::374     2e-77  45%  390 aa  ASSY_ARCFU RecName: Full=Argininosuccinate synthase;       
   11::401     3e-77  40%  412 aa  ASSY_SHEB9 RecName: Full=Argininosuccinate synthase;       
    5::394     3e-77  38%  400 aa  ASSY_PSEHT RecName: Full=Argininosuccinate synthase;       
    2::377     3e-77  39%  395 aa  ASSY_PICTO RecName: Full=Argininosuccinate synthase;       
    5::391     3e-77  43%  468 aa  ASSY_DECAR RecName: Full=Argininosuccinate synthase;       
    5::402     4e-77  38%  402 aa  ASSY_PSYIN RecName: Full=Argininosuccinate synthase;       
    1::387     4e-77  41%  394 aa  ASSY_METMA RecName: Full=Argininosuccinate synthase;       
    3::392     4e-77  42%  394 aa  ASSY_METKA RecName: Full=Argininosuccinate synthase;       
    5::394     4e-77  37%  401 aa  ASSY_BUCAP RecName: Full=Argininosuccinate synthase;       
    5::408     6e-77  41%  409 aa  ASSY_AZOSB RecName: Full=Argininosuccinate synthase;       
   11::401     8e-77  40%  407 aa  ASSY_SHELP RecName: Full=Argininosuccinate synthase;       
    5::391     8e-77  43%  404 aa  ASSY_NOVAD RecName: Full=Argininosuccinate synthase;       
    9::390     8e-77  41%  411 aa  ASSY_BART1 RecName: Full=Argininosuccinate synthase;       
    5::401     8e-77  42%  409 aa  ASSY_AZOSE RecName: Full=Argininosuccinate synthase;       
    9::409     1e-76  41%  413 aa  ASSY_HYPNA RecName: Full=Argininosuccinate synthase;       
    2::388     1e-76  40%  393 aa  ASSY_EHRCJ RecName: Full=Argininosuccinate synthase;       
    7::407     1e-76  41%  407 aa  ASSY_CAUSK RecName: Full=Argininosuccinate synthase;       
    2::401     2e-76  42%  425 aa  ASSY_THELT RecName: Full=Argininosuccinate synthase;       
    2::388     6e-76  41%  393 aa  ASSY_EHRCR RecName: Full=Argininosuccinate synthase;       
   15::404     1e-75  40%  407 aa  ASSY_SHEDO RecName: Full=Argininosuccinate synthase;       
    6::391     1e-75  44%  400 aa  ASSY_NATPD RecName: Full=Argininosuccinate synthase;       
    2::363     1e-75  42%  392 aa  ASSY_METST RecName: Full=Argininosuccinate synthase;       
    8::401     1e-75  41%  412 aa  ASSY_XENTR RecName: Full=Argininosuccinate synthase;       
    2::377     1e-75  39%  402 aa  ASSY_THEAC RecName: Full=Argininosuccinate synthase;       
    7::403     9e-75  37%  404 aa  ASSY_PHOLL RecName: Full=Argininosuccinate synthase;       
    5::400     9e-75  40%  412 aa  ASSY_AEDAE RecName: Full=Argininosuccinate synthase;       
    6::401     2e-74  42%  416 aa  ASSY_CHICK RecName: Full=Argininosuccinate synthase;       
    8::397     3e-74  39%  405 aa  ASSY_EDWI9 RecName: Full=Argininosuccinate synthase;       
    8::395     4e-74  41%  411 aa  ASSY_XENLA RecName: Full=Argininosuccinate synthase;       
    2::392     1e-73  39%  394 aa  ASSY_EHRRW RecName: Full=Argininosuccinate synthase;       
    6::398     3e-73  39%  404 aa  ASSY_MORAB RecName: Full=Argininosuccinate synthase;       
    6::405     3e-73  39%  406 aa  ASSY_CAMLR RecName: Full=Argininosuccinate synthase;       
    2::377     4e-73  39%  397 aa  ASSY_THEVO RecName: Full=Argininosuccinate synthase;       
    2::392     4e-73  39%  394 aa  ASSY_EHRRG RecName: Full=Argininosuccinate synthase;       
    7::400     9e-73  41%  412 aa  ASSY_MOUSE RecName: Full=Argininosuccinate synthase;       
    4::397     1e-72  42%  419 aa  ASSY_DROME RecName: Full=Argininosuccinate synthase;       
    7::400     2e-72  41%  412 aa  ASSY_HUMAN RecName: Full=Argininosuccinate synthase;       
    5::387     3e-72  37%  395 aa  ASSY_PELUB RecName: Full=Argininosuccinate synthase;       
    7::400     4e-72  41%  412 aa  ASSY_BOVIN RecName: Full=Argininosuccinate synthase;       
    7::400     6e-72  41%  412 aa  ASSY_RAT RecName: Full=Argininosuccinate synthase;       
    3::347     2e-71  42%  397 aa  ASSY_HALWD RecName: Full=Argininosuccinate synthase;       
    4::393     4e-71  39%  424 aa  ASSY_ANOGA RecName: Full=Argininosuccinate synthase;       
    6::398     7e-70  41%  410 aa  ASSY_SCHPO RecName: Full=Argininosuccinate synthase;       
    6::389     1e-68  40%  396 aa  ASSY_HALSA RecName: Full=Argininosuccinate synthase;       
    4::384     8e-68  38%  404 aa  ASSY_BURPS RecName: Full=Argininosuccinate synthase;       
    5::405     3e-64  37%  420 aa  ASSY_YEAST RecName: Full=Argininosuccinate synthase;       
    1::399     2e-63  32%  399 aa  ASSY_BUCCC RecName: Full=Argininosuccinate synthase;       
    5::389     1e-60  34%  393 aa  ASSY_CARRP RecName: Full=Argininosuccinate synthase;       
    6::391     3e-54  35%  397 aa  ASSY_XANCP RecName: Full=Argininosuccinate synthase;       
   18::406     1e-53  35%  412 aa  ASSY_XANAC RecName: Full=Argininosuccinate synthase;       
    4::391     3e-53  37%  401 aa  ASSY_XYLFT RecName: Full=Argininosuccinate synthase;       
    4::399     8e-53  35%  401 aa  ASSY_XYLFA RecName: Full=Argininosuccinate synthase;       
   12::367     9e-36  34%  448 aa  ASSY_DIAST RecName: Full=Argininosuccinate synthase;       
   12::367     9e-36  34%  448 aa  ASSY_ACISJ RecName: Full=Argininosuccinate synthase;       
   12::367     4e-35  34%  472 aa  ASSY_SACEN RecName: Full=Argininosuccinate synthase;       
   12::367     2e-34  33%  478 aa  ASSY_LEIXX RecName: Full=Argininosuccinate synthase;       
   12::367     2e-34  33%  445 aa  ASSY_RALSO RecName: Full=Argininosuccinate synthase;       
   13::368     2e-34  32%  444 aa  ASSY_HAEIE RecName: Full=Argininosuccinate synthase;       
   13::368     2e-34  32%  444 aa  ASSY_HAEI8 RecName: Full=Argininosuccinate synthase;       
   12::367     2e-34  32%  448 aa  ASSY_BRASO RecName: Full=Argininosuccinate synthase;       
   12::367     2e-34  32%  445 aa  ASSY_BORPD RecName: Full=Argininosuccinate synthase;       
   12::367     3e-34  33%  445 aa  ASSY_RALPJ RecName: Full=Argininosuccinate synthase;       
   13::368     3e-34  32%  444 aa  ASSY_HAEIN RecName: Full=Argininosuccinate synthase;       
   13::368     3e-34  32%  444 aa  ASSY_HAEIG RecName: Full=Argininosuccinate synthase;       
   12::367     6e-34  33%  445 aa  ASSY_BORPA RecName: Full=Argininosuccinate synthase;       
   12::367     6e-34  33%  445 aa  ASSY_BORBR RecName: Full=Argininosuccinate synthase;       
   12::367     1e-33  33%  445 aa  ASSY_BORPE RecName: Full=Argininosuccinate synthase;       
   12::367     1e-33  32%  445 aa  ASSY_RHOPS RecName: Full=Argininosuccinate synthase;       
   12::367     1e-33  32%  445 aa  ASSY_BRAJA RecName: Full=Argininosuccinate synthase;       
   12::367     2e-33  32%  445 aa  ASSY_RHOP5 RecName: Full=Argininosuccinate synthase;       
   12::394     3e-33  32%  448 aa  ASSY_PECCP RecName: Full=Argininosuccinate synthase;       
   12::367     3e-33  32%  447 aa  ASSY_ACIAC RecName: Full=Argininosuccinate synthase;       
   12::367     4e-33  32%  445 aa  ASSY_RHOPT RecName: Full=Argininosuccinate synthase;       
   12::367     4e-33  32%  445 aa  ASSY_RHOPA RecName: Full=Argininosuccinate synthase;       
   12::367     5e-33  33%  446 aa  ASSY_VARPS RecName: Full=Argininosuccinate synthase;       
   12::367     7e-33  32%  445 aa  ASSY_RHOPB RecName: Full=Argininosuccinate synthase;       
   12::394     7e-33  31%  448 aa  ASSY_ENT38 RecName: Full=Argininosuccinate synthase;       
   12::367     9e-33  32%  481 aa  ASSY_STRCO RecName: Full=Argininosuccinate synthase;       
   12::367     1e-32  32%  445 aa  ASSY_OLICO RecName: Full=Argininosuccinate synthase;       
   12::367     1e-32  32%  470 aa  ASSY_KINRD RecName: Full=Argininosuccinate synthase;       
   12::394     2e-32  32%  448 aa  ASSY_ERWCT RecName: Full=Argininosuccinate synthase;       
   12::367     2e-32  31%  445 aa  ASSY_ACIC5 RecName: Full=Argininosuccinate synthase;       
   12::394     3e-32  32%  447 aa  ASSY_SHIDS RecName: Full=Argininosuccinate synthase;       
   12::394     6e-32  32%  449 aa  ASSY_SALAR RecName: Full=Argininosuccinate synthase;       
   12::394     8e-32  32%  447 aa  ASSY_ECO27 RecName: Full=Argininosuccinate synthase;       
   12::401     1e-31  31%  445 aa  ASSY_GEMAT RecName: Full=Argininosuccinate synthase;       
   12::394     1e-31  31%  447 aa  ASSY_ECOLC RecName: Full=Argininosuccinate synthase;       
   12::394     1e-31  31%  447 aa  ASSY_ECOHS RecName: Full=Argininosuccinate synthase;       
   12::394     1e-31  31%  447 aa  ASSY_CITK8 RecName: Full=Argininosuccinate synthase;       
   12::367     1e-31  31%  444 aa  ASSY_BURS3 RecName: Full=Argininosuccinate synthase;       
   12::367     1e-31  31%  445 aa  ASSY_BRASB RecName: Full=Argininosuccinate synthase;       
   15::370     1e-31  32%  447 aa  ASSY_NEIG2 RecName: Full=Argininosuccinate synthase;       
   15::370     1e-31  32%  447 aa  ASSY_NEIG1 RecName: Full=Argininosuccinate synthase;       
   13::368     1e-31  31%  444 aa  ASSY_MANSM RecName: Full=Argininosuccinate synthase;       
   12::394     1e-31  31%  447 aa  ASSY_ECOUT RecName: Full=Argininosuccinate synthase;       
   12::394     1e-31  31%  447 aa  ASSY_ECOK1 RecName: Full=Argininosuccinate synthase;       
   12::394     1e-31  31%  447 aa  ASSY_ECO45 RecName: Full=Argininosuccinate synthase;       
   10::394     2e-31  31%  454 aa  ASSY_YERE8 RecName: Full=Argininosuccinate synthase;       
   12::394     2e-31  31%  447 aa  ASSY_SHISS RecName: Full=Argininosuccinate synthase;       
   12::394     2e-31  31%  447 aa  ASSY_SHIFL RecName: Full=Argininosuccinate synthase;       
   12::394     2e-31  31%  447 aa  ASSY_SHIF8 RecName: Full=Argininosuccinate synthase;       
   12::394     2e-31  31%  447 aa  ASSY_SHIBS RecName: Full=Argininosuccinate synthase;       
   12::394     2e-31  31%  447 aa  ASSY_SHIB3 RecName: Full=Argininosuccinate synthase;       
   12::394     2e-31  31%  447 aa  ASSY_ECOSM RecName: Full=Argininosuccinate synthase;       
   12::394     2e-31  31%  447 aa  ASSY_ECOSE RecName: Full=Argininosuccinate synthase;       
   12::394     2e-31  31%  447 aa  ASSY_ECOLU RecName: Full=Argininosuccinate synthase;       
   12::394     2e-31  31%  447 aa  ASSY_ECOLI RecName: Full=Argininosuccinate synthase;       
   12::394     2e-31  31%  447 aa  ASSY_ECOL6 RecName: Full=Argininosuccinate synthase;       
   12::394     2e-31  31%  447 aa  ASSY_ECOL5 RecName: Full=Argininosuccinate synthase;       
   12::394     2e-31  31%  447 aa  ASSY_ECODH RecName: Full=Argininosuccinate synthase;       
   12::394     2e-31  31%  447 aa  ASSY_ECOBW RecName: Full=Argininosuccinate synthase;       
   12::394     2e-31  31%  447 aa  ASSY_ECO8A RecName: Full=Argininosuccinate synthase;       
   12::394     2e-31  31%  447 aa  ASSY_ECO81 RecName: Full=Argininosuccinate synthase;       
   12::394     2e-31  31%  447 aa  ASSY_ECO7I RecName: Full=Argininosuccinate synthase;       
   12::394     2e-31  31%  447 aa  ASSY_ECO5E RecName: Full=Argininosuccinate synthase;       
   12::394     2e-31  31%  447 aa  ASSY_ECO57 RecName: Full=Argininosuccinate synthase;       
   12::394     2e-31  31%  447 aa  ASSY_ECO55 RecName: Full=Argininosuccinate synthase;       
   12::394     2e-31  31%  447 aa  ASSY_ECO24 RecName: Full=Argininosuccinate synthase;       
   12::367     3e-31  31%  445 aa  ASSY_BURA4 RecName: Full=Argininosuccinate synthase;       
   13::368     3e-31  31%  444 aa  ASSY_ACTSZ RecName: Full=Argininosuccinate synthase;       
   10::394     4e-31  31%  455 aa  ASSY_YERPY RecName: Full=Argininosuccinate synthase;       
   10::394     4e-31  31%  455 aa  ASSY_YERPS RecName: Full=Argininosuccinate synthase;       
   10::394     4e-31  31%  455 aa  ASSY_YERPP RecName: Full=Argininosuccinate synthase;       
