[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ56165.1

[Show Plain Result]


## Summary of Sequence Search
    1::167
    3::161     5e-22  36%  163 aa  Y1315_MYCBO RecName: Full=Uncharacterized protein Mb1315;
    3::161     5e-22  36%  163 aa  Y1284_MYCTU RecName: Full=Uncharacterized protein Rv1284/MT1322;
    3::178     9e-16  33%  187 aa  YTIB_BACSU RecName: Full=Putative carbonic anhydrase;       
   37::193     2e-06  32%  220 aa  CYNT_PSEAE RecName: Full=Carbonic anhydrase;       
   36::102     6e-05  31%  221 aa  CYNT_HELPJ RecName: Full=Carbonic anhydrase;       
   36::109     1e-04  38%  270 aa  BCA1_CAEEL RecName: Full=Beta carbonic anhydrase 1;       
   36::102     2e-04  31%  221 aa  CYNT_HELPY RecName: Full=Carbonic anhydrase;       
   37::193     2e-04  27%  219 aa  CYNT_ECOLI RecName: Full=Carbonic anhydrase 1;       
   37::193     2e-04  27%  219 aa  CYNT_ECO57 RecName: Full=Carbonic anhydrase 1;       
   15::115     2e-04  37%  221 aa  CAN_YEAST RecName: Full=Carbonic anhydrase;       
   73::167     2e-04  33%  448 aa  ASTB_PSE14 RecName: Full=N-succinylarginine dihydrolase;       
   40::101     3e-04  34%  229 aa  CAN_HAEIN RecName: Full=Carbonic anhydrase 2;       
  167::230     3e-04  37%  347 aa  CAHC_ARATH RecName: Full=Carbonic anhydrase, chloroplastic;        
   21::84      3e-04  37%  190 aa  CAH2_FLALI RecName: Full=Carbonic anhydrase 2;       
   77::138     4e-04  34%  244 aa  CAN_SCHPO RecName: Full=Carbonic anhydrase;       
  159::222     4e-04  35%  328 aa  CAHC_PEA RecName: Full=Carbonic anhydrase, chloroplastic;       
   70::166     4e-04  33%  449 aa  ASTB_PSEPG RecName: Full=N-succinylarginine dihydrolase;       
   90::153     5e-04  37%  259 aa  CAH2_ARATH RecName: Full=Carbonic anhydrase 2;       
  152::215     6e-04  37%  321 aa  CAHC_TOBAC RecName: Full=Carbonic anhydrase, chloroplastic;        
   70::166     6e-04  31%  448 aa  ASTB_PSESM RecName: Full=N-succinylarginine dihydrolase;       
    1::167

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xNGVFDDVLAANEDYVRTFTLAGLQPVAARGLALVTCMDSRIEPLEMLGLKPGDAKILRNAGARVTDDTL
Y1315_MYCBO     ---VTDDYLANNVDYASGFK-GPLPMPPSKHIAIVACMDARLDVYRMLGIKEGEAHVIRNAGCVVTDDVI
Y1284_MYCTU     ---VTDDYLANNVDYASGFK-GPLPMPPSKHIAIVACMDARLDVYRMLGIKEGEAHVIRNAGCVVTDDVI
YTIB_BACSU      ---LLNDILEFNKTFTREYEKYQTSKFPDKKMAILSCMDTRLVELHAMNLRNGDVKIIKSAGALVTHSIM
CYNT_PSEAE      ----------------------------------IACSDSRVVPELLTQREPGELFVIRNAGNIVPGGVS
CYNT_HELPJ      ----------------------------------ISCVDSRVVPNLITGTQPGELYVIRNMGNVIPPSTI
BCA1_CAEEL      ---------------------------------MFTCMDSRMLPTRFTQSQVGDMFVVRNAGNMIPDTEP
CYNT_HELPY      ----------------------------------ISCVDSRVVPNLITGTKPGELYVICNMGYKESLSTI
CYNT_ECOLI      ----------------------------------ISCSDSRLVPELVTQREPGDLFVIRNAGNIVPSGVS
CYNT_ECO57      ----------------------------------ISCSDSRLVPELVTQREPGDLFVIRNAGNIVPSGVS
CAN_YEAST       -NSNLQDILAANAKWASQMN--NIQPTLAKGQSFIGCSDSRYNE-NCLGVLPGEVFTWKNVACHSEDLTL
ASTB_PSE14      --------------------------------------------LRQLGFIGSDEQVIEKA-ARQDMPLL
CAN_HAEIN       ----------------------------------IGCSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
CAHC_ARATH      ------------------------------------CSDSRVCPSHVLDFQPGDAFVVRNIANMVPPDKV
CAH2_FLALI      ------------------------------------CSDSRVCPSHILDFQPGEAFVVRNIANMVPPDTI
CAN_SCHPO       ----------------------------------IGCSDSRVPETTILNLLPGEVFVHRNIANVVPRSDI
CAHC_PEA        ------------------------------------CSDSRVCPSHVLDFQPGEAFVVRNVANLVPPGTG
ASTB_PSEPG      -----------------------------------------VAALRRLGFSGSDAEVIQRAAA----DAM
CAH2_ARATH      ------------------------------------CSDSRVCPSHVLDFHPGDAFVVRNIANMVPPDKV
CAHC_TOBAC      ------------------------------------CSDSRVCPSHVLNFQPGEAFVVRNIANMVPDKTR
ASTB_PSESM      -----------------------------------------VASLRQLGFTGSDEQVIEKA-ARQDMPLL


