[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ56191.1

[Show Plain Result]


## Summary of Sequence Search
    1::515
    1::508     e-105  43%  513 aa  LCFB_BACSU RecName: Full=Long-chain-fatty-acid--CoA ligase;        
   26::544     2e-92  39%  560 aa  LCFA_BACSU RecName: Full=Long-chain-fatty-acid--CoA ligase;        
   70::550     9e-86  42%  561 aa  LCFA_ECO57 RecName: Full=Long-chain-fatty-acid--CoA ligase;        
   70::550     2e-85  42%  561 aa  LCFA_ECOLI RecName: Full=Long-chain-fatty-acid--CoA ligase;        
   70::550     2e-85  42%  561 aa  LCFA_ECOL6 RecName: Full=Long-chain-fatty-acid--CoA ligase;        
   24::550     4e-83  40%  561 aa  LCFA_SALTY RecName: Full=Long-chain-fatty-acid--CoA ligase;        
   24::550     4e-83  40%  561 aa  LCFA_SALTI RecName: Full=Long-chain-fatty-acid--CoA ligase;        
   70::550     4e-82  41%  562 aa  LCFA_YERPE RecName: Full=Long-chain-fatty-acid--CoA ligase;        
   28::552     1e-70  35%  562 aa  LCFA_HAEIN RecName: Full=Long-chain-fatty-acid--CoA ligase;        
    8::517     3e-68  35%  517 aa  CAIC_SALAR RecName: Full=Probable crotonobetaine/carnitine-CoA
   78::606     5e-68  36%  615 aa  ACSF2_RAT RecName: Full=Acyl-CoA synthetase family member 2,
    8::517     6e-68  35%  517 aa  CAIC_CITK8 RecName: Full=Probable crotonobetaine/carnitine-CoA
   37::517     7e-67  36%  517 aa  CAIC_ECOSM RecName: Full=Probable crotonobetaine/carnitine-CoA
   37::517     2e-66  36%  517 aa  CAIC_ECO27 RecName: Full=Probable crotonobetaine/carnitine-CoA
   37::517     3e-66  35%  517 aa  CAIC_ECOUT RecName: Full=Probable crotonobetaine/carnitine-CoA
   37::517     3e-66  35%  517 aa  CAIC_ECOK1 RecName: Full=Probable crotonobetaine/carnitine-CoA
   37::517     3e-66  36%  517 aa  CAIC_ECO81 RecName: Full=Probable crotonobetaine/carnitine-CoA
   37::517     3e-66  35%  517 aa  CAIC_ECO45 RecName: Full=Probable crotonobetaine/carnitine-CoA
   53::536     4e-66  36%  545 aa  4CL2_SOLTU RecName: Full=4-coumarate--CoA ligase 2;       
   78::606     5e-66  35%  615 aa  ACSF2_MOUSE RecName: Full=Acyl-CoA synthetase family member 2,
   37::517     6e-66  35%  517 aa  CAIC_SHIFL RecName: Full=Probable crotonobetaine/carnitine-CoA
   37::517     8e-66  36%  517 aa  CAIC_ECO7I RecName: Full=Probable crotonobetaine/carnitine-CoA
   37::517     8e-66  35%  517 aa  CAIC_ECO5E RecName: Full=Probable crotonobetaine/carnitine-CoA
   37::517     8e-66  35%  517 aa  CAIC_ECO57 RecName: Full=Probable crotonobetaine/carnitine-CoA
   37::517     2e-65  35%  517 aa  CAIC_ECOLC RecName: Full=Probable crotonobetaine/carnitine-CoA
   37::517     2e-65  36%  517 aa  CAIC_ECOL6 RecName: Full=Probable crotonobetaine/carnitine-CoA
   37::517     2e-65  36%  517 aa  CAIC_ECOL5 RecName: Full=Probable crotonobetaine/carnitine-CoA
   37::517     2e-65  35%  517 aa  CAIC_ECO55 RecName: Full=Probable crotonobetaine/carnitine-CoA
   53::536     2e-65  36%  545 aa  4CL1_SOLTU RecName: Full=4-coumarate--CoA ligase 1;       
   37::517     3e-65  35%  517 aa  CAIC_ECO8A RecName: Full=Probable crotonobetaine/carnitine-CoA
   37::517     4e-65  35%  517 aa  CAIC_ECOHS RecName: Full=Probable crotonobetaine/carnitine-CoA
   37::517     5e-65  35%  517 aa  CAIC_ESCF3 RecName: Full=Probable crotonobetaine/carnitine-CoA
   37::517     7e-65  35%  517 aa  CAIC_ECO24 RecName: Full=Probable crotonobetaine/carnitine-CoA