   10::394     4e-31  31%  455 aa  ASSY_YERPN RecName: Full=Argininosuccinate synthase;       
   10::394     4e-31  31%  455 aa  ASSY_YERPG RecName: Full=Argininosuccinate synthase;       
   10::394     4e-31  31%  455 aa  ASSY_YERPE RecName: Full=Argininosuccinate synthase;       
   10::394     4e-31  31%  455 aa  ASSY_YERPB RecName: Full=Argininosuccinate synthase;       
   10::394     4e-31  31%  455 aa  ASSY_YERP3 RecName: Full=Argininosuccinate synthase;       
   12::367     4e-31  31%  482 aa  ASSY_STRLA RecName: Full=Argininosuccinate synthase;       
   15::370     4e-31  32%  447 aa  ASSY_NEIMA RecName: Full=Argininosuccinate synthase;       
   12::394     4e-31  31%  447 aa  ASSY_ESCF3 RecName: Full=Argininosuccinate synthase;       
   12::367     4e-31  31%  445 aa  ASSY_BURCM RecName: Full=Argininosuccinate synthase;       
   13::368     5e-31  32%  445 aa  ASSY_PASMU RecName: Full=Argininosuccinate synthase;       
   12::394     5e-31  31%  447 aa  ASSY_KLEP7 RecName: Full=Argininosuccinate synthase;       
   12::394     5e-31  31%  447 aa  ASSY_KLEP3 RecName: Full=Argininosuccinate synthase;       
   12::367     8e-31  32%  447 aa  ASSY_SALTI RecName: Full=Argininosuccinate synthase;       
   12::367     8e-31  32%  447 aa  ASSY_SALNS RecName: Full=Argininosuccinate synthase;       
   12::367     8e-31  32%  447 aa  ASSY_SALEP RecName: Full=Argininosuccinate synthase;       
   12::367     8e-31  32%  447 aa  ASSY_SALA4 RecName: Full=Argininosuccinate synthase;       
   12::367     1e-30  31%  445 aa  ASSY_BURM1 RecName: Full=Argininosuccinate synthase;       
   13::368     1e-30  31%  444 aa  ASSY_HAES2 RecName: Full=Argininosuccinate synthase;       
   13::368     2e-30  31%  444 aa  ASSY_HAES1 RecName: Full=Argininosuccinate synthase;       
   12::367     2e-30  31%  445 aa  ASSY_BURCJ RecName: Full=Argininosuccinate synthase;       
   12::394     2e-30  31%  447 aa  ASSY_SALPB RecName: Full=Argininosuccinate synthase;       
   12::367     2e-30  32%  447 aa  ASSY_SALDC RecName: Full=Argininosuccinate synthase;       
   12::367     2e-30  31%  445 aa  ASSY_BURCH RecName: Full=Argininosuccinate synthase;       
   12::367     2e-30  31%  445 aa  ASSY_BURCC RecName: Full=Argininosuccinate synthase;       
   12::367     2e-30  31%  445 aa  ASSY_BURCA RecName: Full=Argininosuccinate synthase;       
   12::394     3e-30  31%  447 aa  ASSY_SALHS RecName: Full=Argininosuccinate synthase;       
   12::367     3e-30  31%  445 aa  ASSY_BURVG RecName: Full=Argininosuccinate synthase;       
   12::367     4e-30  31%  444 aa  ASSY_DELAS RecName: Full=Argininosuccinate synthase;       
   12::367     5e-30  32%  447 aa  ASSY_SALTY RecName: Full=Argininosuccinate synthase;       
   12::367     5e-30  32%  447 aa  ASSY_SALSV RecName: Full=Argininosuccinate synthase;       
   12::367     7e-30  30%  444 aa  ASSY_BURP8 RecName: Full=Argininosuccinate synthase;       
   10::367     9e-30  31%  447 aa  ASSY_JANMA RecName: Full=Argininosuccinate synthase;       
   12::382     5e-29  31%  446 aa  ASSY_BURP6 RecName: Full=Argininosuccinate synthase;       
   12::382     5e-29  31%  446 aa  ASSY_BURP1 RecName: Full=Argininosuccinate synthase;       
   12::382     5e-29  31%  446 aa  ASSY_BURP0 RecName: Full=Argininosuccinate synthase;       
   12::382     5e-29  31%  446 aa  ASSY_BURMS RecName: Full=Argininosuccinate synthase;       
   12::382     5e-29  31%  446 aa  ASSY_BURMA RecName: Full=Argininosuccinate synthase;       
   12::382     5e-29  31%  446 aa  ASSY_BURM9 RecName: Full=Argininosuccinate synthase;       
   12::382     5e-29  31%  446 aa  ASSY_BURM7 RecName: Full=Argininosuccinate synthase;       
   10::367     8e-29  30%  445 aa  ASSY_HERAR RecName: Full=Argininosuccinate synthase;       
   12::367     1e-28  30%  446 aa  ASSY_BURTA RecName: Full=Argininosuccinate synthase;       
   12::309     2e-28  33%  477 aa  ASSY_NOCSJ RecName: Full=Argininosuccinate synthase;       
   12::367     5e-28  31%  446 aa  ASSY_METPP RecName: Full=Argininosuccinate synthase;       
   12::367     7e-28  30%  453 aa  ASSY_SOLUE RecName: Full=Argininosuccinate synthase;       
   15::370     1e-26  30%  447 aa  ASSY_NEIMF RecName: Full=Argininosuccinate synthase;       
   15::370     1e-26  30%  447 aa  ASSY_NEIMB RecName: Full=Argininosuccinate synthase;       
   15::370     2e-26  30%  447 aa  ASSY_NEIM0 RecName: Full=Argininosuccinate synthase;       
   12::367     1e-25  30%  446 aa  ASSY_POLSJ RecName: Full=Argininosuccinate synthase;       
   12::307     5e-22  32%  445 aa  ASSY_POLNA RecName: Full=Argininosuccinate synthase;       
   12::160     2e-16  34%  242 aa  ASSY_ERWCH RecName: Full=Argininosuccinate synthase;       
  223::398     6e-08  32%  520 aa  GUAA_GEOSL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  222::398     3e-07  30%  520 aa  GUAA_PELPD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  222::398     6e-07  31%  520 aa  GUAA_PELCD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  222::398     8e-07  29%  520 aa  GUAA_GEOSF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  223::398     2e-06  29%  520 aa  GUAA_GEOMG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   22::187     3e-06  32%  305 aa  GUAAB_METB6 RecName: Full=GMP synthase [glutamine-hydrolyzing]
  227::403     5e-06  27%  525 aa  GUAA_PSEFS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  228::402     5e-06  26%  524 aa  GUAA_COXBR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  227::403     7e-06  27%  525 aa  GUAA_PSEU2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  227::403     7e-06  27%  525 aa  GUAA_PSEF5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  227::403     9e-06  27%  525 aa  GUAA_PSE14 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  227::403     1e-05  27%  525 aa  GUAA_PSESM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  224::399     1e-05  32%  521 aa  GUAA_AZOSB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  227::403     2e-05  27%  525 aa  GUAA_PSEPF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  217::336     2e-05  29%  512 aa  GUAA_CHLCV RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   31::153     3e-05  37%  431 aa  MNMA_BEII9 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
  216::389     3e-05  27%  511 aa  GUAA_CALS8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  223::405     4e-05  32%  534 aa  GUAA_METPP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  231::406     5e-05  29%  535 aa  GUAA_POLNS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   22::187     5e-05  31%  305 aa  GUAAB_METMJ RecName: Full=GMP synthase [glutamine-hydrolyzing]
   14::136     6e-05  36%  391 aa  MNMA_MESSB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
  227::402     6e-05  30%  524 aa  GUAA_METCA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  217::286     6e-05  35%  512 aa  GUAA_CHLMU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  221::396     1e-04  33%  518 aa  GUAA_RHOSK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  221::396     1e-04  33%  518 aa  GUAA_RHOS4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  211::384     1e-04  28%  506 aa  GUAA_DEIRA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  227::403     1e-04  28%  525 aa  GUAA_CELJU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::63      1e-04  37%  226 aa  QUEC_PELPD RecName: Full=Queuosine biosynthesis protein queC;    
  221::396     1e-04  33%  518 aa  GUAA_RHOS5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  221::396     1e-04  33%  518 aa  GUAA_RHOS1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  228::403     1e-04  26%  525 aa  GUAA_PSEHT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::63      2e-04  35%  237 aa  QUEC_GEOSL RecName: Full=Queuosine biosynthesis protein queC;    
    3::65      2e-04  40%  368 aa  MNMA_NATTJ RecName: Full=tRNA-specific 2-thiouridylase mnmA;     
  232::299     2e-04  32%  539 aa  GUAA_MICLC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  225::401     2e-04  28%  523 aa  GUAA_ALCBS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   27::126     2e-04  43%  384 aa  MNMA_ERYLH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
  224::398     2e-04  29%  520 aa  GUAA_RHILO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  224::398     2e-04  29%  520 aa  GUAA_PHEZH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  218::283     2e-04  35%  512 aa  GUAA_CHLFF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::38      3e-04  53%  229 aa  QUEC_METKA RecName: Full=Archaeosine biosynthesis protein queC;  
  230::403     3e-04  25%  525 aa  GUAA_PSEP1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::69      4e-04  38%  356 aa  MNMA2_CLOBK RecName: Full=tRNA-specific 2-thiouridylase mnmA 2;  
    1::69      4e-04  38%  356 aa  MNMA1_CLOBM RecName: Full=tRNA-specific 2-thiouridylase mnmA 1;  
    1::69      4e-04  38%  356 aa  MNMA1_CLOBL RecName: Full=tRNA-specific 2-thiouridylase mnmA 1;  
    1::69      4e-04  38%  356 aa  MNMA1_CLOBH RecName: Full=tRNA-specific 2-thiouridylase mnmA 1;  
    1::69      4e-04  38%  356 aa  MNMA1_CLOB1 RecName: Full=tRNA-specific 2-thiouridylase mnmA 1;  
  216::282     4e-04  37%  510 aa  GUAA_SYNWW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  230::403     4e-04  25%  525 aa  GUAA_PSEPG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  220::288     4e-04  38%  516 aa  GUAA_NITSB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::63      5e-04  35%  226 aa  QUEC_RALEJ RecName: Full=Queuosine biosynthesis protein queC;    
    1::63      5e-04  34%  225 aa  QUEC_GEOBB RecName: Full=Queuosine biosynthesis protein queC;    
  228::404     5e-04  25%  526 aa  GUAA_THICR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  230::403     5e-04  25%  525 aa  GUAA_PSEPW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  230::403     5e-04  25%  525 aa  GUAA_PSEPK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  230::403     5e-04  25%  525 aa  GUAA_PSEE4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  228::403     5e-04  28%  544 aa  GUAA_DECAR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  215::281     5e-04  38%  509 aa  GUAA_CARHZ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  227::403     7e-04  26%  525 aa  GUAA_TOLAT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  229::404     7e-04  25%  526 aa  GUAA_HAHCH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  213::277     7e-04  43%  511 aa  GUAA_DEIDV RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  216::388     7e-04  26%  510 aa  GUAA_CLOBJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   23::187     7e-04  31%  305 aa  GUAAB_METPE RecName: Full=GMP synthase [glutamine-hydrolyzing]
    7::67      9e-04  37%  233 aa  QUEC_DESAA RecName: Full=Queuosine biosynthesis protein queC;    
    6::62      9e-04  38%  224 aa  QUEC1_SPHAL RecName: Full=Queuosine biosynthesis protein queC 1; 
  216::388     9e-04  27%  510 aa  GUAA_CLOBH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  216::388     9e-04  27%  510 aa  GUAA_CLOB1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::399

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTERVVLAYSGGLDTSVAIGWIAEETGAEVIAVAIDCGQGGEDMEVIRQRALACGAVEAVIADAKEEFAN
ASSY_THEFY      MTERVVLAYSGGLDTSVAIGWIAEETGAEVIAVAIDCGQGGEDMEVIRQRALACGAVEAVIADAKEEFAN
ASSY_SALAI      MTERVVLAYSGGLDTSVAIPYLAEQTGAEVIAVAVDVGQGGEDLDAIRQRALDCGAVESEVVDARDEFAA
ASSY_STRAW      VTERVVLAYSGGLDTSVAIGWIAEETGAEVIAVAVDVGQGGEDLDVIRKRALACGXXXXXXXXXXXXXXX
ASSY_STRGG      MTERVVLAYSGGLDTSVAIGWIAEETGAEVIAVAVDVGQGGEDLDVIRKRALACGXXXXXXXXXXXXXXX