                         .         .         *         .         .         .         .:140
query           RTLVLAVYLLGVNRVIVLPHTGCKMASVSGDEEVHDTIAARYGVDTRSLEFHTDSDQIGALHRDVERIRH
Y1315_MYCBO     RSLAISQRLLGTREIILLHHTDCGMLTFT-DDDFKRAIQDETGIPTWSPESYPDA--VEDVRQSLRRIEV
Y1284_MYCTU     RSLAISQRLLGTREIILLHHTDCGMLTFT-DDDFKRAIQDETGIPTWSPESYPDA--VEDVRQSLRRIEV
YTIB_BACSU      RSILVAVYELNADEVCVIGHHDCGMSKISS-KSMLEKIKAR-GIPEERIEWFKSFDSVEASVKDVDVIKH
CYNT_PSEAE      ASVEYAVAVLGVGDIVVCGHSDCQLPAVAG--WLHHAEAAR--AMNSAHEHASEAARLDALVRQLANLRT
CYNT_HELPJ      ASVEYAIAHVGVQNLIICGHSDC-----------------------------------------------
BCA1_CAEEL      AALELAVKRGGIRHIVVCGHSDCK----------------------------------------------
CYNT_HELPY      ASIEYAIAHVGVQNLIICGHSDC-----------------------------------------------
CYNT_ECOLI      ASVEYAVAALRVSDIVICGHSNCGAMTAIASCQCMDHMPARYADSARVVNEHSDPSKAAAMVRELANLQT
CYNT_ECO57      ASVEYAVAALRVSDIVICGHSNCGAMTAIASCQCMDHMPARYADSARVVNEHSDPSKAAAMVRELANLQT
CAN_YEAST       KTLEFAIICLKVNKVIICGHTDC-----------------------------------------------
ASTB_PSE14      VASCSASSMWVANAATVSP------SADTADGRVHFTAANLNCKYHRSIEHPTTSRVLGAMFADAKHFAH
CAN_HAEIN       SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
CAHC_ARATH      KAIEYAVLHLKVENIVVIGHSAC-----------------------------------------------
CAH2_FLALI      KAIEYAVLHLKVENIVVIGHSCC-----------------------------------------------
CAN_SCHPO       NALAVMEYVLKVKHIIVCGHYGC-----------------------------------------------
CAHC_PEA        AAIEYAVLHLKVSNIVVIGHSAC-----------------------------------------------
ASTB_PSEPG      PLLVAASSMWVANAATVSP------SADTADGRVHFTAANLNCKYHRSIEHPTTSRVLGAMFNNEKHFAH
CAH2_ARATH      KAIEYAVLHLKVENIVVIGHSAC-----------------------------------------------
CAHC_TOBAC      AAIEYAVLHLKVENIVVIGHSAC-----------------------------------------------
ASTB_PSESM      VASCSASSMWVANAATVSP------SADTADGRVHFTAANLNCKYHRSIEHPTTSRVLGAMFADAKHFAH


                         +         .         .         .         .         *         .:210
query           HPLLPPDLPVMGAIYDVDTGRVTPVDx
Y1315_MYCBO     NPFVTKHTSLRGFVFDVATGKLNEV--
Y1284_MYCTU     NPFVTKHTSLRGFVFDVATGKLNEV--
YTIB_BACSU      HPLFPENVPVHGLVIDPKTGKL-----
CYNT_PSEAE      HPLEQGRLNLHGWVYDIESGRIDALD-
CYNT_HELPJ      ---------------------------
BCA1_CAEEL      ---------------------------
CYNT_HELPY      ---------------------------
CYNT_ECOLI      HPLEEGRIALHGWVYDIESGSIAAFD-
CYNT_ECO57      HPLEEGRIALHGWVYDIESGSIAAFD-
CAN_YEAST       ---------------------------
ASTB_PSE14      HPALPP---------------------
CAN_HAEIN       ---------------------------
CAHC_ARATH      ---------------------------
CAH2_FLALI      ---------------------------
CAN_SCHPO       ---------------------------
CAHC_PEA        ---------------------------
ASTB_PSEPG      HPALP----------------------
CAH2_ARATH      ---------------------------
CAHC_TOBAC      ---------------------------
ASTB_PSESM      HPALP----------------------