ASSY_STRCL      MTERVVLAYSGGLDTSVAIGWIAEETGAEVIAVAVDVGQGGEDLDVIRKRALACGXXXXXXXXXXXXXXX
ASSY_ARTS2      MTERIVLAYSGGLDTSVAIGWIGEATGAEVIAVAVDVGQGGESLETIRQRALGCGAVEAYVADASDEFAN
ASSY_ACIC1      MTERVVLAYSGGLDTSVCIGWITEQTGAEVIAVAVDVGQG-EDMEVIRKRALACGAVEAEVIDARAEFAA
ASSY_ARTAT      MTERIVLAYSGGLDTSVAIGWIGEATGAEVIAVAVDVGQGGESLETIRQRALGCGAVEAYVADARDEFAN
ASSY_ARTCA      MTERIVLAYSGGLDTSVAIGWIGEATGAEVIAVAVDVGQGGESLETIRQRALGCGAVEAYVADARDEFAN
ASSY_NOCFA      MSERVVLAYSGGLDTSVAISWIGKETGAEVVAVAIDLGQGGEDMNVVRQRALDCGAVESIVIDARDEFAE
ASSY_RENSM      VTDRIVLAYSGGLDTSVAIGWIGEATGAEVIAVAVDVGQGGESLETVRQRALGCGAVEAYVADARDEFAN
ASSY_RHOSR      MADRVVLAYSGGLDTSVAISWIGKETGKEVVAVAIDLGQGGEDMEVVRQRALDCGAVESVVVDARDEFAD
ASSY_RHOOB      MADRVVLAYSGGLDTSVAISWIGKETGKEVVAVAIDLGQGGEDMEVVRQRALDCGAVESVVVDARDEFAD
ASSY_RHOE4      MADRVVLAYSGGLDTSVAISWIGKETGAEVVAVAIDLGQGGEDMEVVRQRAIDCGAVESVVVDARDEFAD
ASSY_MYCSS      MSERVILAYSGGLDTSVAISWIGKETGREVVAVAIDLGQGGEDMDVVRQRALDCGAVEAVVIDARDEFAE
ASSY_MYCSK      MSERVILAYSGGLDTSVAISWIGKETGREVVAVAIDLGQGGEDMDVVRQRALDCGAVEAVVIDARDEFAE
ASSY_CORDI      MTNRVVLAYSGGLDTSVAIPYLAKMTGGEVVAVSLDLGQGGEDMESVRQRALDCGAVESIVIDAKDEFAN
ASSY_FRASN      MTERVVLAYSGGLDTSVAIGWIGAETGAEVIALAVDVGQGGEDLEAIRQRAFTCGAVESIVVDAREEFAA
ASSY_CORU7      MKDRVVLAYSGGLDTTVAISWIAKERNAEVIAVSIDLGQGGEDMETVRQRALGAGAVESIVVDARDEFAN
ASSY_CORJK      MKDRVVLAYSGGLDTTVAISWIAKERNAEVVCVSIDLGQGGEDMETVRQRALGAGAVESIVVDARDEFAN
ASSY_MYCLE      MPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQRALDCGAVEAIVVDARDEFAE
ASSY_FRAAA      MTERVVLAYSGGLDTSVAIGWIGAETGAEVVALAVDVGQGGEDLEAIRQRALTCGAVESIVVDARTEFAE
ASSY_CORK4      MTNRVVLAYSGGLDTSVAIPYLSKMTDGEVVAVSIDLGQGGEDMESVRQRALACGAVEAIVVDAKDEFAE
ASSY_COREF      MTNRVVLAYSGGLDTSVAIPYLSKMTGGEVVAVSLDLGQGGEDMESVRQRALDCGAVESIVIDAKDEFAE
ASSY_MYCSJ      MSERVILAYSGGLDTSVAISWIGKETGREVVAVAIDLGQGGEDMDVVRQRALDCGXXXXXXXXXXXXXXX
ASSY_MYCVP      MSERVILAYSGGLDTSVAISWIGKETGSEVVAVAIDLGQGGEDMEVVRQRALDCGXXXXXXXXXXXXXXX
ASSY_MYCS2      MSERVILAYSGGLDTSVAISWIGKETGKEVVAVAIDLGQGGEDMEVVRQRALDCGXXXXXXXXXXXXXXX
ASSY_MYCA1      MSERVILAYSGGLDTSVAISWIGKETGREVVAVAIDLGQGGEDMEVIRQRALDCGXXXXXXXXXXXXXXX
ASSY_KOCRD      MSDRVVLAYSGGLDTSVAIGWIXXXXXXXXXXXXXXXXXXXXDLETIRQRALDCGAVEAYVADARDEFAS
ASSY_MYCGI      MSERVILAYSGGLDTSVAISWIGKETGKEVVAVAIDLGQGGEDMEVVRQRAIDCGXXXXXXXXXXXXXXX
ASSY_MYCPA      MSERVILAYSGGLDTSVAISWIGKETGREVVAVAIDLGQGGEDMEVIRQRALDCGXXXXXXXXXXXXXXX
ASSY_MYCMM      MSERVILAYSGGLDTSVAISWIGKETGREVVAVAIDLGQGGEDMEVVRQRALDCGXXXXXXXXXXXXXXX
ASSY_CLAMS      MAERVVLAYSGGLDTSVGIGWLKDATGKEVVALAVDVGQGGEDMEVIRQRALDCGXXXXXXXXXXXXXXX
ASSY_MYCUA      MSERVILAYSGGLDTSVAISWIGEETGREVVAVAIDLGQGGEDMEVVCQRALDCGXXXXXXXXXXXXXXX
ASSY_CLAM3      MAERVVLAYSGGLDTSVGIGWLKDATGKEVVALAVDVGQGGEDMEVIRQRALDCGXXXXXXXXXXXXXXX
ASSY_BIFLO      --KRIVLAYSGGLDTSVAISYLKERTGKDVVAVSLDVGQGGESLETIKQRALACGAVESYVVDARDEFAN
ASSY_BIFLD      --KRIVLAYSGGLDTSVAISYLKERTGKDVVAVSLDVGQGGESLETIKQRALACGAVESYVVDARDEFAN
ASSY_BIFLI      --KRIVLAYSGGLDTSVAISYLKERTGKDVVAVSLDVGQGGESLETIKQRALACGAVESYVVDARDEFAN
ASSY_MYCTU      MSERVILAYSGGLDTSVAISWIGKETGREVVAVAIDLGQGGEHMDVIRQRALDCGXXXXXXXXXXXXXXX
ASSY_MYCTA      MSERVILAYSGGLDTSVAISWIGKETGREVVAVAIDLGQGGEHMDVIRQRALDCGXXXXXXXXXXXXXXX
ASSY_MYCBT      MSERVILAYSGGLDTSVAISWIGKETGREVVAVAIDLGQGGEHMDVIRQRALDCGXXXXXXXXXXXXXXX
ASSY_MYCBP      MSERVILAYSGGLDTSVAISWIGKETGREVVAVAIDLGQGGEHMDVIRQRALDCGXXXXXXXXXXXXXXX
ASSY_MYCBO      MSERVILAYSGGLDTSVAISWIGKETGREVVAVAIDLGQGGEHMDVIRQRALDCGXXXXXXXXXXXXXXX
ASSY_CORGL      MTNRIVLAYSGGLDTTVAIPYLKKMIDGEVIAVSLDLGQGGENMDNVRQRALDAGAAESIVVDAKDEFAE
ASSY_CORGB      MTNRIVLAYSGGLDTTVAIPYLKKMIDGEVIAVSLDLGQGGENLDNVRQRALDAGAAESIVVDAKDEFAE
ASSY_FRASC      MTERVVLAYSGGLDTSVAIGWIGAETXXXXXXXXXXXXXXXEDLEAIRQRALTCGAVESIVVDAREEFAE
ASSY_BIFAA      ---RLVLAYSGGLDTSVAISYLKERTGKDVVAVSLDVGQGGESLETIKQRALACGAVEAYVVDARDEFAN
ASSY_MICLC      MKERIILAYSGGLDTSVAIGWIXXXXXXXXXXXXXXXXXXXXSLETIRQRALDCGAVEAYVADARDEFAE
ASSY_BREBN      --DKIVLAYSGGLDTSVAIKWLQDTYNYDVIAVALDVGEG-KDLDFVQKKALQVGALKSIVVDAKDAFAE
ASSY_LACS1      ---KVVLAYSGGLDTSVEIAWLKNK-GYDVIACCIDVGEG-KDLEAIKEKGLKVGAVESIVIDAKHEFAE
ASSY_RUBXD      --KKVVLAYSGGLDTSVCLKWF-EEQGAEPYALYLDLGQG-EPAEDVREKALRIGAREVFVWDAREEFAR
ASSY_ACAM1      --KKVVLAYSGGVDTSVCIPYLKHEWGVEVITLAADLGQGDE-LEPIRKKALDAGAAQSLIADGTESFIA
ASSY_BACLD      --KKVVLAYSGGLDTSVAIKWLQEQ-GYDVVACCLDVGEG-KDLAFVQQKALQVGASNSYVIDAKEEFAK
ASSY_GLOVI      --KKVVLAYSGGVDTSVCIPYLKHEWGVEVVALAADLGQG-EDLEAVRQKALASGADQAIVQDAREDFVY
ASSY_BACSU      --KKVVLAYSGGLDTSVAIKWLQEQ-GYNVIACCLDVGEG-KDLAFVQQKALEVGATNSYVIDAKEEFAQ
ASSY_TRIEI      ---KVVLAYSGGVDTSVCIPYLKNEWGVEVITLAADLGQGDE-LEGVRKKALDSGAVESLVIDVIEPLIK
ASSY_ANAVT      --KKVVLAYSGGVDTSVCIPYLKQEWGVEVITLAADLGQGDE-LEPIREKALKSGASESLVADVKESFIK
ASSY_ANASP      --KKVVLAYSGGVDTSVCIPYLKQEWGVEVITLAADLGQGDE-LEPIREKALKSGASESLVADVKESFIK
ASSY_LISMH      --EKIVLAYSGGLDTSVAIQWLVE-SGYEVIACCLDVGEG-KNLDFIKEKAITVGASESYTIDAKEEFAE
ASSY_LISMF      --EKIVLAYSGGLDTSVAIQWLVE-SGYEVIACCLDVGEG-KNLDFIKEKAITVGASESYTIDAKEEFAE
ASSY_LISMC      --EKIVLAYSGGLDTSVAIQWLVE-SGYEVIACCLDVGEG-KNLDFIKEKAITVGASESYTIDAKEEFAE
ASSY_BACCZ      --KKVVLAYSGGLDTSVAIKWL-QEKNYDIIALCLDLGEG-KDLAFVKEKALSVGAIKSYMIDVQEEFAN
ASSY_BACC3      --KKVVLAYSGGLDTSVAIKWL-QEKNYDIIALCLDLGEG-KDLAFVKEKALSVGAIKSYMIDVQEEFAN
ASSY_BACAH      --KKVVLAYSGGLDTSVAIKWL-QEKNYDIIALCLDLGEG-KDLAFVKEKALSVGAIKSYMIDVQEEFAN
ASSY_BACHD      --KKVVLAYSGGLDTSVAIKWLSDK-GYDVIAVGLDVGEG-KDLEFVKEKALKVGAIESYTIDAKKEFAE
ASSY_BACAN      --KKVVLAYSGGLDTSVAIKWL-QEKNYDIIALCLDLGEG-KDLAFVKEKALSVGAIKSYMIDVQEEFAN
ASSY_BACAC      --KKVVLAYSGGLDTSVAIKWL-QEKNYDIIALCLDLGEG-KDLAFVKEKALSVGAIKSYMIDVQEEFAN
ASSY_BACAA      --KKVVLAYSGGLDTSVAIKWL-QEKNYDIIALCLDLGEG-KDLAFVKEKALSVGAIKSYMIDVQEEFAN
ASSY_ANOFW      ---KVVLAYSGGLDTSVAIKWLQEQ-GYDVVACCLDVGEG-KDLEFVKEKALKVGAVKSYMIDAKEEFAN
ASSY_BACCR      --KKVVLAYSGGLDTSVAIKWL-QEKNYDIIALCLDLGEG-KDLAFVKEKALSVGAIKSYMIDVQEEFAN
ASSY_BACC4      --KKVVLAYSGGLDTSVAIKWL-QEKNYDIIALCLDLGEG-KDLAFVKEKALSVGAIKSYMIDVQEEFAN
ASSY_BACC1      --KKVVLAYSGGLDTSVAIKWL-QEKNYDIIALCLDLGEG-KDLAFVKEKALSVGAIKSYMIDVQEEFAN
ASSY_BACHK      --KKVVLAYSGGLDTSVAIKWL-QEKNYDIIALCLDLGEG-KDLAFVKEKALSVGAIKSYMIDVQEEFAN
ASSY_BACC0      --KKVVLAYSGGLDTSVAIKWL-QEKNYDIIALCLDLGEG-KDLAFVKEKALSVGAIKSYMIDVQEEFAN
ASSY_BACCQ      --KKVVLAYSGGLDTSVAIKWL-QEKNYDIIALCLDLGEG-KDLAFVKEKALSVGAIKSYMIDVQEEFAN
ASSY_BACWK      --KKVVLAYSGGLDTSVAIKWL-QEKNYDIIALCLDLGEG-KDLAFVKEKALSVGAIKSYMIDVQEEYAN
ASSY_BACC7      --KKVVLAYSGGLDTSVAIKWL-QEKNYDIIALCLDLGEG-KDLAFVKEKALSVGAIKSYMIDVQEEFAN
ASSY_LISMO      --EKIVLAYSGGLDTSVAIQWLVE-SGYEVIACCLDVGEG-KNLDFIKEKAITVGASESYTIDAKEEFAE
ASSY_MICAN      --KRVVLAYSGGVDTSVCIPYLKQEWGVEVITLAADLGQGDE-LGPIQEKALRCGAIESLVVNAQEEFVK
ASSY_BACC2      --KKVVLAYSGGLDTSVAIKWL-QEKNYDVIALCLDLGEG-KDLGFVKEKALSVGAIKSYMVDVQEEFAN
ASSY_THEEB      --EKVILAYSGGVDTSVCIPYLQHEWGVEVITLAVDLGQGDE-LEPIRQKALDAGASASLVADAKAEFIR
ASSY_LISW6      --EKIVLAYSGGLDTSVAIQWLVE-SGYEVIACCLDVGEG-KNLDFIKEKAITVGASESYTIDAKEEFAE
ASSY_OCEIH      --EKIVLAYSGGLDTSVAVKWLQDKYNYDVIAVALDVGEG-KDLDFVKKKALDVGAIKSYVIDAKNLFAE
ASSY_STRU0      ---KIVLAYSGGLDTSVAIAWLKKDF--DVIAVCMDVGEG-KDLQFIHEKALKIGAIESYVIDVKEEFAE
ASSY_STRSY      --EKLILAYSGGLDTSVAIAWLKKDY--DVIAVCMDVGEG-KNLEFIHDKALSIGAIESHVLDVKEEFAQ
ASSY_STRS2      --EKLILAYSGGLDTSVAIAWLKKDY--DVIAVCMDVGEG-KNLEFIHDKALSIGAIESHVLDVKEEFAQ
ASSY_NOSP7      --KKVVLAYSGGVDTSVCIPYLKQEWGVEVITLAADLGQGDE-LEPIREKALKSGASESLVADVKDSFVK
ASSY_GEOKA      ---KLVLAYSGGLDTSVAIKWL-QERGYDVIACCLDLGEG-KDLDFVKEKALKVGAMKSYVIDVKDEFAN
ASSY_BACSK      --EKVVLAYSGGLDTSVAVKWLTDK-GYDVIAVGLDVGEG-KDLEFVKQKALQVGAIQSYTIDAKKEYAE
ASSY_GEOTN      ---KLVLAYSGGLDTSVAIKWL-QERGYDVIACCLDLGEG-KDLDFVKEKALKVGAIKSYVIDVKDEFAN
ASSY_STRGC      --EKVILAYSGGLDTSVAITWLNKDY--DVIAVCMDVGEGN-DLDFIHDKALKVGAIESHVIDVKDEFAE
ASSY_STRSV      --EKVILAYSGGLDTSVAITWLDKDY--DVIAVCMDVGEGN-DLDFIHDKALKVGAIESHVIDVKDEFAE
ASSY_LISIN      --EKIVLAYSGGLDTSVAIQWLVE-SGYEVIACCLDVGEG-KNLDFIKEKAITVGASASYTIDAKEEFAE
ASSY_LACRJ      --EKIVLAYSGGLDTSVAIAWLKNK-GYDVIACCIDVGEG-KDLEAIKEKGLQVGAWKSVVIDAKRDFAE
ASSY_LACRD      --EKIVLAYSGGLDTSVAIAWLKNK-GYDVIACCIDVGEG-KDLEAIKEKGLQVGAWKSVVIDAKRDFAE
ASSY_SYNSC      --KKVVLAYSGGVDTSVCIPYLKQEWGVEVITFAADLGQGDE-LEPIRQKALDAGASQSLVGDLIEPFIK
ASSY_CYAP4      --KKVVLAYSGGVDTSVCIPYLKHEWGVEVITLAADLGQGDE-LEPIRQKALNSGAEISLVADAKDSFIK
ASSY_STRTD      --EKVILAYSGGLDTSVAITWLKKDY--DVIAVCMDVGEG-KDLEFIHDKALTVGAVESYVLDVKDEFAE
ASSY_STRT2      --EKVILAYSGGLDTSVAITWLKKDY--DVIAVCMDVGEG-KDLEFIHDKALTVGAVESYVLDVKDEFAE
ASSY_STRT1      --EKVILAYSGGLDTSVAITWLKKDY--DVIAVCMDVGEG-KDLEFIHDKALTVGAVESYVLDVKDEFAE
ASSY_DEHE1      MSEKVVLAYSGGLDTSAAVKWLQEKYGMDVIAVTIDVGNE-KDFTLIKEKALKVGAKKAYVRDVRKEFAE
ASSY_DEHSC      MSEKVVLAYSGGLDTSAAVKWLQEKYGMDVIAVTIDVGNE-KDFTLIKEKALKVGAKKAYVRDVRKEFAE
ASSY_DEHSB      MSEKVVLAYSGGLDTSAAVKWLQEKYGMDVIAVTIDVGNE-KDFTLIKEKALKVGAKKAYVRDVRKEFAE
ASSY_STRMU      --EKVILAYSGGLDTSVAITWLKKDY--DVVAVCMDVGEG-KDLEFIHDKALKVGAIESYVLDIKDEFAE
ASSY_BACA2      --KKVVLAYSGGLDTSVAIKWLQEQ-GYDVVACCLDVGEG-KDLAFVQQKALEVGAVNSYVIDAKEEFAR
ASSY_GEOSW      ---KLVLAYSGGLDTSVAIKWL-QERGYDVIACCLDLGEG-KDLDFVKEKALKVGAIKSYVIDVKEEFAD
ASSY_SYNS9      --KKVVLAYSGGVDTSVCIPYLKQEWGVEVITFAADLGQGDE-LEPIRQKALDAGASQSLVGDLIQPFIE
ASSY_SYNJA      --KKVVLAYSGGVDTSVCIPYLKHEWGVEVVTLAVDLGQGAE-LEAIQAKALRAGAEQSLVREAVQTLIA
ASSY_SYNY3      --KKVVLAYSGGVDTSVCIPYLMHEWGVEVITLAADLGQGDE-LGPIQEKALRCGAVESLVIDGKEEFVK
ASSY_SYNS3      ---KVVLAYSGGVDTSVCIPYLKQEWGVEVITFAADLGQGDE-LEPIRLKALEAGATQSLVGDLIKPFIE
ASSY_SYNP2      --EKVVLAYSGGVDTSVCIPYLMHEWGVEVITLAADLGQG-EELGPIKQKALNSGAVVSLVEDGREEFIT
ASSY_SYNJB      --KKVVLAYSGGVDTSVCIPYLKHEWGVEVVALAVDLGQGAE-LEAIQAKALRAGAEQSLVREAVQALIT
ASSY_STRR6      --EKVILAYSGGLDTSVAITWLKKDY--DVVAVCMDVGEG-KDLDFIHDKALKVGAVESYVIDVKDEFAT
ASSY_STRP2      --EKVILAYSGGLDTSVAITWLKKDY--DVVAVCMDVGEG-KDLDFIHDKALKVGAVESYVIDVKDEFAT
ASSY_LACPL      --DKIILAYSGGLDTSVAISWLKDK-GYDVVACGIDVGEG-KDMDAIKEKALKLGAVSSYMIDAKQEFAE
ASSY_STRPI      --EKVILAYSGGLDTSVAITWLKKDY--DVVSVCMDVGEG-KDLDFIHDKALKVGAVESYVIDVKDEFAT
ASSY_BACP2      --KKVVLAYSGGLDTSVAVKWLQEQ-GYEVVACCLDVGEG-KDLAFVQQKALQVGAVQSYMIDAKXXXXX
ASSY_PROM3      --KKVVLAYSGGVDTSVCIPYLKHEWGVEVITFAADLGQGDE-LDPIRLKALDAGASQSLVGDLIEPFVE
ASSY_CYAP8      --DKVVLAYSGGVDTSVCIPYLKNEWGVEVITLAADLGQGDE-LGPIQAKALRCGAVESLVTNAQEEFVT
ASSY_STAS1      MKEKIVLAYSGGLDTSVAVKWLLDK-GYDVVACCLDVGEG-KDLELVHQKALDMGAIECHIIDATEEFSQ
ASSY_PROMM      --KKVVLAYSGGVDTSVCIPYLKHEWGVEVITFAADLGQGDE-LDPIRLKALDAGASQSLVGDLIEPFVE
ASSY_SYNP6      --KRVVLAYSGGVDTSVCIPYLKQEWGVEVITLAADLGQGDE-LGPIRQKALDSGAVESLVIDATAEFVR
ASSY_SYNE7      --KRVVLAYSGGVDTSVCIPYLKQEWGVEVITLAADLGQGDE-LGPIRQKALDSGAVESLVIDATAEFVR
ASSY_DICT6      --EKVVLAYSGGLDTSVAIKWLMQKYSLDVITLTVDIGQG-INLDEIKNKAENLGVEKAYVLDLKEEFVK
ASSY_SYNR3      ---KVVLAYSGGVDTSVCIPYLKHEWGVEVITFAADLGQGDE-LEPIRQKALDAGASQSLVGDLIEPFIT
ASSY_LEUCK      MTEKLVLAYSGGLDTSVAIPWLKEK-GYDVIAVVLNVGQHGKDMVAIQEKALKVGASQSIVIDAQAEFAD
ASSY_PROM0      --KKVVLAYSGGVDTSVCIPYLKKEYGSEVVTFVADLGQG-EDLELIRQKALNSGASQSIVGNLVNSFVE
ASSY_PROMP      --KKVVLAYSGGVDTSVCIPYLKNEYGSEVVTFVADLGQG-DDLEIVRQKALNSGATKSVIGNLVDNFVE
ASSY_PROM5      --KKVVLAYSGGVDTSVCIPYLKNEYGSEVITFVADLGQG-DDIESISQKALNSGATKSVIGNLVEDFVE
ASSY_BACCN      --KKVVLAYSGGLDTSVAIKWL-QEKNYDVIALCXXXXXXXXXX-FVKEKALSVGAIKSYMIDVQEEFMN
ASSY_PROM4      --KKVVLAYSGGVDTSSCIPYLINEYGVEVVAFAADLGQGDE-LEPIREKALSAGASECLVDDLVKPFIE
ASSY_EXIS2      --QKLILAYSGGLDTSVAIKWLSKDY--DVVALCMDVGEG-KDLSVIKEKALLVGAIESIVLDVKDEFAN
ASSY_SYNPW      --KKVVLAYSGGVDTSVCIPYLKQEWGVEVITFAADLGQGDE-LEPIRRKALEAGASQSLVGDLIQPFIE
ASSY_STRA5      --EKLILAYSGGLDTSVAIAWLKKDY--DVIAVCMDVGEG-KDLDFIHDKALTIGAIESYILDVKDEFAE
ASSY_IGNH4      ---KIVLAYSGGLDTSVAVAWLKEKFGAEVITVTVDVGQK-EDFKEIEERAYKAGASKHYLIDAKEEFVN
ASSY_SYNPX      ---KVVLAYSGGVDTSVCIPYLKQEWGVEVITFAADLGQGDE-LEPIRQKALDAGASQSLVGDLIQPFIE
ASSY_STRA3      --EKLILAYSGGLDTSVAIAWLKKDY--DVIAVCMDVGEG-KDLDFIHDKALTIGAIESYILDVKDEFAE
ASSY_STRA1      --EKLILAYSGGLDTSVAIAWLKKDY--DVIAVCMDVGEG-KDLDFIHDKALTIGAIESYILDVKDEFAE
ASSY_STAES      MKDKIVLAYSGGLDTSVAVQWLIDK-GYDVVACCLDVGEG-KDLDVVYQKALDMGAVECHIIDATKEFSD
ASSY_STAEQ      MKDKIVLAYSGGLDTSVAVQWLIDK-GYDVVACCLDVGEG-KDLDVVYQKALDMGAVECHIIDATKEFSD
ASSY_CYAA5      --KKVVLAYSGGVDTSVCIPYLKHEWGVEVITLAADLGQGDE-LGPIQAKALKSGAVESLVEDATAEFVT
ASSY_STAAW      MKEKIVLAYSGGLDTSVAVQWLIDK-GYDVVACCLDVGEG-KDLDIVYKKALDMGAVECHIIDATKEFSD
ASSY_STAAS      MKEKIVLAYSGGLDTSVAVQWLIDK-GYDVVACCLDVGEG-KDLDIVYKKALDMGAVECHIIDATKEFSD
ASSY_LACC3      MTEKIVLAYSGGLDTSVAIPWLKDK-GYEVIAVVLNVGQPNADFDAIQQKALNVGALDSIVVDAQDEFAD
ASSY_PROMS      --KKVVLAYSGGVDTSVCIPYLKNEYGSEVVTFVADLGQG-EDLELVRQKALNSGASKSIVGNLVNSFVE
ASSY_PROMA      --QKVVLAYSGGVDTSACIPYLKNEYGVEIIAFAADLGQG-EELEVVRKKALLAGAKESLVDDLIEPFIH
ASSY_PROM2      --KKVVLAYSGGVDTSVCIPYLKKEYGSEVITFVADLGQG-EDLELIRQKALNSGASQSIVGNLVNSFVE
ASSY_STAAT      MKEKIVLAYSGGLDTSVAVQWLIDK-GYDVVACCLDVGEG-KDLDIVYKKALDMGAVECHIIDATKEFSD
ASSY_STAAN      MKEKIVLAYSGGLDTSVAVQWLIDK-GYDVVACCLDVGEG-KDLDIVYKKALDMGAVECHIIDATKEFSD
ASSY_STAAM      MKEKIVLAYSGGLDTSVAVQWLIDK-GYDVVACCLDVGEG-KDLDIVYKKALDMGAVECHIIDATKEFSD
ASSY_STAAE      MKEKIVLAYSGGLDTSVAVQWLIDK-GYDVVACCLDVGEG-KDLDIVYKKALDMGAVECHIIDATKEFSD
ASSY_STAAC      MKEKIVLAYSGGLDTSVAVQWLIDK-GYDVVACCLDVGEG-KDLDIVYKKALDMGAVECHIIDATKEFSD
ASSY_STAA9      MKEKIVLAYSGGLDTSVAVQWLIDK-GYDVVACCLDVGEG-KDLDIVYKKALDMGAVECHIIDATKEFSD
ASSY_STAA8      MKEKIVLAYSGGLDTSVAVQWLIDK-GYDVVACCLDVGEG-KDLDIVYKKALDMGAVECHIIDATKEFSD
ASSY_STAA3      MKEKIVLAYSGGLDTSVAVQWLIDK-GYDVVACCLDVGEG-KDLDIVYKKALDMGAVECHIIDATKEFSD
ASSY_STAA2      MKEKIVLAYSGGLDTSVAVQWLIDK-GYDVVACCLDVGEG-KDLDIVYKKALDMGAVECHIIDATKEFSD
ASSY_STAA1      MKEKIVLAYSGGLDTSVAVQWLIDK-GYDVVACCLDVGEG-KDLDIVYKKALDMGAVECHIIDATKEFSD
ASSY_PROM9      ---KVVLAYSGGVDTSVCIPYLKNEYGSEVVTFVADLGQG-EDLELIRKKALNSGASKSIIGNLVSSFVE
ASSY_STAHJ      MKEKIVLAYSGGLDTSVAVKWLIDK-GYDVVAVCLDVGEG-KDLDVVYSKALDMGAVECHIIDATKEFSD
ASSY_LACLM      --KKIVLAYSGGLDTSVAVKWLTDK-GFDVIAACMDVGEG-KDLNFIHDKALQVGAVESVVLDCKAEFAE
ASSY_STAAB      MKEKIVLAYSGGLDTSVAVQWLIDK-GYDVVACCLDVGEG-KDLDIVYKKALDTGAIECHIIDATKEFSD
ASSY_STAAR      MKEKIVLAYSGGLDTSVAVQWLIDK-GYDVVACCLDVGEG-KDLDIVYKKALDMRAVECHIIDATKEFSD
ASSY_LACLS      --KKIVLAYSGGLDTSVAVKWLTDK-GFDVIAACMDVGEG-KDLNFIHDKALQVGAVESVVLNCKAEFAE
ASSY_LACLA      --KKIVLAYSGGLDTSVAVKWLTDK-GFDVIADCMDVGEG-KDLNFIHDKALQVGAVESVVLDCKEEFAK
ASSY_PROM1      --KKVVLAYSGGVDTSVCIPYLKKEYGVEVIAFAADLGQGDE-LDQIKQKAISAGASESLIGNLVKPFIE
ASSY_PROMT      ---KVVLAYSGGVDTSVCIPYLKEEYGVEVIAFAADLGQGDE-LDEIKKKAISAGASQSLIGNLVKPFIE
ASSY_STACT      MKEKIVLAYSGGLDTSVAVQWLIDK-GYDVVACCLDVGEG-KDLDEVYQKALDMGAIECYIIDATEEFSD
ASSY_OENOB      MADKIVLAYSGGLDTSVAIPWLKDK-GYEVIAVSLDVGQHGKQIENIQKKALKIGAIQSFIIDGKDEFAE
ASSY_LEUMM      MTDTLVLAYSGGLDTSVAIPWLKDK-GYDVIAVVLDVGQHGKNLNEIQAKALKVGAKQSIVIDAKAEFAD
ASSY_DICTD      --EKVVLAYSGGLDTSVAIKWLMQKYSLDVITLTVDIGQG-IDLNEIKNKAENLGVEKAYVLDLREEFIK
ASSY_CHLPD      --EKIAIAYSGGLDTSIMIKWLKDKYDAEIVAVTGNLGQQKE-IENLESKAIATGASAFQFVDLRKEFVE
ASSY_PYRFU      ---RIVLAYSGGLDTSVILKLMQEKLGAEVITVTVDVGQK-DDFEKIEEKAYKFGAVKHYYIDAKEEFAE
ASSY_THETN      --EKVVLAYSGGLDTSVIIPWLKENYECEIIAVCVDVGQR-EDLRYIKDKALASGASKVYIEDVKEEFVK
ASSY_SYMTH      --KKCVLAYSGGLDTSVAIHWIKENYXXXXXXXXXXXXXXXKDLEFIRQKALSIGAVKSYVYDARKEFAY
ASSY_MOOTA      VAEKVVLAYSGGLDTSIIIPWLKETYGYEVIAVAVDVGQG-EELEPLEEKAIKSGASKIYILDKKKEFVE
ASSY_PROVI      --ERIALAYSGGLDTSIMIKWLKDKYGADVVAITGNLGQQKE-IEGLEEKAVSTGASSFHFVDLKKQFVE
ASSY_CHLPB      --EKIALAYSGGLDTSVMIKWLKDKYDADIIAVTGNLGQEKE-IENLEQKAFDTGASGFSFLDLRKEFVE
ASSY_THEPX      --EKVVLAYSGGLDTSVIIPWLKENYECEIIAACINVGQG-EELKYIKDKALASGASKVYIEDVKEEFVK
ASSY_CARHZ      MAEKVVLAYSGGLDTSIIIPWLKENYGYEVIAMVADVGQG-EELEPLREKAIKSGAAKIYIEDVKEEFVR
ASSY_PELPB      --EKIAIAYSGGLDTSIMIKWLKDKYDAEIVAVTGNLGQQKE-IENLESKAIATGASKFQFLDLRKEFVE
ASSY_THEP3      --EKVVLAYSGGLDTSVIIPWLKENYECEIIAACINVGQG-EELKYIKDKALASGASKVYIEDVKEEFVK
ASSY_CLOK5      MKDKVVLAYSGGLDTSIIIPWLKENYDLDVIAACIDVGQD-DDMEAVRNKAIKTGAVKVYIEDVKEEFVR
ASSY_CLOK1      MKDKVVLAYSGGLDTSIIIPWLKENYDLDVIAACIDVGQD-DDMEAVRNKAIKTGAVKVYIEDVKEEFVR
ASSY_PROA2      --EKIALAYSGGLDTSVMIKWLKDKYDAEIVAVTGNLGQEKE-VENLEEKAIATGASSFAFLDLRKEFVE
ASSY_CHLL2      --EKIALAYSGGLDTSVMIKWLKDKYDAEIVAVTGNLGQQKE-IENLESKAYSTGASAFRFVDLRKTFVE
ASSY_AQUAE      --KRVILAYSGGLDTSIIVRWLTEK-GYEVITYTADVGQG-EELSEIPEKARRAGAIEAIVEDLKETFAE
ASSY_PELLD      --EKIAIAYSGGLDTSIMIKWLKDKYDADIVAVTGNLGQQKE-IENLESKAIATGASGFHFVDLKKPFVE
ASSY_PELTS      ---KVVLAYSGGLDTSVAIPWLKENYGYEVIAMSADLGQG-EELAPLREKAIKSGASKIYIEDVRREFVE
ASSY_DESHY      --KKVVLAYSGGLDTSIIIPWLKENYGYEVIAMAADLGQG-EELEPLHEKAIKSGASKLYIEDLQEEFVT
ASSY_DESHD      --KKVVLAYSGGLDTSIIIPWLKENYGYEVIAMAADLGQG-EELEPLHEKAIKSGASKLYIEDLQEEFVT
ASSY_UNCTG      --KKVVVAYSGGLDTSIILSWVKENYGCEVVACCVDVGQGKE-LEGLDEKAKKTGASKSYIIDAKKEFVT
ASSY_CHLP8      --EKIAVAYSGGLDTSVMIKWLKDKEGAEIVAVT---GNLGQKMEVLEPKALATGAASFHFVDLRKTFVE
ASSY_CLOTE      --EKVVLAYSGGLDTSIIIPWLKENYDLDVIAVCIDVGQD-DDMEEVKKKAIKTGAVKVYVEDAKEEFVK
ASSY_CHLTE      --EKIAVAYSGGLDTSVMIKWLKDKEGAEIVAVT---GNLGQKMEVLEQKAIATGAKSFHFVDLRKTFVE
ASSY_CHLCH      --EKIAIAYSGGLDTSVMIKWLKDKYDADIVAVTGNLGQQKE-IENLESKALATGASSFHFVDLRTEFVE
ASSY_HELMO      MSKKVVLAYSGGLDTSIIIPWLKENYGYEVIAMAADLGQG-EELEPLNEKAINTGATKIYIEDVKEEFVT
ASSY_PYRAE      ---KIVLAYSGGLDTTVAVKWLSEKFGAEVYTVTVDVGQE-DDFSKIEERAYKAGAVQHFYIDAKREFAE
ASSY_ALKMQ      --KKVVLAYSGGLDTSVILKWLEETYGYEVIAACVNVGQT-EDFAAIKKKALATGASKAYIVDVTEEFIT
ASSY_CLONN      MKEKVVLAYSGGLDTSITIHWLKENYNLDVIACCVNVGQD-EDFDEIKKKAIKSGATKIYVEDVKDEFVS
ASSY_ROSS1      ---KVVLAYSGGLDTSIIVPWLKQNYGPEVICYCANIGQDDE-LSGLEEKAIATGASKCYVEDLREEFVR
ASSY_DESAA      --KKVVLAYSGGLDTSVILKWLVETYQCEVVAFSADIGQG-EELEPVRGKAEASGACAVYIDDLREEFVK
ASSY_CLOAB      MKEKVVLAYSGGLDTSVTIPWLKDNYDVEVIAVCVNVGQE-DDMDKVKEKAVNSGAAKIYVEDVKEEFVT
ASSY_SYNAS      --KKVVLAYSGGLDTSVIVQWLIETYGCEVIAFAADVGQK-EELEGLREKAIKTGASKIYIEDLREEFAR
ASSY_LEPIN      --KKIVLAYSGGLDTSVILTWLKDTYGCEVIAFTADIGQK-EELSGLEEKGIKTGASKVYIQDLRLEFAR
ASSY_LEPIC      --KKIVLAYSGGLDTSVILTWLKDTYGCEVIAFTADIGQK-EELSGLEEKGIKTGASKVYIQDLRLEFAR
ASSY_LEPBL      --KKIVLAYSGGLDTSVILTWLKETYGCEVIAFTADVGQK-EELSGLEEKGIKTGASKVYIQDLRLEFAR
ASSY_LEPBJ      --KKIVLAYSGGLDTSVILTWLKETYGCEVIAFTADVGQK-EELSGLEEKGIKTGASKVYIQDLRLEFAR
ASSY_CLOTH      --EKVILAYSGGLDTSIIIPWLKENYDYEVIAMAADVGQG-EELEPLREKAIKTGASKIYIEDLKEEFVT
ASSY_DESRM      ---KVVLAYSGGLDTSVIIAWLKENYGYEVIAVTADLGQG-EELAPLEEKALQSGASKIYIEDLRKEFVE
ASSY_SACD2      --KKVVLAYSGGLDTSVIVKWLQETYNCEVVTFTADIGQG-EEVEPARAKAEALGVKEIYIDDLREEFVR
ASSY_ROSCS      ---KVVLAYSGGLDTSIIVPWLKQNYGPEVICYCANIGQDDE-LSGLEAKAIATGASKCYVEDLREEFVR
ASSY_PSEMY      --KKVVLAYSGGLDTSVILKWLQDTYNCEVVTFTADLGQG-EEVEPARAKAQALGVKEIYIDDLREEFVR
ASSY_METMP      MQEKIVLAYSGGLDTSCCLKLLEDKYDYKVISVAVDVGQPEDDLKEPEEKAKKFGVLKHYTIDAKEEFAK
ASSY_ARATH      --KKVVLAYSGGLDTSVIVPWLKENYGCEVVCFTADVGQGIKELEGLEQKAKASGASQLVVKDLTEEFVK
ASSY_CHRSD      --KKVVLAYSGGLDTSVIVKWLQETYDCEVVTFTADIGQG-EEVEPARAKAQALGVKEIYIEDLREEFVR
ASSY_PSEAE      --KKVVLAYSGGLDTSVILKWLQDTYNCEVVTFTADLGQG-EEVEPARAKARAMGVKEIYIDDLREEFVR
ASSY_PSEAB      --KKVVLAYSGGLDTSVILKWLQDTYNCEVVTFTADLGQG-EEVEPARAKARAMGVKEIYIDDLREEFVR
ASSY_PSEA8      --KKVVLAYSGGLDTSVILKWLQDTYNCEVVTFTADLGQG-EEVEPARAKARAMGVKEIYIDDLREEFVR
ASSY_PSEA7      --KKVVLAYSGGLDTSVILKWLQDTYNCEVVTFTADLGQG-EEVEPARAKARAMGVREIYIDDLREEFVR
ASSY_CALS8      ---KVVLAYSGGLDTSVIIPWLKENFSCEVIAVVVDVGQE-DDFETIKERAYKTGASKVYIEDAKAEFVK
ASSY_ALCBS      ---KVVLAYSGGLDTSVIVKWLQDTYDCEVVTFTADIGQG-EEVEPARAKAEAMGVKEIYIEDLREEFVR
ASSY_ANATD      ---KVVLAYSGGLDTSVIIPWLKENFDCEVIAVVVDVGQE-DDFDAIKEKAYKTGASKVYIEDAKEEFVN
ASSY_HAHCH      ---KVVLAYSGGLDTSVIVKWLQENYDCEVVTFTADIGQG-EEVEPARAKAEKLGVKQIFIEDLREEFAR
ASSY_DESPS      --DKIVLAYSGGLDTSVILKWLANEYECPVVAYSANIGQI-EDWDAVKEKGMATGADKVIVSDLQKEFVE
ASSY_PSEU5      --KKVVLAYSGGLDTSVILKWLQDTYNCEVVTFTADLGQG-EEVEPARAKAQALGVKEIYIDDLREEFVR
ASSY_WOLSU      ---KIVLAYSGGLDTSVILKWLQEQYQCEVVTFTADIGQG-EEVEPARAKAKLLGIKEEFIKDLKEEFVR
ASSY_PSEF5      ---KVVLAYSGGLDTSVILKWLQDTYNCEVVTFTADLGQG-EEVEPARAKAQAMGVKEIYIDDLREEFVR
ASSY_PSEA6      --KKVVLAYSGGLDTSAIIPWLKENYDCEVIAFAADVGQGDEELEGLREKAIKTGASECYIVDLKDEFVS
ASSY_CLOBL      MKEKVVLAYSGGLDTSIIIPWLKENYDLDVIAVCVNVGQG-DDMDYVKTKAIKSGASKIYVEDVKEEFVV
ASSY_MARMS      --KKVVLAYSGGLDTSVIAKWLQEEYNCEVVTFTADLGQG-EEVEPARAKAQALGIKEIYIEDLREEFVR
ASSY_MARAV      --KKVVLAYSGGLDTSVIVRWLQDTYNCEVVTFTADIGQG-EEVEPARAKAEALGVKEIYIEDLREEFVR
ASSY_CLOBM      MKEKVVLAYSGGLDTSIIIPWLKENYDLDVIAVCVNVGQG-DDMDYVKTKAIKSGASKIYVEDVKEEFVV
ASSY_CLOBK      MKEKVVLAYSGGLDTSIIIPWLKENYDLDVIAVCVNVGQG-DDMDYVKTKAIKSGASKIYVEDVKEEFVV
ASSY_CLOBH      MKEKVVLAYSGGLDTSIIIPWLKENYDLDVIAVCVNVGQG-DDMDYVKTKAIKSGASKIYVEDVKEEFVV
ASSY_CLOB6      MKEKVVLAYSGGLDTSIIIPWLKENYDLDVIAVCVNVGQG-DDMDYVKTKAIKSGASKIYVEDVKEEFVV
ASSY_CLOB1      MKEKVVLAYSGGLDTSIIIPWLKENYDLDVIAVCVNVGQG-DDMDYVKTKAIKSGASKIYVEDVKEEFVV
ASSY_PSEFS      ---KVVLAYSGGLDTSVILKWLQDTYNCEVVTFTADLGQG-EEVEPARAKAQAMGVKEIYIDDLREEFVR
ASSY_CLOBJ      MKEKVVLAYSGGLDTSIIIPWLKENYDLDVIAVCVNVGQG-DDMDYVKTKAIKSGASKIYVEDVKEEFVV
ASSY_EUBE2      MKEKVILAYSGGLDTTAIIPWLKETYNYDVVCVCADCGQE-EELDGLEQRALSCGAAKLYIEDITDEFCD
ASSY_AZOVD      --KKVVLAYSGGLDTSVILKWLQDTYNCEVVTFTADLGQG-EEVEPARAKAQALGVKEIFIDDLREEFVR
ASSY_HALHL      --KKVVLAYSGGLDTSVILKWLEETYGCEVVTFTADLGQG-EELEPARRKAEAFGIREIYVDDLREEFAR
ASSY_PSEPF      ---KVVLAYSGGLDTSVILKWLQDTYNCEVVTFTADLGQG-EEVEPARAKAQAMGVKEIYIDDLREEFVR
ASSY_METTH      --DKVVLAFSGGLDTSVCIKLLEEKYNMEVITACVDVGQPRDEIERPAMVAKELGNYRHYTVDARREFAE
ASSY_METCA      --KKVALAYSGGLDTSVILKWLQETYGCEVVTFTADLGQG-EEVEPARAKAQAMGVKEIYIDDLREEFSR
ASSY_LEPBP      --KKIVLAYSGGLDTSVILAWLKDTYGCEVIAFCADVGQXXXXXXXXXXXXNT-GASKVYIQDLRLEFAR
ASSY_LEPBA      --KKIVLAYSGGLDTSVILAWLKDTYGCEVIAFCADVGQXXXXXXXXXXXXNT-GASKVYIQDLRLEFAR
ASSY_PELCD      --KKAVLAYSGGLDTSIIVRWLIEEYGCEVIAFAADVGQGKE-LDGIPEKARQTGASKCYVEDLREEFVR
ASSY_METVA      MQEKIVLAYSGGLDTSCCLKLLEDKYNYKVVSVAVDVGQPEDDLKEPEEKAKKLGVLKHYTIDAKEEFAV
ASSY_THET2      ---KIVLAYSGGLDTSIILKWLKETYGAEVIAFTADIGQG-EEVEEAREKALRTGASKAIALDLKEEFVR
ASSY_SYNFM      --KKVVLAYSGGLDTSIILKWLIESYGCEVVAFSADLGQA-EELDGLEAKALATGAVKARIVDLREEFVR
ASSY_NITSB      ---KVVLAYSGGLDTSVILKWLQETYNCEVVTFTADIGQG-EEVEPAREKALKLGIKNIFIEDLKEEFVR
ASSY_SULTO      ---KIVLAYSGGLDTTVAIRWLKETFNADVITVTVDVGQK-DNFEDIEKRAYIAGATKHYTIDAKKEFAD
ASSY_PSEPK      --KKVVLAYSGGLDTSVILKWLQDTYNCEVVTFTADLGQG-EEVEPARAKAQAMGVKEIYIDDLREEFVR
ASSY_PSEP1      --KKVVLAYSGGLDTSVILKWLQDTYNCEVVTFTADLGQG-EEVEPARAKAQAMGVKEIYIDDLREEFVR
ASSY_PSEE4      --KKVVLAYSGGLDTSVILKWLQDTYNCEVVTFTADLGQG-EEVEPARAKAQAMGVKEIYIDDLREEFVR
ASSY_LEGPH      --KKIALAYSGGLDTSIMIPWLKEHEHAEVIAVICDLGQQ-EDLDAIKNKALKSGASKAYVVDVKNEFAT
ASSY_PSEPW      --KKVVLAYSGGLDTSVILKWLQDTYDCEVVTFTADLGQG-EEVEPARAKAQAMGVKEIYIDDLREEFVR
ASSY_LEGPC      --KKIALAYSGGLDTSIMIPWLKEHEHAEVIAVICDLGQQ-EDLDTIKNKALKSGASKAYVVDVKNEFAI
ASSY_LEGPA      --KKIALAYSGGLDTSIMIPWLKEHEHAEVIAVICDLGQQ-EDLDAIKNKALKSGASKAYVVDVKNEFAI
ASSY_DEIRA      --EKIVLAYSGGLDTSIILKWLQTERNYDVVCFTADLGQGDE-VEEARVKALNTGAVAAYALDLREEFVR
ASSY_RHILO      --KKVVLAYSGGLDTSIILKWLQTELGAEVVTFTADLGQGGE-LEPARKKAEMMGIKDIRIVDVREEFVA
ASSY_AERS4      ---KIVLAYSGGLDTSAIIPWLKEHYDAEIIAFVADVGQERDDLEGIEQKAIASGAVKCIVKDLREEFVK
ASSY_NITMU      --KKVVLAFSGGLDTSVILKWLQDTYRCEVVTFTADIGQG-EEVEPARAKAKQLGVREIFIDDLREEFVR
ASSY_ALHEH      --KKVVLAYSGGLDTSVILQWLRETYDCEVVTFTADLGQG-EELEPARKKAEAFGIKEIYIDDLREEFVR
ASSY_SULSO      ---KIVLAYSGGLDTTVSIRWLKETFKAEIITVTVDVGQK-DDFKKIEERAYIAGASKHYTIDAVRQFAN
ASSY_ACIBL      MREKIVLAYSGGLDTSIIIPWLKENYSCDVIAMVGDVGQG-DDIDAVVAKAHKTGASKVIVKDLREEFLT
ASSY_MARMM      --KKVVLAYSGGLDTSVILKWLQDAYDAEVVTFTADLGQG-EELEPARRKAEAAGVSEIFIEDLREEFVR
ASSY_MAGSM      --DKVVLAYSGGLDTSIILKWLQDEYQCEVVAFCADLGQA-EELEPARAKAEKFGVKEIYIDDLKEEFVR
ASSY_VIBFM      ---KVVVAYSGGLDTSVIIPWLKENYNCEVIAFVADVGQGEEELEGIEAKAIASGATECYIADLKEEMVS
ASSY_PSEPG      --KKVVLAYSGGLDTSVILKWLQDTYNCEVVTFTADLGQG-EEVEPARAKAQAMGVKEIYIDDLREEFVR
ASSY_GEOSF      --KKIVLAYSGGLDTSIILKWLKNEYGCEVITFSADLGQGDE-LAPIREKAFATGADKVYIDDLKEEFVR
ASSY_AERHH      ---KIVLAYSGGLDTSAIIPWLKENYDAEIIAFVADVGQERDDLEGIEQKAIASGATKCIVKDLREEFVK
ASSY_THET8      ---KIVLAYSGGLDTSIILKWLKETYRAEVIAFTADIGQG-EEVEEAREKALRTGASKAIALDLKEEFVR
ASSY_SULAC      ---KIVLAYSGGLDTTVAIRWLRETFNADVTTVTVDVGQK-DDFYQIEKRAYIAGAIKHYTIDAKKDFAE
ASSY_ALISL      -------AYSGGLDTSVIIPWLKENYDCEVIAFVADVGQGAEELEGIEAKAIASGASECYVADLKEEMVS
ASSY_ARCB4      --KKVVLAYSGGLDTSIILKWLQDEYNAEVITFTADLGQG-EEVEPARQKAIACGIKNVFILDIKEEFVK
ASSY_GEOUR      --KKIVLAYSGGLDTSIILKWLKNEYGCEVITFSADLGQGDE-LTPIRDKAFATGADKVYIDDLREEFVR
ASSY_EUBR3      MKDKVVLAYSGGLDTTAIIPWLKETYDYDVICCCINCGQG-EELDGLDERAKLSGASKLYIEDICDEFSE
ASSY_DESVH      --KKVVLAYSGGLDTSVILKWLAVTYNCEVVTLTADLGQE-EDLDGVDDKAMRTGASRAYVEDLQEEFAR
ASSY_VIBF1      ---KVVVAYSGGLDTSVIIPWLKENYNCEVIAFVADVGQGEEELEGIEAKAIASGATECYVVDLKEEMVS
ASSY_THICR      --KKVVLAYSGGLDTSIIAKWLQEEYQCEVVTFTADIGQG-EEVAPARAKAEAMGIKEIYIEDLREEFAR
ASSY_DESVV      --KKVVLAYSGGLDTSVILKWLAVTYNCEVVTLTADLGQE-EDLDGVDDKAMRTGASRAYVEDLQEEFAR
ASSY_CAMC1      --KKVVLAYSGGLDTSIILKWLQDEYKCEVVTFTADIGQG-EELEPARKKALALGVKNIFIEDLREEFVR
ASSY_GEOSL      --KKIVLAYSGGLDTSIILKWLKNEYGCEVIAFSADLGQGDE-LAPIRDKAIATGADKVYIDDLKEEFVK
ASSY_CLOD6      MKEKVVLAYSGGLDTSIIIPWLKENEDIDVIAV---CGNVGQEMEDVYEKALQSGASKAYVDDISEEFVT
ASSY_PSYWF      ---KIVLAYSGGLDTSIIAKWLQDTYDAEVITFTADIGQG-EEVEPARAKAEAMGIKHIHIEDLRAEFAR
ASSY_LEGPL      --KKIALAYSGGLDTSIMIPWLKEHEHAEVIAVICDLGQQ-EDLDAIKNKALKSGASKAYVVDVKNEFAI
ASSY_DESDG      --KKVVLAYSGGLDTSVILKWIAKTYDCEVVTLTADLGQE-EDLDGVDEKALRTGATRAYVEDLREEFAR
ASSY_DEIGD      --DKIVLAYSGGLDTSIILKWLQTERNYDVVTFTADLGQGDE-VEEARVKALNTGAVAAYALDLREEFVR
ASSY_METS5      ---KIVLAYSGGLDTTVAIKWLSETFHAEVISVSVDVGQK-DDFKKIEERAYKAGSAKHYLVDAKREFAE
ASSY_MESSB      --KKVVLAYSGGLDTSIILKWLQTELGAEVVTFTADLGQG-EELEPARRKAEMLGIKEIHIEDLREEFVR
ASSY_VIBHB      ---KVVVAYSGGLDTSVIIPWLKENYDCEVVAFVADVGQGAEELEGIEAKAKASGASECYIADLKEEMVA
ASSY_NITEC      --KKAVLAFSGGLDTSVILKWLQDTYQCEVVTFTADIGQG-EEIEPARAKALQFGIKEIFIEDLREEFVR
ASSY_METBF      MAKKVALAYSGGLDTSVCIPILKEKYGYEVVTISVDVGQPEEEIKRADAKAEKISNKHYTI-DAKEEFVK
ASSY_METHJ      ----VVLAYSGGLDTSICIPLLKEEYGYDVVTVAADVGQRKEEISIAEEKGKRF-ADKHYTLDLIDQFVD
ASSY_PARL1      --KKVVLAYSGGLDTSVILKWLQETYGCEVVTFTADLGQG-EELEPARKKAEMLGVKEIYIEDLREEFVR
ASSY_GEOMG      --KKIVLAYSGGLDTSIILKWLKNEYGCEVIAFSADLGQGDE-LAPIRDKAFATGADKVYIDDLKEEFVR
ASSY_VIBPA      ---KVVVAYSGGLDTSVIIPWLKENYDCEVVAFVADVGQGAEELEGIEAKAKASGASECYIADLKEEMVA
ASSY_THENN      MKEKVVLAYSGGLDTSVILKWLCEK-GFEVIAYVANVGQK-DDFEAIKEKALKTGASKVYIEDLRREFVT
ASSY_DESVM      --KKVVLAYSGGLDTSVILKWIAVTYGCEVVTLTADLGQE-EDLDGVDAKALRTGASRAYVEDLREEFAR
ASSY_PSE14      ---KVVLAYSGGLDTSVILKWLQDTYNCEVVTFTADLGQG-EEVEPARAKAQAMGVKEIYIDDLREEFVR
ASSY_HYPBU      ---KVVLAYSGGLDTS-AILVLLREQGHEVVTVTVSVGQXXXXXXXXX-RAYKLGASKHYTVNAVEEFAE
ASSY_GEOSM      --KKIVLAYSGGLDTSIILKWLKNEYGCEVVTFSADLGQGDE-LEPVREKAFKTGADKVYIDDLREEFVR
ASSY_GEOBB      --KKIVLAYSGGLDTSIILKWLKNEYGCEVVTFSADLGQGDE-LEPVREKAFKTGADKVYIDDLREEFVR
ASSY_CLOP1      ---KVILAYSGGLDTSIIIPWLKENYGCEVIAVVGNVGQSDE-LVGLKEKAIKTGASKIYIEDLTKEFVE
ASSY_PSEU2      ---KVVLAYSGGLDTSVILKWLQDTYNCEVVTFTADLGQG-EEVEPARAKAQAMGVKEIYIDDLREEFVR
ASSY_DEIDV      --DKIVLAYSGGLDTSIILKWLQTERNYDVVCFTADLGQGDE-VEEARVKALNTGAVAAYALDLREEFVR
ASSY_VIBVY      ---KVVVAYSGGLDTSVIIPWLKENYDCEVVAFVADVGQGEEELVGIEEKAKASGASECYVVDLKEELVA
ASSY_VIBVU      ---KVVVAYSGGLDTSVIIPWLKENYDCEVVAFVADVGQGEEELVGIEEKAKASGASECYVVDLKEELVA
ASSY_MAGSA      --KKVVLAYSGGLDTSIILRWLQDQYQCEVVTFTADLGQG-EELEPARAKARLMGIKEEFIDDLREEFVR
ASSY_CLOBB      ---KVILAYSGGLDTSIIIPWLKENYNCEVIAVCGNVGQKDE-LDGLEEKAIKTGASKLYIEDLTKEFVE
ASSY_VIBCM      --KKVVVAYSGGLDTSVIIPWLKENYDCEVVAFVADVGQGDEELKGVEAKALSSGASECYIVDLKEEFVK
ASSY_VIBCH      --KKVVVAYSGGLDTSVIIPWLKENYDCEVVAFVADVGQGDEELKGVEAKALSSGASECYIVDLKEEFVK
ASSY_VIBC3      --KKVVVAYSGGLDTSVIIPWLKENYDCEVVAFVADVGQGDEELKGVEAKALSSGASECYIVDLKEEFVK
ASSY_METBU      MSKKVALAYSGGLDTSICIPLLKEEYGYEVITVAVDVGQPKEDVAQAEEKAKKISDKHFTL-DVREEFVN
ASSY_PSYCK      ---KIVLAYSGGLDTSIIARWLQETYDAEVITFTADIGQG-EEVEPARAKAEAMGIKHIHIEDLREEFAR
ASSY_POLSQ      --KKAVLAYSGGLDTSVILKWLQDTYGCEIVTFTADLGQG-EELEPARAKALQFGIKNIFIDDLREEFVR
ASSY_NITHX      --EKVVLAYSGGLDTSIILKWLQTTYGAEVVTFTADLGQG-EELEPARQKALLLGIKNIFIEDLREEFVR
ASSY_PSYA2      ---KIVLAYSGGLDTSIIARWLQETYDAEVITFTADIGQG-EEVEPARAKAEAMGIKHIHIEDLREEFAR
ASSY_PSESM      ---KVVLAYSGGLDTSVILKWLQDTYNCEVVTFTADLGQG-EEVEPARAKAQAMGVKEIYIDDLREEFVR
ASSY_GRABC      --KKVVLAYSGGLDTSVILRWLQTTYNCEVVTFTADLGQG-EELEPARRKAEMFGVKEIFVDDLRETFVK
ASSY_CLOPE      ---KVILAYSGGLDTSIIIPWLKENYGCEVIAVVGNVGQSDE-LVGLKEKAIKTGASKIYIEDLTKEFVE
ASSY_BURXL      --KKVVLAYSGGLDTSVILKWLQDNYDAEVVTFTADIGQG-EELEPARKKALQLGIKNIFIEDLREEFVR
ASSY_METSB      --KKVVLAYSGGLDTSIILKWLETTYGCEVVTFTADLGQG-EEIEPARQKAILLGVKNIFIEDLREEFVR
ASSY_GLUDA      --KKVVLAYSGGLDTSVILRWLQTTYGCEVVTFTADLGQG-EELEPARKKAEMFGVKEIFVEDLRETFVK
ASSY_CAMHC      --KKVVLAYSGGLDTSVILKWLEDNYKCEVVTFTADIGQN-EDLKPIKEKALKLGIKKEFIKDLREEFVR
ASSY_BRAHW      MKKKLVLAYSGGLDTTVIIPWLKENYDYDVIAVCVDVGQGTET-DGLEEKALKTGAVKYRLVKCEDEFVT
ASSY_NITWN      --QKVVLAYSGGLDTSIILKWLQTTYGAEVVTFTADLGQG-EELEPARRKAQLLGIKDEFIEDLREEFVR
ASSY_CLOB8      ---KVVLAYSGGLDTSIIIPWLKENYGCEVIAVCGNVGQKDE-LDGLEEKAIKTGASKLYIEDLTQEFVD
ASSY_CAMFF      --KKVVLAYSGGLDTSIILKWLQDEYKCEVVTFTADIGQG-EEVEPARKKAISLGIKNIFIEDLREEFVK
ASSY_CLOBA      ---KVILAYSGGLDTSIIIPWLKENYNCEVIAVCGNVGQKDE-LDGLEEKAIKTGASKLYMEDLTKEFVE
ASSY_PELPD      --KNVVLAYSGGLDTSIILKWLKNEYGCRVVAFSADLGQG-EELDPVREKALATGADVVYIDDLREEFVR
ASSY_PARDP      --KKVVLAYSGGLDTSIILKWLQTEYGCEVITFTADLGQG-EELEPARQKAELLGIKNIHIVDVREEFVR
ASSY_ACICJ      --KKVVLAYSGGLDTSVILRWLQTERGAEVVTFTADLGQG-EELEPARRKAEMFGVKEIFVEDLRETFVK
ASSY_NITOC      --KKVVLAYSGGLDTSVILKWLQETYDCEVVTFTADIGQG-EEVAPARAKAETLGVKEIYIEDLREEFCR
ASSY_THESQ      MKEKVVLAYSGGLDTSVILKWLCEK-GFDVIAYVANVGQK-DDFDAIKEKALKTGASKVYVEDLRREFVT
ASSY_GLUOX      --KKVVLAYSGGLDTSVILRWLQKTYNCEVVTFTADLGQG-EELEPARKKAEMFGVKEIFVEDLRETFVK
ASSY_NITEU      --KKAVLAFSGGLDTSVILKWLQDTYQCEVVTFTADIGQG-EEIEPARAKAVQFGIREIFIEDLREEFVR
ASSY_THEMA      MKEKVVLAYSGGLDTSVILKWLCEK-GFDVIAYVANVGQK-DDFVAIKEKALKTGASKVYVEDLRREFVT
ASSY_RHOCS      --KKVVLAYSGGLDTSVILKWLQETYRCEVVTFTADLGQG-EELEPARAKAQMLGIENIFIDDLREEFVR
ASSY_BURPP      --KKVVLAYSGGLDTSVILKWLQDNYDAEVVTFTADIGQG-EELEPARKKALQLGIKQIFIEDLREEFVR
ASSY_THIDA      --KKVVLAYSGGLDTSVILKWLQDTYQCEVVTFTADLGQG-EELEPARQKALQFGIKQIYIDDLREEFVR
ASSY_RHIEC      --KKVVLAYSGGLDTSIILKWLQTELGAEVVTFTADLGQG-EELEPARKKAEMLGIKEIYIEDVREEFVR
ASSY_JANSC      --KKVVLAYSGGLDTSIILKWLQTEYGCEVVTFTADLGQG-EELEPARKKAEMMGAAGIYVEDLREEFVR
ASSY_HELHP      --KKVVLAYSGGLDTSVILKWLGDNYHCEVVTFTADIGQG-EEVEPAREKALKLGSENIFIEDLREEFIK
ASSY_CAMC5      --KKVVLAYSGGLDTSIILKWLQDEYKCEVVTFTADIGQG-EELEPARKKALALGVKNIFIEDLREEFVR
ASSY_RUTMC      --KKVVLAYSGGLDTSIIVKWLQDTYRCEVVTFTADIGQG-EEVELARTKAKAAGVKEVYIENLREEFVR
ASSY_METAC      MVKKVALAYSGGLDTSVCIPILKEKYGYEVITISVDVGQPXXXXXXXXXXXXXXSNKHYTI-DAKEEFVK
ASSY_ERYLH      --KRVVLAYSGGLDTSVIAKWLEVERGLEVVTFTADLGQG-EELEPARAKAQAMGIPDKFIEDLREEFVR
ASSY_THEP1      MKEKVVLAYSGGLDTSVILKWLCEK-GFDVIAYVANVGQK-DDFDAIKEKALKTGASKVYVEDLRREFVT
ASSY_SILST      --KKVVLAYSGGLDTSIILKWLQTEYGCEVVTFTADLGQG-EELEPARKKAELLGIKNIFIEDIREEFVR
ASSY_DINSH      --KKVVLAYSGGLDTSIILKWLQTEYDCEVVTFTADLGQG-EELEPARAKAEMMGASAIYIEDLREEFVR
ASSY_CAMJR      --KKVVLAYSGGLDTSIILKWLQDEYNCEVVTFTADIGQG-EELEPARKKALSLGIKEEFIKDLRDEFVK
ASSY_XANP2      --KKVVLAYSGGLDTSVILKWLQTTYKCEVITFTADLGQG-EELEPARKKAQLLGIKDEFIEDVREEFVA
ASSY_SULNB      ---KAVLAYSGGLDTSIILKWLQDEYECEVVTFTADLGQG-EEVEPARQKALDMGIKNIFILDLREEFVR
ASSY_SULDN      --KKVVLAYSGGLDTSVILKWLQDEYKCEVVTFTADIGQG-EEVEPARAKALALGIKNIFIDDLREEFVK
ASSY_IDILO      --KKVVLAYSGGLDTSAIVPWLKENYGCEVVAFVADVGQGAEELEGVEEKAKASGASECHVVDLKDEFVK
ASSY_CAMJE      --KKVVLAYSGGLDTSIILKWLQDEYNCEVVTFTADIGQG-EELEPARKKALSLGIKEEFIKDLRDEFVK
ASSY_CAMJD      --KKVVLAYSGGLDTSIILKWLQDEYNCEVVTFTADIGQG-EELEPARKKALSLGIKEEFIKDLRDEFVK
ASSY_AGRT5      --KKVVLAYSGGLDTSIILKWLQTELGAEVVTFTADLGQG-EELEPARKKAEMLGIKEIFVEDVREEFVR
ASSY_ZYMMO      --KRVVLAYSGGLDTSVILKWLQEHYGCEVVTFTADLGQG-EELEPARKKAEMMGIKPEHIFDLREEFVR
ASSY_ENTS8      --KKVVLAYSGGLDTSAIIPWLKENEGCDVVACVVDIGQDRDDLKGVEQKALRSGASECYVVDAREEFIK
ASSY_CAMJJ      --KKVVLAYSGGLDTSIILKWLQDEYNCEVVTFTADIGQG-EELEPARKKALSLGIKEEFIKDLRDEFVK
ASSY2_RHIL3     --KKVVLAYSGGLDTSIILKWLQTELGAEVVTFTADLGQG-EELEPARKKAEMLGIKEIYIEDVREEFVR
ASSY_RHORT      --KKVVLAYSGGLDTSIILRWLQDEYDCEVVTFTADIGQG-EELEPARQKAEMMGIKEIYIEDLREEFVR
ASSY_RHOFA      ----IVLAYSGGLDTSVAVHWLKERYQTEVIAYCANLGQI-EDLEAVSKRATAAGASEVIVEDVRDLFLH
ASSY_CAMJ8      --KKVVLAYSGGLDTSIILKWLQDEYNCEVVTFTADIGQG-EELEPARKKALSLGIKEEFIKDLRDEFVK
ASSY_COLP3      --KKVVLAYSGGLDTSAIIPWLKENDGCEVIAFCADVGQGDEELEGVKEKAIASGASECYVVDLKEEYVK
ASSY_VESOH      ---KVVLAYSGGLDTSIIVKWLQDTYQCEVVTFTADIGQG-EEVEPARVKAEAAGVKEIYIEDLREEFAR
ASSY_POLNS      --KKAVLAYSGGLDTSVILKWLQDTYGCEIVTFTADFGQG-EELEPARAKALQFGIKNIFIDDLCEEFVR
ASSY_OCHA4      --KKVVLAYSGGLDTSIILKWLQTELGAEVVTFTADLGQG-EELEPARKKAEMLGIKEIFIEDVREEFVR
ASSY_RHOSK      --KKVVLAYSGGLDTSIILKWLQTEYGCEVVTFTADLGQG-EELEPAREKAVMLGIKNIFIEDVREEFVR
ASSY_RHOS4      --KKVVLAYSGGLDTSIILKWLQTEYGCEVVTFTADLGQG-EELEPAREKAVMLGIKNIFIEDVREEFVR
ASSY_RHOS1      --KKVVLAYSGGLDTSIILKWLQTEYGCEVVTFTADLGQG-EELEPAREKAVMLGIKNIFIEDVREEFVR
ASSY_RHIME      --KKVVLAYSGGLDTSIILKWLQTELGAEVVTFTADLGQG-EELEPARKKAEMLGIKEIYIEDVREEFVR
ASSY_HALMA      ----VALAFSGGLDTTVCVSLLKEEYGYEVIGVTVDVGQPDYXXXXXXXXXXXLG-VEQHVVDATEEFA-
ASSY_RHOBA      -----VLAYSGGLDTSVILGWLQDQ-GYEVHCVYVDLGQPCEDRDAIMEKARTCGAKSSRLVDVREELCR
ASSY_METJA      --ERIVLAYSGGLDTSCCLKLLEDKYGYKVVSVCVDVGQPXXXXXXXXXXXXXLGVLKHYTIDAKEEFVK
ASSY_BRUSI      --KKVVLAYSGGLDTSIILKWLQTELGAEVVTFTADLGQG-EELEPARKKAEMLGIKEIFIEDVREEFVR
ASSY_BRUO2      --KKVVLAYSGGLDTSIILKWLQTELGAEVVTFTADLGQG-EELEPARKKAEMLGIKEIFIEDVREEFVR
ASSY_BRUME      --KKVVLAYSGGLDTSIILKWLQTELGAEVVTFTADLGQG-EELEPARKKAEMLGIKEIFIEDVREEFVR
ASSY_BRUMB      --KKVVLAYSGGLDTSIILKWLQTELGAEVVTFTADLGQG-EELEPARKKAEMLGIKEIFIEDVREEFVR
ASSY_BRUC2      --KKVVLAYSGGLDTSIILKWLQTELGAEVVTFTADLGQG-EELEPARKKAEMLGIKEIFIEDVREEFVR
ASSY_BRUAB      --KKVVLAYSGGLDTSIILKWLQTELGAEVVTFTADLGQG-EELEPARKKAEMLGIKEIFIEDVREEFVR
ASSY_BRUA2      --KKVVLAYSGGLDTSIILKWLQTELGAEVVTFTADLGQG-EELEPARKKAEMLGIKEIFIEDVREEFVR
ASSY_BRUA1      --KKVVLAYSGGLDTSIILKWLQTELGAEVVTFTADLGQG-EELEPARKKAEMLGIKEIFIEDVREEFVR
ASSY_RHOS5      --KKVVLAYSGGLDTSIILKWLQTEYGCEVVTFTADLGQG-EELEPAREKAVMLGIKNIFIEDVREEFVR
ASSY_PHOPR      ---KVVLAYSGGLDTSAIIPWLKENYDCEVVAFVADVGQGAAELEGIEEKAIASGASSCYIADLKEEMVA
ASSY_METFK      ---KVVLAYSGGLDTSVILKWLQDTYQCEVVTFTADIGQG-EELEPAREKARQFGVKEIYIDDLREEFVR
ASSY_CLOPH      MKEKVILAYSGGLDTTAIIPWLKENYDYDVVCCCIDVGQGNE-LDGLEERAKLSGATKLYIEHVTDEFVD
ASSY_SINMW      --KKVVLAYSGGLDTSIILKWLQTELGAEVVTFTADLGQG-EELEPARKKAEMLGIKEIYIEDVREEFVK
ASSY_ROSDO      --KKVVLAYSGGLDTSIILKWLQTEYGCEVVTFTADLGQG-EELEPARAKAEMMGASDIYIEDVREEFVR
ASSY_METBA      MAKKVALAYSGGLDTSVCIPILKEKYGYEVVTISVDVGQPEEEIKRADAKAEKISNKHYTI-DAKEEFVK
ASSY_BRUSU      --KKVVLAYSGGLDTSIILKWLQTELGAEVVTFTADLGQG-EELEPARKKAEMLGIKEIFIEDVREEFVR
ASSY1_RHIL3     --EKIVLSYSGGLDTSIILKWLQETYGCEVVTFTADLGQG-EELEPARAKAEMSGVKDIRIVDLREEFVS
ASSY_DANRE      ----VVLAYSGGLDTSCILVWLKEQ-GYDVIAYLANIGQD-EDFDVARKKAEKLGAKKVFIEDLRSEFVQ
ASSY_CHRVO      --KKVVLAYSGGLDTSVILKWLQDEYQCEVVTFTADIGQG-EEVEPARQKAVSLGIKNIFIEDLREEFVR
ASSY_SHEAM      --KKVVLAYSGGLDTSAIIPWLKENDNCEIVAFCADVGQGEEELVGLTEKALASGASECHIVDLKEEFVK
ASSY_BUCBP      --KKVVLAYSGGLDTSAIIPWIKENYSSEVIAFVANVGQNQADLKDIEYKALKSGASQCIIKDLREEFIR
ASSY_SPHAL      --KRVVLAYSGGLDTSVILKWLQVTYGCEVVTFTADLGQG-EELEPARAKAELMGIKHIYIDDLREEFVR
ASSY_SHESH      --KKVVLAYSGGLDTSAIIPWLKETDNCEIIAFCADVGQGDAELEGLHEKAISSGASECYIVDLKEELVA
ASSY_SILPO      --KKVVLAYSGGLDTSIILKWLQTEYGCEVVTFTADLGQG-EELEPARKKAELLGIKNIHIEDVREEFVR
ASSY_SHEPW      --KKVVLAYSGGLDTSAIIPWLKETDNCEIVAFCADVGQGSEELEGLHEKAIASGASECYIVDLKEELVA
ASSY_CAUCR      --KKVVLAYSGGLDTSIILKWLQTEYGAEVITFTADLGQG-EEIEPARAKALAAGVKNIFIEDVREEFVR
ASSY_CAUCN      --KKVVLAYSGGLDTSIILKWLQTEYGAEVITFTADLGQG-EEIEPARAKALAAGVKNIFIEDVREEFVR
ASSY_AZOC5      --KKVVLAYSGGLDTSVILKWLQTTYRCEVVTFTADLGQG-EELEPARKKAELLGIKNIFIEDVREEFVR
ASSY_SERP5      --KKIVLAYSGGLDTSAIIPWLKENYGGEVVAFVADIGQERSDLEGVEQKALQSGASECHVVDLREEFIR
ASSY_BUCAT      ---KVVLAYSGGLDTSAIIPWLKENYNFEVVAFVADIGQSKKDLNGIEKKSLESGASSCHVFDLKEEFIE
ASSY_BUCAI      ---KVVLAYSGGLDTSAIIPWLKENYNFEVVAFVADIGQSKKDLNGIEKKSLESGASSCHVFDLKEEFIE
ASSY_BUCA5      ---KVVLAYSGGLDTSAIIPWLKENYNFEVVAFVADIGQSKKDLNGIEKKSLESGASSCHVFDLKEEFIE
ASSY_ERWT9      --KKIVLAYSGGLDTSAIIPWLKENYGGEVVAFVADIGQERGDLEGVEQKALQSGASECHVVDLREEFIS
ASSY_SHEPA      ---KVVLAYSGGLDTSAIIPWLKETDNCEIVAFCADVGQGDAELEGLYEKAIASGASECYIVDLKEELVA
ASSY_SHEFN      --KKVVLAYSGGLDTSAIIPWLKETDDCEIIAFCADVGQGEEELVGLTEKALASGASECHIVDLKEEFVA
ASSY_SHEHH      --KKVVLAYSGGLDTSAIIPWLKETDDCEIIAFCADVGQGDAELEGLYEKAIASGASECHIVDLKEELVA
ASSY_MORPR      -------AYSGGLDTSVILPWLQENDNCEIVAFVADVGQGAEELEGIEAKALASGASECYVVDLKDELVE
ASSY_LAWIP      --KKVVLAYSGGLDTSVILKWLIATYNCEVIAVTADLGQN-ENFHDIEEKAIVTGASKAYVVDLRNEFAK
ASSY_SHEWM      --KKVVLAYSGGLDTSAIIPWLKETDDCEIVAFCADVGQGEAELEGLHEKAIASGASECYIVDLKEELVA
ASSY_SHEPC      --KKVVLAYSGGLDTSAIIPWLKENDNCEIIAFCADVGQGEEELVGLTEKALASGASECHIVDLKEEFVK
ASSY_BARBK      --KKVVLAYSGGLDTSIILKWLQSELGAEVVTFTADLGQG-EELESARRKAEIMGIKEIYIEDLREEFVR
ASSY_SHEB8      --KKVVLAYSGGLDTSAIIPWLKENDNCEIIAFCADVGQGEEELVGLTEKALASGASECHIVDLKEEFVK
ASSY_SHEB5      --KKVVLAYSGGLDTSAIIPWLKENDNCEIIAFCADVGQGEEELVGLTEKALASGASECHIVDLKEEFVK
ASSY_SHEB2      --KKVVLAYSGGLDTSAIIPWLKENDNCEIIAFCADVGQGEEELVGLTEKALASGASECHIVDLKEEFVK
ASSY_LARHH      --KKVVLAYSGGLDTSVILKWLQDTYQCEVVTFTADIGQG-EEVEPARKKALALGIKNIFIDDLREEFVR
ASSY_SHEON      --KKVVLAYSGGLDTSAIIPWLKENDNCEIIAFCADVGQGEEELIGLTEKALASGASECHIVDLKEEFVK
ASSY_SPHWW      --KRVVLAFSGGLDTSVILKWLQQTYQCEVVTFTADLGQG-EELEPARAKAKLMGVPDEFIDDLREEFVK
ASSY_SHESW      --KKVVLAYSGGLDTSAIIPWLKENDNCEIIAFCADVGQGEEELVGLTEKALASGASECHIVDLKEEFVK
ASSY_SHESR      --KKVVLAYSGGLDTSAIIPWLKETDNCEIIAFCADVGQGEEELVGLTEKALASGASECHIVDLKEEFVK
ASSY_SHESM      --KKVVLAYSGGLDTSAIIPWLKETDNCEIIAFCADVGQGEEELVGLTEKALASGASECHIVDLKEEFVK
ASSY_SHESA      --KKVVLAYSGGLDTSAIIPWLKETDNCEIIAFCADVGQGEEELVGLTEKALASGASECHIVDLKEEFVK
ASSY_ARCFU      ---KVVLSYSGGLDTTVCIPLLKEKYGFEVITVTVDIGQPEADIKQAEERGKKYADKHYTI-DAKKEFV-
ASSY_SHEB9      --KKVVLAYSGGLDTSAIIPWLKENDNCEIIAFCADVGQGEEELVGLTEKALASGASECHIVDLKEEFVK
ASSY_PSEHT      --KKVVLAYSGGLDTSAIVPWLKENYGCEVIAFVADVGQGAEELEGVEAKAIASGASECYVVDLKDEMVS
ASSY_PICTO      --EKALLLYSGGLDTSVMVRWIKEKMNMDVVTLTLDIGNS--DLEEIKEKALKLGAIDAITLDVKKEFAD
ASSY_DECAR      --KKVVLAYSGGLDTSVILKWLQDVYKCEVVTFTADLGQG-EELEPARAKALKAGIKNIYIDDVREEFVR
ASSY_PSYIN      --KKVVLAYSGGLDTSAIIPWLKETDDCEIIAFCADVGQGAEELVGLEEKALASGASECHIVDLKEEFVK
ASSY_METMA      MVKKVALAYSGGLDTSVCIPILKEKYGYEVITISVDVGQPEEEIRKADAKAQKISNKHYTI-DAKEEFVR
ASSY_METKA      ---RVVLAYSGGLDTSVCIELLRERYGYEVITVTADVGQPXXXXXXXXXXXXXX-ADEHFTVDCVDEFVC
ASSY_BUCAP      --KKVVLAYSGGLDTSAIIPWLKENYHVDVVAFVADIGQSKKDLNGIEKKALQSGAIDCRVFDLKEEFIK
ASSY_AZOSB      --KKVVLAYSGGLDTSVILKWLQDTYQCEVVTFTADLGQG-EELEPARQKALKFGIKNIFIDDLREEFVR
ASSY_SHELP      --KKVVLAYSGGLDTSAIIPWLKETDNCEIVAFCADVGQGEAELEGLHEKAIASGASECYIVDLKEELVA
ASSY_NOVAD      --KKVVLAYSGGLDTSVILKWLQVTYNCEVVTFTADLGQG-EELEPARAKAKLMGVPDIYIDDLREEFVR
ASSY_BART1      ---KVVLAYSGGLDTSIILKWLQSTLDAEVVTFTADLGQG-EELELARRKAEMLGVKEIYIEDLREEFVR
ASSY_AZOSE      --KKAVLAYSGGLDTSVILKWLQDTYQCEVVTFTADLGQG-EELEPARQKALKFGIKNIFIDDLREEFVR
ASSY_HYPNA      --KKVVLAYSGGLDTSIILKWLQVEFGCEVVTFTADLGQG-EELEPARKKALAAGVKNIFIEDVREEFVR
ASSY_EHRCJ      --KKIVLAYSGGLDTSVILKWLQENYNCEVVVFTADLGQD-DDMSVIRQKATALNVKEIFIEDLKEEFVK
ASSY_CAUSK      --KKVVLAYSGGLDTSIILKWLQTEYGAEVVTFTADLGQG-EEIEPARAKALAAGVKNIFIEDVREEFVR
ASSY_THELT      --KKVILAYSGGLDTSVILKWLSEK-GFEVIAFVANLGQK-EDFKAIECKALSTGASKVYVEDLRREFVT
ASSY_EHRCR      --KKIVLAYSGGLDTSVILKWLQENYNCEVVVFTADLGQN-DDMSAIRQKAAASNVKEIFIEDLKEEFVK
ASSY_SHEDO      ------LAYSGGLDTSAIIPWLKETDDCEIVAFCADVGQGEEELVGLTEKALASGASECHIVDLKEEFVK
ASSY_NATPD      ---RVALAFSGGLDTTVCVPLLEEEYGYEVIGVTVDVGQPXXXXXXXXXXXXXLD-LEHHVVDAKPEFA-
ASSY_METST      --EKVVLAFSGGLDTSVCVKLLQEKYNMEVITACVDVGQPEDEIKKPEAAAQKIGSDKHYTIDAKDEFAK
ASSY_XENTR      ----VVLAYSGGLDTSCILVWLKEQ-GYDVIAYLANIGQN-EDFEAARKKAVNLGAKKVYIEDMRQQFVE
ASSY_THEAC      --DKALLLYSGGLDTSVMIKWIQENLSMDVATLTLNVGNS--DLVAIEEKARMLGADPVFVHDAKDEFAE
ASSY_PHOLL      --KKIVLAYSGGLDTSAIIPWLKEHYGCEVVAFVADVGQSREDLEGVEQKALRSGASECHVVDLREEFIK
ASSY_AEDAE      --EKILLAYSGGLDTSCILKWLLEK-GYEVICFMADVGQE-EDFVAAREKALRVGAKDVIIKDMKRIFVE
ASSY_CHICK      --DTVVLAYSGGLDTSCILVWLKEQ-GYTVIAFLANIGQT-EDFDXXXXXXXXXXXXXVYIQDVCREFVE
ASSY_EDWI9      ---KIVLAYSGGLDTSAIIPWLKENYGCEVIAFVADIGQEREDLVGIEQKALRSGAASCYVVDLRETFIK
ASSY_XENLA      ----VVLAYSGGLDTSCILVWLKEQ-GFDVIAYLANIGQN-EDFEEARKKAVNLGAKKVYIEDIRQQFVE
ASSY_EHRRW      --KKIVLAYSGGLDTSVILKWLQENYNCEVVVFTADIGQE-DDMSVIQKKAAALNVKEIFIEDLKEEFVR
ASSY_MORAB      --KKVVVAYSGGLDTSVILPWLQENDNCEIVALFVDVGQGAEELEGIEAKALASGASECYVVDLKDELVE
ASSY_CAMLR      --KKVVLAYSGGLDTSIILKWLQDEYKSEVVTFTADIGQG-EELEPARKKALSLGVKEEFIKDLKDEFVK
ASSY_THEVO      --KELLLLYSGGLDTSVMIKWMNENLGYDVSTLTLDIGNN--DLKSIREKAEAIGAVETFVEDVKQEFSY
ASSY_EHRRG      --KKIVLAYSGGLDTSVILKWLQENYNCEVVVFTADIGQE-DDMSVIQKKAAALNVKEIFIEDLKEEFVR
ASSY_MOUSE      ----VVLAYSGGLDTSCILVWLKEQ-GYDVIAYLANIGQK-EDFEEARXXXXXXXXXXVFIEDVSKEFVE
ASSY_DROME      --ETVILAYSGGLDTSCVLKWLLDKQ-YEVICVLADVGQK-EDFTAAEKKALKIGAKKVIVADVKQSFVE
ASSY_HUMAN      ----VVLAYSGGLDTSCILVWLKEQ-GYDVIAYLANIGQK-EDFEEARXXXXXXXXXXVFIEDVSREFVE
ASSY_PELUB      --KKIVLAYSGGLDTSIILKWLQENYDAEVICYTADVGQEIDRKKIIKN-AKRLGVKNIIIEDLKDTFVK
ASSY_BOVIN      ----VVLAYSGGLDTSCILVWLKEQ-GYDVIAYLANIGQK-EDFEEARXXXXXXXXXXVFIEDISKEFVE
ASSY_RAT        ----VVLAYSGGLDTSCILVWLKEQ-GYDVIAYLANIGQK-EDFEEARXXXXXXXXXXVFIEDVSKEFVE
ASSY_HALWD      ---RVALAFSGGLDTTVCVSLLKEEYGYEVIGVTVDVGQPATEFEEAQATADAHG-IDLHVVDATAEFV-
ASSY_ANOGA      --EKVLLAYSGGLDTSCILKWLLEQD-YEVICFMADVGQT-EDFAAAREKALKIGAAXXXXXXXXXXXXX
ASSY_SCHPO      --KRCVLAYSGGLDTSCILAWLIEE-GWEVICYMANVGQE-EDWDAAREKALKVGAKKVYVEDLREEFIN
ASSY_HALSA      ----VALAFSGGLDTTVCVPLLKEEYGYDVIGVTVDVGQPDXXXXXXXXXXXXLG-VEHHVVDATAEFAA
ASSY_BURPS      --KHILLAYSGGLDTSTALHFLKRHFDCRVTAYCANLGQK-EDWERMKRRAAIAGADELVIEDLRETFIG
ASSY_YEAST      ---KVCLAYSGGLDTSVILAWLLDQ-GYEVVAFMANVGQE-EDFDAAKEKALKIGACKFVCVDCREDFVK
ASSY_BUCCC      MKKTIVLAYSGGLDTSAIIPWIKDNYNFDVVAFVADIGQSKKDLYKIKEKAIISGASDCYISDLKDIFVK
ASSY_CARRP      --EKIVLAYSGGLDTSVIVKWLQNELNFEVITFTADLGQG-EEXXXXXXXXXXXXXXXXFVKNLKKEFIK
ASSY_XANCP      ----IVLAFSGGLDTSFCIPYLQERGYAVHTVFADTGGVDAEERDFIEKRAAELGAASHVTVDGGPAIWE
ASSY_XANAC      -TKDIVLAFSGGLDTSFCIPYLQERGYAVHTVFADTGGVDAEEREFIEKRAAELGAASHVTVDGGPAIWE
ASSY_XYLFT      --KNIVLAFSGGLDTSFCIPYLKEQ-GYAVHTVFADTGGVDEDRDFIEKRAAELGVASHLTVDGGPAIWD
ASSY_XYLFA      --KNIVLAFSGGLDTSFCIPYLKEQGYAVHTVFADTGGVNEEERDFIEKRAAELGVASHLTVDGGPAIWD
ASSY_DIAST      --QKVGIAFSGGLDTSAALRWMKNK-GALPYAYTANLGQPDEDYDEIPRKAMEYGAEKARLIDCRTQLAH
ASSY_ACISJ      --QKVGIAFSGGLDTSAALRWMKNK-GALPYAYTANLGQPDEDYDEIPRKAMEYGAEKARLIDCRTQLAH
ASSY_SACEN      --QRVGIAFSGGLDTSVAVAWM-RENGAVPCTYTADIGQYDEDIASIPGRAEAYGAEISRLVDCREALVE
ASSY_LEIXX      --ERVGIAFSGGLDTSCAVAWMREK-GAVPCAYTADIGQYDENIEEVPGRATEYGAEIARLVDAKRALVE
ASSY_RALSO      --QKVGIAFSGGLDTSAALRWMKNK-GALPYAYTANLGQPDEDYDAIPRKALEYGAEKARLIDCRPQLAN
ASSY_HAEIE      --QKVGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYNAIPKKAMAYGAENARLIDCRSQLAH
ASSY_HAEI8      --QKVGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYNAIPKKAMAYGAENARLIDCRSQLAH
ASSY_BRASO      --EKVGIAFSGGLDTSAALLWMKQK-GARCFAYTANLGQPDEDYDEIPRKAMSFGAEKARLVDCRTQLVH
ASSY_BORPD      --QKVGIAFSGGLDTSAALLWMRNK-GAIPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRAQLVA
ASSY_RALPJ      --QKVGIAFSGGLDTSAALRWMKNK-GALPYAYTANLGQPDEDYDAIPRKAMEYGAEKARLIDCRPQLAN
ASSY_HAEIN      --QKVGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYNAIPKKAMAYGAENARLIDCRAQLAH
ASSY_HAEIG      --QKVGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYNAIPKKAMAYGAENARLIDCRAQLAH
ASSY_BORPA      --QKVGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDEIPRRAMQYGAEAARLVDCRAQLVA
ASSY_BORBR      --QKVGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDEIPRRAMQYGAEAARLVDCRAQLVA
ASSY_BORPE      --QKVGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDEIPRRAMQYGAEAARLVDCRAQLVA
ASSY_RHOPS      --ENVGIAFSGGLDTSAALLWMKQK-GARVFAYTANLGQPDEDYDEIPRKAMEFGAEKARLVDCRSQLVH
ASSY_BRAJA      --EKVGIAFSGGLDTSAALLWMKQK-GARCYAYTANLGQPDEDYNEIPRKAQEFGAEKAVLVDCRTQLVH
ASSY_RHOP5      --ENVGIAFSGGLDTSAALLWMKQK-GARVFAYTANLGQPDEDYDEIPRKAMEFGAEKARLVDCRSQLVH
ASSY_PECCP      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYEEIPRRAMEYGAENARLIDCRKQLVA
ASSY_ACIAC      --QKVGIAFSGGLDTSAALRWMKNK-GALPYAYTANLGQPDEDYDAIPRKAMEYGAEKARLIDCRTQLAH
ASSY_RHOPT      --ENVGIAFSGGLDTSAALLWMKQK-GAKVFAYTANLGQPDEDYDAIPRKAMEFGAEKARLVDCRTQLVH
ASSY_RHOPA      --ENVGIAFSGGLDTSAALLWMKQK-GAKVFAYTANLGQPDEDYDAIPRKAMEFGAEKARLVDCRTQLVH
ASSY_VARPS      --QKVGIAFSGGLDTSAALHWMKLK-GAIPYAYTANLGQPDEDYDEIPRKAMLYGAENARLIDCRAQLAN
ASSY_RHOPB      --ENVGIAFSGGLDTSAALLWMKQK-GARVFAYTANLGQPDEDYDEIPRKAMEFGAEKARLVDCRSQLVH
ASSY_ENT38      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_STRCO      --ERVGIAFSGGLDTSVAVAWMRDK-GAVPCTYTADIGQYDEDIASVPDRAKTYGAEVARLVDCRAALVE
ASSY_OLICO      --ENVGIAFSGGLDTSAALLWMKQK-GARVFAYTANLGQPDEDYDEIPRKALEFGAEKARLVDCRTQLVH
ASSY_KINRD      --ERVGIAFSGGLDTSVAVAWMREK-GAVPCTYTADIGQYDEDIDSVPGRAGAYGAELARLVDCRAALVE
ASSY_ERWCT      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDEIPRRAMEYGAENARLIDCRKQLVA
ASSY_ACIC5      --QKVGIAFSGGLDTSAALHWMKQK-GALPYAYTANLGQPDEDYEAIPRKALEYGAEIARLIDCREPLVR
ASSY_SHIDS      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_SALAR      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYEAIPRRAMEYGAENARLIDCRKQLVT
ASSY_ECO27      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_GEMAT      --EKVGIAFSGGLDTSAALHWMRAK-GAVPYAYTANLGQPDEDYEEIPRKAMAYGAEKARLVECRSQLVA
ASSY_ECOLC      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_ECOHS      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_CITK8      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_BURS3      --QKVGIAFSGGLDTSAALHWMKLK-GAVPYAYTANLGQPDEDYDAIPKRAIEYGAAGARLIDCRAQLVA
ASSY_BRASB      --EKVGIAFSGGLDTSAALLWMKQK-GARCFAYTANLGQPDEDYDEIPRKAMSFGAEKARLVDCRTQLVH
ASSY_NEIG2      --QKVGIAFSGGLDTSAALLWMKLK-GALPYAYTANLGQPDEDYNAIPKKAMEYGAENARLIDCRAQLAH
ASSY_NEIG1      --QKVGIAFSGGLDTSAALLWMKLK-GALPYAYTANLGQPDEDYNAIPKKAMEYGAENARLIDCRAQLAH
ASSY_MANSM      --QKVGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYNAIPKKAMAYGAENARLIDCRKQLAQ
ASSY_ECOUT      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_ECOK1      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_ECO45      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_YERE8      INQRVGIAFSGGLDTSAALLWM-QKKGAIPYAYTANLGQPDEDYDAIPRKAMEYGAEKARLIDCRKQLVA
ASSY_SHISS      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_SHIFL      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_SHIF8      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_SHIBS      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_SHIB3      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_ECOSM      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_ECOSE      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_ECOLU      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_ECOLI      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_ECOL6      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_ECOL5      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_ECODH      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_ECOBW      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_ECO8A      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_ECO81      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_ECO7I      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_ECO5E      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_ECO57      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_ECO55      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_ECO24      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_BURA4      --QKVGIAFSGGLDTSAALHWMKLK-GAVPYAYTANLGQPDEDYDAIPKRAIEYGAAGARLIDCRAQLVA
ASSY_ACTSZ      --QKVGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYNAIPKKAMAYGAENARLIDCRTQLAQ
ASSY_YERPY      INQRVGIAFSGGLDTSAALLWM-QKKGAIPYAYTANLGQPDEDYEAIPRKAMEYGAEKARLIDCRKQLVA
ASSY_YERPS      INQRVGIAFSGGLDTSAALLWM-QKKGAIPYAYTANLGQPDEDYEAIPRKAMEYGAEKARLIDCRKQLVA
ASSY_YERPP      INQRVGIAFSGGLDTSAALLWM-QKKGAIPYAYTANLGQPDEDYEAIPRKAMEYGAEKARLIDCRKQLVA
ASSY_YERPN      INQRVGIAFSGGLDTSAALLWM-QKKGAIPYAYTANLGQPDEDYEAIPRKAMEYGAEKARLIDCRKQLVA
ASSY_YERPG      INQRVGIAFSGGLDTSAALLWM-QKKGAIPYAYTANLGQPDEDYEAIPRKAMEYGAEKARLIDCRKQLVA
ASSY_YERPE      INQRVGIAFSGGLDTSAALLWM-QKKGAIPYAYTANLGQPDEDYEAIPRKAMEYGAEKARLIDCRKQLVA
ASSY_YERPB      INQRVGIAFSGGLDTSAALLWM-QKKGAIPYAYTANLGQPDEDYEAIPRKAMEYGAEKARLIDCRKQLVA
ASSY_YERP3      INQRVGIAFSGGLDTSAALLWM-QKKGAIPYAYTANLGQPDEDYEAIPRKAMEYGAEKARLIDCRKQLVA
ASSY_STRLA      --ERVGIAFSGGLDTSVAVAWMRDK-GAVPCTYTADIGQYDEDIASVPSRASAYGAEITRLVDCRXXXXX
ASSY_NEIMA      --QKVGIAFSGGLDTSAALLWMKLK-GALPYAYTANLGQPDEDYNAIPKKAMEYGAENARLIDCRAQLAH
ASSY_ESCF3      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_BURCM      --QKVGIAFSGGLDTSAALHWMKLK-GAVPYAYTANLGQPDEDYDAIPKRAIEYGAAGARLIDCRAQLVA
ASSY_PASMU      --QKVGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYNAIPRKAMEYGAENARLIDCRAQLAH
ASSY_KLEP7      --QRIGIAFSGGLDTSAALLWMRKK-GAVPYAYTANLGQPDEDYDAIPRRAKEYGAEGARLIDCRKQLVA
ASSY_KLEP3      --QRIGIAFSGGLDTSAALLWMRKK-GAVPYAYTANLGQPDEDYDAIPRRAKEYGAEGARLIDCRKQLVA
ASSY_SALTI      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_SALNS      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_SALEP      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_SALA4      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_BURM1      --QKVGIAFSGGLDTSAALHWMKLK-GAVPYAYTANLGQPDEDYDAIPKRALEYGAAGARLIDCRAQLVA
ASSY_HAES2      --QKVGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYNAIPRKAMEYGAEKARLIDCRNQLAH
ASSY_HAES1      --QKVGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYNAIPRKAMEYGAEKARLIDCRNQLAH
ASSY_BURCJ      --QKVGIAFSGGLDTSAALHWMKLK-GAVPYAYTANLGQPDEDYDAIPKRAIEYGAAGARLIDCRAQLVA
ASSY_SALPB      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_SALDC      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_BURCH      --QKVGIAFSGGLDTSAALHWMKLK-GAVPYAYTANLGQPDEDYDAIPKRAIEYGAAGARLIDCRAQLVA
ASSY_BURCC      --QKVGIAFSGGLDTSAALHWMKLK-GAVPYAYTANLGQPDEDYDAIPKRAIEYGAAGARLIDCRAQLVA
ASSY_BURCA      --QKVGIAFSGGLDTSAALHWMKLK-GAVPYAYTANLGQPDEDYDAIPKRAIEYGAAGARLIDCRAQLVA
ASSY_SALHS      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_BURVG      --QKVGIAFSGGLDTSAALHWMKLK-GAVPYAYTANLGQPDEDYDAIPKRAIEYGAAGARLIDCRAQLVA
ASSY_DELAS      --QKVGIAFSGGLDTSAALRWMKNK-GALPYAYTANLGQPDEDYDEIPRKAMEYGAEQARLIDCRSQLXX
ASSY_SALTY      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_SALSV      --QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDYDAIPRRAMEYGAENARLIDCRKQLVA
ASSY_BURP8      --QKVGIAFSGGLDTSAALHWMRLK-GAVPYAYTANLGQPDEDYDSIPRRATEYGAEGARLIDCRAQLVA
ASSY_JANMA      VNQKVGIAFSGGLDTSAALHWMRQK-GAIPYAYTANLGQPDEDYNAIPEKAKAYGAELARLIDCREQLVA
ASSY_BURP6      --QKVGIAFSGGLDTSAALHWMRIK-GAVPYAYTANLGQPDEDYDAIPKRAIQYGAEGARLIDCRAQLVA
ASSY_BURP1      --QKVGIAFSGGLDTSAALHWMRIK-GAVPYAYTANLGQPDEDYDAIPKRAIQYGAEGARLIDCRAQLVA
ASSY_BURP0      --QKVGIAFSGGLDTSAALHWMRIK-GAVPYAYTANLGQPDEDYDAIPKRAIQYGAEGARLIDCRAQLVA
ASSY_BURMS      --QKVGIAFSGGLDTSAALHWMRIK-GAVPYAYTANLGQPDEDYDAIPKRAIQYGAEGARLIDCRAQLVA
ASSY_BURMA      --QKVGIAFSGGLDTSAALHWMRIK-GAVPYAYTANLGQPDEDYDAIPKRAIQYGAEGARLIDCRAQLVA
ASSY_BURM9      --QKVGIAFSGGLDTSAALHWMRIK-GAVPYAYTANLGQPDEDYDAIPKRAIQYGAEGARLIDCRAQLVA
ASSY_BURM7      --QKVGIAFSGGLDTSAALHWMRIK-GAVPYAYTANLGQPDEDYDAIPKRAIQYGAEGARLIDCRAQLVA
ASSY_HERAR      VNQKVGIAFSGGLDTSAALHWMRQK-GAIPYAYTANLGQPDEDYNAIPEKAKAYGAELARLIDCREQLVA
ASSY_BURTA      --QKVGIAFSGGLDTSAALHWMRIK-GAVPYAYTANLGQPDEDYDAIPKRAIQYGAEGARLIDCRAQLVA
ASSY_NOCSJ      --QRVGIAFSGGLDTSVAVAWMRDK-GAIPCTYTADIGQYDEDVSGVPARAREYGAEIARVVDCRAQLVE
ASSY_METPP      --QKVGIAFSGGLDTSAALHWMKLK-GALPYAYTAHLGQPDEDYDEIPRKAMQYGAEKARLIDCRAQLVA
ASSY_SOLUE      --EKVGLAFSGGLDTSAAIHWMRAK-GAIPYSYTANLGQPDEDYDEIPRRALLYGAEKARLIDCRKQLVA
ASSY_NEIMF      --QKVGIAFSGGLDTSAALLWMKLK-GALPYAYTANLGQPDEDYNAIPKKAMEYGAENARLIDCRAQLAH
ASSY_NEIMB      --QKVGIAFSGGLDTSAALLWMKLK-GALPYAYTANLGQPDEDYNAIPKKAMEYGAENARLIDCRAQLAH
ASSY_NEIM0      --QKVGIAFSGGLDTSAALLWMKLK-GALPYAYTANLGQPDEDYNAIPKKAMEYGAENARLIDCRAQLAH
ASSY_POLSJ      --QKVGIAFSGGLDTSAALHWMKLK-GALPYAYTANLGQPDEDYDEIPRKALQYGAEKARLIDCRSQLAA
ASSY_POLNA      --QKVGIAFSGGLDTSAALHWMKLK-GAIPYAYTANLGQPDEDYEDIPRKAMQYGAEQARLIDCRSXXXX
ASSY_ERWCH      ----------------------------------------------------------------------
GUAA_GEOSL      --ERVILGLSGGVDSSVAAALIHRAIGDQLTCVFVDNGEGDQVMATFAENL----GVKVIRVDAEQRF--
GUAA_PELPD      -SERVILGLSGGVDSSVAAALIHRAIGDQLTCVFVDNGRLEEGDQVMRTFAENLG-VKVIRVNAEERF--
GUAA_PELCD      -SERVILGLSGGVDSSVAAALIQRAIGDQLVCVFVDNGRLDEGDQVMRTFAQNMG-VNVIRVNAQDRF--
GUAA_GEOSF      -SDRVILGLSGGVDSSVAAALIHRAIGEQLTCVFVDNGRLGEGDQVMATFAQNLG-VKVIRVDAEDRFVS
GUAA_GEOMG      --DRVILGLSGGVDSSVAAALIHRAIGDQLTCVFVDNGEGDQVMATFAENL----GVKVIRVDAEDRFES
GUAAB_METB6     --EKVVMALSGGVDSSVCASLAARAIGDRLIPIYIDTGRKGETERI----KAVFGNIRLQVVDAGDEF--
GUAA_PSEFS      -TDNVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGEGEQVMAMFAENM----GVKVIRANAEDQFLN
GUAA_COXBR      --EQVIVGLSGGVDSAVTATLVHKAIGDQLVCVLVDTGRLNEVDEVLNVFQKHLGA-KVICVDAKDRFLK
GUAA_PSEU2      -TDNVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGEGEQVMAMFAENM----GVKVIRANAEEQFLN
GUAA_PSEF5      -TDNVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGEGEQVMAMFAENM----GVKVIRANAEEQFLN
GUAA_PSE14      -TDNVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGEGEQVMAMFAENM----GVKVIRANAEEQFLN
GUAA_PSESM      -TDSVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGEGEQVMAMFAENM----GVKVIRANAEEQFLN
GUAA_AZOSB      --EEVILGLSGGVDSSVAAALIHRAIGDQLTCVFVDNGEGAQVMETFNRSL----GVKVIHVDATEQFMG
GUAA_PSEPF      -TDNVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGEGEQVMAMFAENM----GVKVIRANAEDQFLN
GUAA_CHLCV      -TERVLLGLSGGVDSSVLAVLLHNALGDRLSCVFVDTGLRKNEVEEVKQQFSSLG-LEILVVDASEKFFH
MNMA_BEII9      ---RVVVAMSGGVDSSVVAALLKRE-GYEVIGVTLDHGEAGQDIQDARQVADQLG-IPHYVLDYEERFRR
GUAA_CALS8      --QKVVCALSGGVDSSVAAVLVHKAIGKNLFCIFVDHGRKGEAEEVIK-TFKGQFDMNVIKVDAKERFLK
GUAA_METPP      --EEVILGLSGGVDSSVAAALIHRAIGDRLTCVFVDHGEGDMVMEMFAGKLHA----KVVRVDAAELFMN
GUAA_POLNS      --EEVILGLSGGVDSSVAAALIHRAIGDQLTCVFVDHGEGDMVMEMFARNL----GVKVIRVDAKETFMG
GUAAB_METMJ     --DKVVMALSGGVDSSVCAALATRAIGDQLVPIYVDTGLMRKG-ETDRIRSLFADANLRVV-DAADEF--
MNMA_MESSB      ---RVVVAMSGGVDSSVVAGLLARE-GYEVVGVTLDHGAAGQDIDDARRVAETLGIAHYVL-DYEERFRK
GUAA_METCA      --ERVVLGLSGGVDSSVVAALLQHAIGEQLTCVFVDTGEGDQVMATFAEHM----GVRVIRVNAEERF--
GUAA_CHLMU      -TERVLLGLSGGVDSSVLAVLLHNALGDRLSCVFVDTGLRKNEVEEVKQQFSSLG-LEILVVDASEKFFH
GUAA_RHOSK      --QKVICGLSGGVDSSVAAVLIHEAIGDQLTCVFVDHG------------LLRLGEAEQVV----KMFRD
GUAA_RHOS4      --QKVICGLSGGVDSSVAAVLIHEAIGDQLTCVFVDHG------------LLRLGEAEQVV----KMFRD
GUAA_DEIRA      -TGRVLLGISGGVDSSTLALLLAKAVGERLTAVFIDHGRLGEREQV--EAALTPLGVNLVTVDAKDEFLG
GUAA_CELJU      -TDKVLLGLSGGVDSSVVAALLHRAIGDQLTCVFVDNGEGDQVMDMFAKNM----GVRVIRADAEQLFVS
QUEC_PELPD      MEKRAVVLYSGGLDSTTCLA-MAKADGFAPYAMSFSYGQHGFELEVAKANARPLGAVEHLVVD-------
GUAA_RHOS5      --QKVICGLSGGVDSSVAAVLIHEAIGDQLTCVFVDHG------------LLRLGEAEQVVT----MFRD
GUAA_RHOS1      --QKVICGLSGGVDSSVAAVLIHEAIGDQLTCVFVDHG------------LLRLGEAEQVVT----MFRD
GUAA_PSEHT      --DEVILGLSGGVDSSVVAMLIHRAIGEKLTCVFVDNGEGQQVMDMFGNKF----GLNIVKVEAEEQFLN
QUEC_GEOSL      MTRKAVVLYSGGLDSTTCLA-IARAEGFEPHAMSFSYGQHSVELELAKRNARPAGAVEHMVVE-------
MNMA_NATTJ      MSNRVLVAMSGGVDSSVA-ALMLKEQGYEVIGAHMRIWYREEDEELYEQNVKGCCSL-AAVHDAK-----
GUAA_MICLC      --KRAICGLSGGVDSAVAAALVQRAIGDRLTCVYVDHGREGESAEIEQAFGEAHGGARLVMVDAREDF--
GUAA_ALCBS      -TDEVILGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGEGDQVMEMFADNM----GVKVIRVDAEDNFLG
MNMA_ERYLH      ---RIVVAMSGGVDSSV-VAALAHASGAEVIGITLDYGAAGDDIQDARAVADRLGIAHYVFEDVVEQFAD
GUAA_RHILO      ---KVICALSGGVDSSVAALLIHEAVGDQLTCILVDHGLMRKDVAMFRQHY----NLPLILVDASEKF--
GUAA_PHEZH      ---RIICGLSGGVDSSVAAVLIHEAIGDQLTCVFVDHGEAEQVVTMFRDHY----NIPLVHVDAAEEF--
GUAA_CHLFF      --ERVLLGLSGGVDSSVLAVLLHNALGDRLSCVFVDTGLRKNEVEEVKQQFLSLG-LEIIVEDASETF--
QUEC_METKA      MATTVVLC-SGGLDSSVIAKWAVEELGGRVICLFVDYGQ-------------------------------
GUAA_PSEP1      ----VLLGLSGGVDSSVVAALLHRAIGDQLTCVFVDNGEGDQVMAMFKENM----GVKVIRADAEKQFLD
MNMA2_CLOBK     MKKKVLVGMSGGVDSSVA-AYLLKEQGYEVIGVTMQIWQ--DDEEFIEKEGGCCSL--SAVADAR-RVAN
MNMA1_CLOBM     MKKKVLVGMSGGVDSSVA-AYLLKEQGYEVIGVTMQIWQ--DDEEFIEKEGGCCSL--SAVADAR-RVAN
MNMA1_CLOBL     MKKKVLVGMSGGVDSSVA-AYLLKEQGYEVIGVTMQIWQ--DDEEFIEKEGGCCSL--SAVADAR-RVAN
MNMA1_CLOBH     MKKKVLVGMSGGVDSSVA-AYLLKEQGYEVIGVTMQIWQ--DDEEFIEKEGGCCSL--SAVADAR-RVAN
MNMA1_CLOB1     MKKKVLVGMSGGVDSSVA-AYLLKEQGYEVIGVTMQIWQ--DDEEFIEKEGGCCSL--SAVADAR-RVAN
GUAA_SYNWW      --KRVLCALSGGVDSSVAATLVHQAVGEQLVCVFVDNGRKGEASQVIDTFAKEM-KMNLVFVDARERF--
GUAA_PSEPG      ----VLLGLSGGVDSSVVAALLHRAIGDQLTCVFVDNGEGDQVMAMFKENM----GVKVIRADAEKQFLD
GUAA_NITSB      --DKVLCALSGGVDSSVVTALLYEAIGDKLIPVFVDNGEGREKVEYVFKNML---KVPLIVVDAKERFLN
QUEC_RALEJ      MTKRAIVLLSGGLDSATVLA-MAKAQGFETYALSMRYGQHSSELDAAKQVASALGAVRHEIVD-------
QUEC_GEOBB      MQKKAVILYSGGLDSTTCLA-IAKEQGFAPYALSFSYGQHQQELEVAKLNARPMGAVDHLLVE-------
GUAA_THICR      -SDEVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDHGEGDQVMSMFAENM----GIKVIRVDAEDYFMN
GUAA_PSEPW      ----VLLGLSGGVDSSVVAALLHRAIGDQLTCVFVDNGEGDQVMAMFKENM----GVKVIRADAEKQFLD
GUAA_PSEPK      ----VLLGLSGGVDSSVVAALLHRAIGDQLTCVFVDNGEGDQVMAMFKENM----GVKVIRADAEKQFLD
GUAA_PSEE4      ----VLLGLSGGVDSSVVAALLHRAIGDQLTCVFVDNGEGDQVMAMFKENM----GVKVIRADAEKQFLD
GUAA_DECAR      --EEVILGLSGGVDSSVAAALIHKAIGDQLTCVFVDHGEGDMVMEMFARNL----GVKVIRVDAVDDFMG
GUAA_CARHZ      --EKVVCALSGGVDSSVAAVLVHKAIGDNLTCIFVDHGRKGEAEEVVRTFKEQF-QMNLVFVDAKEQF--
GUAA_TOLAT      -TDEVILGLSGGVDSSVVAMLIHRAVGKQLTCVFVDNGEGQQVMEMFGDHF----GLNIIKVDAEERFLS
GUAA_HAHCH      --DKVLLGLSGGVDSSVVAALLHRAIGDQLTCVFVDNGEGDQVMDMFAKNM----GIKVVRANAQDQFEN
GUAA_DEIDV      ---RVLLGISGGVDSSTLALLLARAVGERLTAVFIDHGRLGEREQV--EAALRPLGVNLVTVDAREEF--
GUAA_CLOBJ      --KKVICALSGGVDSSVAAVIVHKAIGKQLTCIFVDHGEGDQDMNLIRVNARFLGKLKGVSPERKRKIIG
GUAAB_METPE     ---RVVMALSGGVDSSVCAALAAQAIGERLEPIYVDTGLMRKG-ETDRIRHL-FGHLNLRIVDASDEF--
QUEC_DESAA      --EKAVVLLSGGLDSATAMA-IAKDMGFQVYALSFSYGQHTTELEAAKRVAKTLGAVEHQVAN-------
QUEC1_SPHAL     ----VIVLLSGGLDSMVCAG-LAREAGARIVALTIDYNQRHRELESAARIAAHVGAAEHIV---------
GUAA_CLOBH      --KKVICALSGGVDSSVAAVIVHKAIGKQLTCVFVDHGEGDQDMNLIRVNARFLGKLKGVSPERKRKIIG
GUAA_CLOB1      --KKVICALSGGVDSSVAAVIVHKAIGKQLTCVFVDHGEGDQDMNLIRVNARFLGKLKGVSPERKRKIIG


                         .         .         *         .         .         .         .:140
query           DYCVPAIQANALYMDRYPLVSALSRPLIVKHLAEAARYHGATMVAHGCTGKGNDQVRFEAGLAALFPELK
ASSY_THEFY      DYCVPAIQANALYMDRYPLVSALSRPLIVKHLAEAARYHGATMVAHGCTGKGNDQVRFEAGLAALFPELK
ASSY_SALAI      EYCLPAVRANSLYMDRYPLVSALSRPLIVKHLVAAARTHGGTIVSHGCTGKGNDQVRFEAGLGALAPDLR
ASSY_STRAW      XYCLPAVKANALYMDRYPLVSALSRPTIVKHLVAAAQKHGATTVAHGCTGKGNDQVRFEAGIVALAPGLK
ASSY_STRGG      XYCLPAIKANALYMDRYPLVSALSRPTIVKHLVAAARKHGAGTVAHGCTGKGNDQVRFEAGISALGPDLK
ASSY_STRCL      XYCLPAIKANARYMDRYPLVSALSRPAIVKHLVAAAKKHDASIVAHGCTGKGNDQVRFEAGIQALGPDLK
ASSY_ARTS2      EYCMPTLKANALYQGHYPLVSAISRPVIVKHLVKAAREFGATTVAHGCTGKGNDQVRFEVGIQTLGPDLK
ASSY_ACIC1      DYCVPALRANALYMGRYPLISALSRPLIDKHLVXXXXXXXXXXXXXGSTGKGNDQVRFEVGIGSLDPELR
ASSY_ARTAT      EYAMPTLKANALYQGHYPLVSAISRPVIVKHLVKAAREFGATTVAHGCTGKGNDQVRFEVGIQTLGPDLK
ASSY_ARTCA      EYAMPTLKANALYQGHYPLVSAISRPVIVKHLVKAAREFGATTVAHGCTGKGNDQVRFEVGIQTLGPDLK
ASSY_NOCFA      QYCLPTIQANALYMGQYPLVSAISRPLIVKHLVEAAKFHGADTVAHGCTGKGNDQVRFEVGIGALAPDLN
ASSY_RENSM      EYCMPTLKANALYQGHYPLVSAISRPVIVKHLVKAAREFGATTVAHGCTGKGNDQVRFEVGIQTLGPDLK
ASSY_RHOSR      EYCLPTIQANALYMDRYPLVSAISRPLIVKHLVEAARAHGGTTVAHGCTGKGNDQVRFEVGFGSLAPDLD
ASSY_RHOOB      EYCLPTIQANALYMDRYPLVSAISRPLIVKHLVEAARAHGGTTVAHGCTGKGNDQVRFEVGFGSLAPDLD
ASSY_RHOE4      EYCLPTIAANALYMDRYPLVSAISRPLIVKHIVEAARSHGGTIVSHGCTGKGNDQVRFEVGFGALAPDLQ
ASSY_MYCSS      DYCLPAIQSNALYMDRYPLVSALSRPLIVKHLVDAAREHKGGIVAHGCTGKGNDQVRFEVGFASLAPDLE
ASSY_MYCSK      DYCLPAIQSNALYMDRYPLVSALSRPLIVKHLVDAAREHKGGIVAHGCTGKGNDQVRFEVGFASLAPDLE
ASSY_CORDI      DYCLPTIKANGMYMKQYPLVSAISRPLIVKHLVEAAKKHGGTHVSHGCTGKGNDQVRFEVGFRNLAPELQ
ASSY_FRASN      SFVAPAIRANALYMDRYPLISSLSRPIIVKHLVEAAKQHGADAISHGCTGKGNDQVRFEVGVMALAPGLR
ASSY_CORU7      DYCLPTIKANGLYMKEYPLVSAISRPLIVKHMAEAAKEHNGTAVAHGCTGKGNDQVRFEVGFANTAPELE
ASSY_CORJK      DYCLPTIKANGMYMKEYPLVSAISRPLIVKHMADAAKEHGGTAVAHGCTGKGNDQVRFEVGFANTAPDLE
ASSY_MYCLE      GYCLPTVLNNALYMDRYPLVSAISRPLIVKHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLE
ASSY_FRAAA      SFVAPAIRSNALYMDRYPLISSLSRPIIVKHLVEAAREHGADAIAHGCTGKGNDQVRFEVGVSALAPGLK
ASSY_CORK4      QYCLPAIKANGLYMKQYPLVSALSRPLIVKHLVETAKEHGGTHVAHGCTGKGNDQVRFEVGFADTAPDLK
ASSY_COREF      EYCLPTIKANGMYMKQYPLVSAISRPLIVKHLVQAAKEHGGTHVSHGCTGKGNDQVRFEVGFMDLDPSLE
ASSY_MYCSJ      NYCLPAIQSNALYMDRYPLVSALSRPLIVKHLVDAAREHKGGIVAHGCTGKGNDQVRFEVGFASLAPDLE
ASSY_MYCVP      QYCLPAIKSNALYMDRYPLVSALSRPLIVKHLVDAAREHGGGVVAHGCTGKGNDQVRFEVGFASLAPDLK
ASSY_MYCS2      XYCLPTIQSNALYMDRYPLVSAISRPLIVKHLVKAAREHGGGVVAHGCTGKGNDQVRFEVGFASLAPDLQ
ASSY_MYCA1      GYCLPTIRNNALYMDRYPLVSAISRPLIVKHLVAAAREHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLE
ASSY_KOCRD      EYCMPALQANGLYMDSYPLVSAVSRPVIVKHLVAAAKKFGATTVAHGCTGKGNDQVRFEVGIQTLGPELK
ASSY_MYCGI      QYCLPAIQSNALYMDRYPLVSALSRPLIVKHLVDAAREHGGGIVAHGCTGKGNDQVRFEVGFASLAPDLK
ASSY_MYCPA      GYCLPTIRNNALYMDRYPLVSAISRPLIVKHLVAAAREHGGSTVAHGCTGKGNDQVRFEVGFASLAPDLE
ASSY_MYCMM      GYCLPTILNNALYMDRYPLVSAISRPLIVKHLVEAAREHGGGIVAHGCTGKGNDQVRFEVGFASLAPDLE
ASSY_CLAMS      XYIVPALKANALYQKRYPLVSGLSRPLIAKHLARVAHELGANSVAHGCTGKGNDQVRFEAAVAALAPDLT
ASSY_MYCUA      GYCLPTILNNALYMDRYPLVSAISRPLIVKHLVEAAREHGGGIVAHGCTGKGNDQVRFEVGFASLAPDLE
ASSY_CLAM3      XYIVPALKANALYQKRYPLVSGLSRPLIAKHLARVAHELGANSVAHGCTGKGNDQVRFEAAVAALAPDLT
ASSY_BIFLO      EYCMKALKANAMYEGVYPLVSAISRPLISKHLVRAAHQFGADTISHGCTGKGNDQVRFEVSIASIDPTLK
ASSY_BIFLD      EYCMKALKANAMYEGVYPLVSAISRPLISKHLVRAAHQFGADTISHGCTGKGNDQVRFEVSIASIDPTLK
ASSY_BIFLI      EYCMKALKANAMYEGVYPLVSAISRPLISKHLVRAAHQFGADTISHGCTGKGNDQVRFEVSIASIDPTLK
ASSY_MYCTU      GYCLPTVLNNALYMDRYPLVSAISRPLIVKHLVAAAREHGGGIVAHGCTGKGNDQVRFEVGFASLAPDLE
ASSY_MYCTA      GYCLPTVLNNALYMDRYPLVSAISRPLIVKHLVAAAREHGGGIVAHGCTGKGNDQVRFEVGFASLAPDLE
ASSY_MYCBT      GYCLPTVLNNALYMDRYPLVSAISRPLIVKHLVAAAREHGGGIVAHGCTGKGNDQVRFEVGFASLAPDLE
ASSY_MYCBP      GYCLPTVLNNALYMDRYPLVSAISRPLIVKHLVAAAREHGGGIVAHGCTGKGNDQVRFEVGFASLAPDLE
ASSY_MYCBO      GYCLPTVLNNALYMDRYPLVSAISRPLIVKHLVAAAREHGGGIVAHGCTGKGNDQVRFEVGFASLAPDLE
ASSY_CORGL      EYCLPTIKANGMYMKQYPLVSAISRPLIVKHLVEAGKQFNGTHVAHGCTGKGNDQVRFEVGFMDTDPNLE
ASSY_CORGB      EYCLPTIKANGMYMKQYPLVSAISRPLIVKHLVEAGKQFNGTHVAHGCTGKGNDQVRFEVGFMDTDPNLE
ASSY_FRASC      SFVAPAIKSNALYMDRYPLISSLSRPVIVRHLVAAAREHGADAIAHGCTGKGNDQVRFEVGVAALAPGLS
ASSY_BIFAA      EYCMKALKANAMYEGVYPLVSAISRPLISKHLVRAAHQFGADTISHGCTGKGNDQVRFEVSIASIDPTLK
ASSY_MICLC      QYCMPTLKANALYMDAYPLVSAISRPVISRHLVAAARQFGASTVAHGCTGKGNDQVRFEVSIQTLGPDLK
ASSY_BREBN      EFVLPALKANAMYEGKYPLVSALSRYLISRVLVEIAEKEGAVAVAHGCTGKGNDQVRFDVSFTALNPDIK
ASSY_LACS1      EYVLPALQGHAYYENKYPLVSALSRPLIVKKLVEVAKEHGATAIAHGCTGKGNDQVRFEVGIHALVPEMK
ASSY_RUBXD      DYVAPAIKANALYGGRYPLFTALGRPLIAKKLVEAARRVGATHIAHGSTGKGNDQVRFDVTTGSLAPDLT
ASSY_ACAM1      DYAFPAIQANALYENRYPLSTALARPLIAKLLVEAAEIHGADAVAHGCTGKGNDQVRFDVSITALNPDIK
ASSY_BACLD      EFALTALQAHTLYEGKYPLVSALSRPLIAKKLVEVAEKENAQAVAHGCTGKGNDQVRFEVSIKSLNPDLE
ASSY_GLOVI      DYAFAALQANALYEGRYPLATALARPLIARILVKCAQAVGADAVAHGCTGKGNDQVRFDVSIGALDPKLK
ASSY_BACSU      DYALISLQAHTMYEGKYPLVSALSRPLIAKKLVEIAEKEDAQAIAHGCTGKGNDQVRFEVSIKSLNPDLE
ASSY_TRIEI      EYAFPAIQANALYENRYPLATALARPLIAKILVEAAEKYGADAIAHGCTGKGNDQVRFDVAIAALNPQIK
ASSY_ANAVT      DYAFPAIQANALYENRYPLGTALARPLIAKILVEAAEKYGADAIAHGCTGKGNDQVRFDVSCTALNPKLK
ASSY_ANASP      DYAFPAIQANALYENRYPLGTALARPLIAKILVEAAAKYGADAIAHGCTGKGNDQVRFDVSCTALNPNLK
ASSY_LISMH      DFALIALQAHAYYEGKYPLISALSRPLIAKKLVEVARQEGASAIAHGCTGKGNDQVRFEVAIHALAPDLK
ASSY_LISMF      DFALIALQAHAYYEGKYPLISALSRPLIAKKLVEVARQEGASAIAHGCTGKGNDQVRFEVAIHALAPDLK
ASSY_LISMC      DFALIALQAHAYYEGKYPLISALSRPLIAKKLVEVARQEGASAIAHGCTGKGNDQVRFEVAIHALAPDLK
ASSY_BACCZ      EYALMAMQAHTLYEGKYPLVSALSRPLIAKKLVEIAEQEGATAVAHGCTGKGNDQVRFEVSIQALNPYLE
ASSY_BACC3      EYALMAMQAHTLYEGKYPLVSALSRPLIAKKLVEIAEQEGATAVAHGCTGKGNDQVRFEVSIQALNPYLE
ASSY_BACAH      EYALMAMQAHTLYEGKYPLVSALSRPLIAKKLVEIAEQEGATAVAHGCTGKGNDQVRFEVSIQALNPYLE
ASSY_BACHD      EFVLPALQAHALYEQKYPLVSALSRPLISKKLVEIAEQTGAQAVAHGCTGKGNDQVRFEVSIQALNPNLE
ASSY_BACAN      EYALMAMQAHTLYEGKYPLVSALSRPLIAKKLVEIAEQEGATAVAHGCTGKGNDQVRFEVSIQALNPYLE
ASSY_BACAC      EYALMAMQAHTLYEGKYPLVSALSRPLIAKKLVEIAEQEGATAVAHGCTGKGNDQVRFEVSIQALNPYLE
ASSY_BACAA      EYALMAMQAHTLYEGKYPLVSALSRPLIAKKLVEIAEQEGATAVAHGCTGKGNDQVRFEVSIQALNPYLE
ASSY_ANOFW      EYALIALQAHALYEGKYPLISALSRPLISKKLVEIAELEGAVAVAHGCTGKGNDQVRFEVSIQALNPNLK
ASSY_BACCR      EYALMAMQAHTLYEGKYPLVSALSRPLIAKKLVEIAEQEGATAVAHGCTGKGNDQVRFEVSIQALNPYLE
ASSY_BACC4      EYALMAMQAHTLYEGKYPLVSALSRPLIAKKLVEIAEQEGATAVAHGCTGKGNDQVRFEVSIQALNPYLE
ASSY_BACC1      EYALMAMQAHTLYEGKYPLVSALSRPLIAKKLVEIAEQEGATAVAHGCTGKGNDQVRFEVSIQALNPYLE
ASSY_BACHK      EYALMAMQAHTLYEGKYPLVSALSRPLIAKKLVEIAEQEGATAVAHGCTGKGNDQVRFEVSIQALNPYLE
ASSY_BACC0      EYALMAMQAHTLYEGKYPLVSALSRPLIAKKLVEIAEQEGATAVAHGCTGKGNDQVRFEVSIQALNPYLE
ASSY_BACCQ      EYALMAMQAHTLYEGKYPLVSALSRPLIAKKLVEIAEQEGATAVAHGCTGKGNDQVRFEVSIQALNPYLE
ASSY_BACWK      EYALIAMQAHTLYEGKYPLVSALSRPLIAKKLVEIAEQEGASAVAHGCTGKGNDQVRFEVSIQALNPYLE
ASSY_BACC7      EYALMAMQAHTLYEGKYPLVSALSRPLIAKKLVEIAEQEGATAVAHGCTGKGNDQVRFEVSIQALNPYLE
ASSY_LISMO      DFALIALQAHAYYEGKYPLISALSRPLIAKKLVEVARQEGASAIAHGCTGKGNDQVRFEVAIHALAPDLK
ASSY_MICAN      EYAFPSIQANALYENRYPLSTALARPLIAKLLVEAAEKYGADAVSHGCTGKGNDQVRFDVGIMALNPSLK
ASSY_BACC2      EYALMAMQAHTLYEGKYPLVSALSRPLIAKKLVEIAEQEGATAVAHGCTGKGNDQVRFEVSIQALNPYLE
ASSY_THEEB      NYAFPAIQANALYENRYPLSTALARPLIAKLLVEAATQYGADAVAHGCTGKGNDQVRFDVAIAALNPNLK
ASSY_LISW6      DFALIALQAHAYYEGKYPLISALSRPLIAKKLVEVARQEGASAIAHGCTGKGNDQVRFEVAIHALAPDLK
ASSY_OCEIH      EYVLPALQANLLYEGKYPLISALSRPLISKILVDIXXXXXXXXXXHGCTGKGNDQVRFDVSFTALNPNLK
ASSY_STRU0      AFVLPALQAHAFYEQKYPLVSALSRPLISKKLVDIAHECGATYIAHGCTGKGNDQVRFEIAIAALDPTIE
ASSY_STRSY      EYVLPALQAHAYYEQKYPLVSALSRPLISKKLVEMAHKTGATTIAHGCTGKGNDQVRFEVAIAALDPSLK
ASSY_STRS2      EYVLPALQAHAYYEQKYPLVSALSRPLISKKLVEMAHKTGATTIAHGCTGKGNDQVRFEVAIAALDPSLK
ASSY_NOSP7      DYAFGAIQANALYENRYPLGTALARPLIAKILVETAEKYGADAIAHGCTGKGNDQVRFDVSVTALNPNLK
ASSY_GEOKA      EYALIALQANALYEGKYPLVSALSRPLIAKKLVEIAELEGAVAVAHGCTGKGNDQVRFEVSIKALNPDLD
ASSY_BACSK      SFVLPALQAHALYEQKYPLVSALSRPLISKKLVEIAEQTGATAVAHGCTGKGNDQVRFEVSIQALNPNLK
ASSY_GEOTN      EYALIALQANALYEGKYPLVSALSRPLIAKKLVEIAELEGAVAVAHGCTGKGNDQVRFEVSIKALNPDLD
ASSY_STRGC      DYVLVALQGHTFYEQKYPLVSALSRPLISKKLVEIAHKTGATTIAHGCTGKGNDQVRFEVAIASLDPSLK
ASSY_STRSV      DYVLVALQGHTFYERKYPLVSALSRPLISKKLVEIAHKTGATTIAHGCTGKGNDQVRFEVAIASLDPKLK
ASSY_LISIN      NFALIALQAHAYYEGKYPLISALSRPLIAKKLVEVARQEGASAIAHGCTGKGNDQVRFEVAIHALAPDLK
ASSY_LACRJ      QFVLPALQAHAMYEQKYPLVSALSRPLIVQKLVAVANQYGATAIAHGCTGKGNDQVRFEAGIHALAPEMK
ASSY_LACRD      QFVLPALQAHAMYEQKYPLVSALSRPLIVQKLVAVANQYGATAIAHGCTGKGNDQVRFEAGIHALAPEMK
ASSY_SYNSC      DFAFPAIRANALYEGRYPLSTALARPLIAKRLVEVAREVGADAVAHGCTGKGNDQVRFDVAIAALAPDLK
ASSY_CYAP4      EYAFAAIQANALYENRYPLSTALARPLIAKLLXXXXXXXXXXXXXHGCTGKGNDQVRFDVSIAALNPNLK
ASSY_STRTD      DYVLPALQAHAYYEQKYPLVSALSRPIIAKKLVEIAHKTGATTIAHGCTGKGNDQVRFEVAIAALDPSLK
ASSY_STRT2      DYVLPALQAHAYYEQKYPLVSALSRPIIAKKLVEIAHKTGATTIAHGCTGKGNDQVRFEVAIAALDPSLK
ASSY_STRT1      DYVLPALQAHAYYEQKYPLVSALSRPIIAKKLVEIAHKTGATTIAHGCTGKGNDQVRFEVAIAALDPSLK
ASSY_DEHE1      DYIWKAIKANSMYEGVYPLATALARPLIAKVMVDIAMEEGATAIAHGCTGKGNDQVRFDVGINTLAPHLK
ASSY_DEHSC      DYIWKAIKANSMYEGVYPLATALARPLIAKVMVDIALEEGATAIAHGCTGKGNDQVRFDVGINTLAPHLK
ASSY_DEHSB      DYIWKAIKANSMYEGVYPLATALARPLIAKVMVDIALEEGATAIAHGCTGKGNDQVRFDVGINTLAPHLK
ASSY_STRMU      EYVLPALQAHAYYEQKYPLVSALSRPVISKKLVEIAHQTGATTIAHGCTGKGNDQVRFEVAIAALDPKLK
ASSY_BACA2      EYALISMQAHTMYEGKYPLVSALSRPLIXXXXXXXXXXXXXXXXXHGCTGKGNDQVRFEVSIKSLNPDLE
ASSY_GEOSW      EYALIALQAHALYEGKYPLVSALSRPLIAKKLVEIAELEGAVAVAHGCTGKGNDQVRFEVSIKALNPNLE
ASSY_SYNS9      DFAFPAIRANALYEGRYPLSTALARPLIAKRLVEVAREVGADAVAHGCTGKGNDQVRFDVAIASLAPDLK
ASSY_SYNJA      DYAFPAIQANALYEQRYPLSTALARPLIAQLLXXXXXXXXXXXXXHGCTGKGNDQVRFDLAIAALNPKLK
ASSY_SYNY3      EYAFRSIQANALYENRYPLSTALARPLIAKMLVEAAEKYGADAVAHGCTGKGNDQVRFDISIMALNPNLK
ASSY_SYNS3      EFAFPAIRANALYEGRYPLSTALARPLIARRLVEVAREVGADAVAHGCTGKGNDQVRFDVAIASLAPDLK
ASSY_SYNP2      DYAFPAIKANALYENRYPLATALARPLIAKMLVRAAEKYGADAVAHGCTAKGNDQVRFDLGILAQNPEIK
ASSY_SYNJB      DYAFPAIQANALYEQRYPLSTALARPLIAKLLXXXXXXXXXXXXXHGCTGKGNDQVRFDLAIAALNPQLK
ASSY_STRR6      DYVLVAHQSHAYYEQKYPLVSALSRPLISKKLVEIAHQIGATTIAHGCTGKGNDQVRFEVSIAALDLNLK
ASSY_STRP2      DYVLVAHQSHAYYEQKYPLVSALSRPLISKKLVEIAHQIGATTIAHGCTGKGNDQVRFEVSIAALDLNLK
ASSY_LACPL      EYALIALQGHTLYEGEYPLVSALSRPLIAKKLVTLAKQEHAVAIAHGCTGKGNDQVRFEVAIHALAPDIK
ASSY_STRPI      DYVLVAHQSHAYYEQKYPLVSALSRPLISKKLVEIAHQIGATTIAHGCTGKGNDQVRFEVSIAALDLNLK
ASSY_BACP2      XXXLTALQAHTMYEGKYPLVSALSRPLIXXXXXXXXXXXXXXXXXHGCTGKGNDQVRFEVSIKALNPDLE
ASSY_PROM3      EFALPAIRANALYEGRYPLSTALARPLIARRLVEVAREVGADAVAHGCTGKGNDQVRFDLAIAALAPDLK
ASSY_CYAP8      EYAFRAIKANALYENRYPLSTALARPLIAKLLVEAAEKYGADAVAHGCTAKGNDQVRFDLGILALNPNLK
ASSY_STAS1      DYVSYAIKGNLMYEGTYPLVSALSRPLISKKLVEIASKTNSVGIAHGCTGKGNDQVRFEVAIKALDPELK
ASSY_PROMM      QFALPAIRANALYEGRYPLSTALARPLIARQLVEVAREVGADAVAHGCTGKGNDQVRFDLAIAALAPDLK
ASSY_SYNP6      DYAFPAIQANSLYEGRYPLSTALARPLIAKLLVEAAAKYGADAVAHGCTGKGNDQVRFDVSIAALNPDLK
ASSY_SYNE7      DYAFPAIQANSLYEGRYPLSTALARPLIAKLLVEAAAKYGADAVAHGCTGKGNDQVRFDVSIAALNPDLK
ASSY_DICT6      DYIIPAIKSNAMYERVYPLATALSRPLIAKYLVKIAKENGAKYVAHGCTGKGNDQVRIDLGVKALAPDLE
ASSY_SYNR3      EFAFPAIRANALYEGRYPLSTALARPLIARRLVEIAREVGADAVAHGCTGKGNDQVRFDVAIGALAPDLK
ASSY_LEUCK      QYVAPVIKANMLYEGEYPMVSALSRPLIIKKLVDIAHENEAVAIAHGSTGHGNDQVRFEAAIHALDPDMK
ASSY_PROM0      RYAFPAIRANALYLDKYPLSTALARPLIAENLVNIAREISADAVAHGCTGKGNDQVRFDLAINALGPDLK
ASSY_PROMP      KYAFPAIRANALYGEKYPLSTALARPLIAENLVNLARELNADAVAHGCTGKGNDQVRFDLAIHALGPDLQ
ASSY_PROM5      KYAFPAIRANALYGEKYPLSTALARPLIAENLVKLARKLNAGAVAHGCTGKGNDQVRFDLAINALGPDLE
ASSY_BACCN      EYALVALQGHTLYEGKYPLVSALSRPLIAKKLVEIAELEGASAVAHGCTGKGNDQVRFEVSIQALNPYLE
ASSY_PROM4      DFAFPAIRANALYEGKYPLSTALARPLISKRLVDIAKELEADAVAHGCTGKGNDQVRFDIAIATLAPELK
ASSY_EXIS2      DFVLPALQYGAHYEGAYPLISALSRPLIAEKLVEVAHAQGATAVAHGCTGKGNDQVRFEVSVAALDPSLE
ASSY_SYNPW      EFAFPAIRANALYEGRYPLSTALARPLIARRLVEVAREVGADAVAHGCTGKGNDQVRFDVAIAALAPDLK
ASSY_STRA5      HFVLPALQAHAMYEQKYPLVSALSRPIIAQKLVEMAHQTGATTIAHGCTGKGNDQVRFEVAIAALDPELK
ASSY_IGNH4      KYIKPAIIANALYEEVYPLGTALARPLIGEKVIEVARKEGADAVAHGATSKGNDQVRFEAAFKALAPEIK
ASSY_SYNPX      EFAFPAIRANALYEGRYPLSTALARPLIARRLVEVAREVGADAVAHGCTGKGNDQVRFDVAIAALAPDLK
ASSY_STRA3      HFVLPALQAHAMYEQKYPLVSALSRPIIAQKLVEMAHQTGATTIAHGCTGKGNDQVRFEVAIAALDPELK
ASSY_STRA1      HFVLPALQAHAMYEQKYPLVSALSRPIIAQKLVEMAHQTGATTIAHGCTGKGNDQVRFEVAIAALDPELK
ASSY_STAES      DYVSYAIKGNLMYENAYPLVSALSRPLIAKKLVEIAEKTNSIGIAHGCTGKGNDQVRFEVAIKALNPKLK
ASSY_STAEQ      DYVSYAIKGNLMYENAYPLVSALSRPLIAKKLVEIAEKTNSIGIAHGCTGKGNDQVRFEVAIKALNPKLK
ASSY_CYAA5      DYAFKAIKANALYESRYPLSTALARPLIAKLLVEAAEKYGADAVAHGCTAKGNDQVRFDLGILALNPTLK
ASSY_STAAW      EYVSYAIKGNLMYENAYPLVSALSRPLIAKKLVEIAEKTNSVGIAHGCTGKGNDQVRFEVAIKALNPSLK
ASSY_STAAS      EYVSYAIKGNLMYENAYPLVSALSRPLIAKKLVEIAEKTNSVGIAHGCTGKGNDQVRFEVAIKALNPSLK
ASSY_LACC3      HYVAPVIKANALYEGDYPLVSALSRPLIIEHLVKIAHAQNATAIAHGSTGKG