   37::517     9e-65  35%  517 aa  CAIC_ECOSE RecName: Full=Probable crotonobetaine/carnitine-CoA
   37::517     9e-65  35%  517 aa  CAIC_ECOLU RecName: Full=Probable crotonobetaine/carnitine-CoA
   37::517     1e-64  35%  517 aa  CAIC_SHISS RecName: Full=Probable crotonobetaine/carnitine-CoA
   37::517     1e-64  35%  517 aa  CAIC_ECOLI RecName: Full=Probable crotonobetaine/carnitine-CoA
   37::517     1e-64  35%  517 aa  CAIC_ECODH RecName: Full=Probable crotonobetaine/carnitine-CoA
   37::517     1e-64  35%  517 aa  CAIC_ECOBW RecName: Full=Probable crotonobetaine/carnitine-CoA
    8::517     3e-64  34%  517 aa  CAIC_SALPK RecName: Full=Probable crotonobetaine/carnitine-CoA
    8::517     3e-64  34%  517 aa  CAIC_SALPA RecName: Full=Probable crotonobetaine/carnitine-CoA
   81::609     3e-64  34%  618 aa  ACSF2_MACFA RecName: Full=Acyl-CoA synthetase family member 2,
    8::517     3e-64  34%  517 aa  CAIC_SALNS RecName: Full=Probable crotonobetaine/carnitine-CoA
    8::518     4e-64  34%  518 aa  CAIC_PROMH RecName: Full=Probable crotonobetaine/carnitine-CoA
   78::606     6e-64  35%  615 aa  ACSF2_PONAB RecName: Full=Acyl-CoA synthetase family member 2,
   55::538     1e-63  35%  547 aa  4CL1_TOBAC RecName: Full=4-coumarate--CoA ligase 1;       
    8::517     1e-63  33%  517 aa  CAIC_SALSV RecName: Full=Probable crotonobetaine/carnitine-CoA
    8::517     1e-63  34%  517 aa  CAIC_SALDC RecName: Full=Probable crotonobetaine/carnitine-CoA
   37::517     2e-63  35%  517 aa  CAIC_SHIDS RecName: Full=Probable crotonobetaine/carnitine-CoA
    8::517     2e-63  33%  517 aa  CAIC_SALTI RecName: Full=Probable crotonobetaine/carnitine-CoA
    8::517     2e-63  33%  517 aa  CAIC_SALPC RecName: Full=Probable crotonobetaine/carnitine-CoA
    8::517     2e-63  32%  517 aa  CAIC_SALPB RecName: Full=Probable crotonobetaine/carnitine-CoA
    8::517     2e-63  33%  517 aa  CAIC_SALEP RecName: Full=Probable crotonobetaine/carnitine-CoA
    8::517     3e-63  33%  517 aa  CAIC_SALCH RecName: Full=Probable crotonobetaine/carnitine-CoA
    8::517     8e-63  33%  517 aa  CAIC_SALTY RecName: Full=Probable crotonobetaine/carnitine-CoA
    8::517     8e-63  33%  517 aa  CAIC_SALHS RecName: Full=Probable crotonobetaine/carnitine-CoA
    8::517     8e-63  32%  517 aa  CAIC_SALA4 RecName: Full=Probable crotonobetaine/carnitine-CoA
   78::606     8e-63  34%  615 aa  ACSF2_HUMAN RecName: Full=Acyl-CoA synthetase family member 2,
    1::497     2e-62  34%  503 aa  YDAB_BACSU RecName: Full=Putative acyl--CoA ligase ydaB;       
    8::518     3e-62  34%  518 aa  CAIC_PROSL RecName: Full=Probable crotonobetaine/carnitine-CoA
    9::478     5e-62  35%  478 aa  MENE_BACLD RecName: Full=2-succinylbenzoate--CoA ligase;       
   78::606     7e-62  34%  615 aa  ACSF2_BOVIN RecName: Full=Acyl-CoA synthetase family member 2,
   81::555     1e-61  33%  566 aa  4CLL6_ARATH RecName: Full=4-coumarate--CoA ligase-like 6;       
   55::533     2e-61  35%  542 aa  4CL2_TOBAC RecName: Full=4-coumarate--CoA ligase 2;       
   16::477     3e-61  36%  486 aa  MENE_BACP2 RecName: Full=2-succinylbenzoate--CoA ligase;       
   17::481     4e-61  34%  492 aa  MENE_GEOSW RecName: Full=2-succinylbenzoate--CoA ligase;       
   70::536     4e-61  32%  546 aa  4CLL5_ARATH RecName: Full=4-coumarate--CoA ligase-like 5;       
   54::540     1e-60  33%  553 aa  4CL_VANPL RecName: Full=4-coumarate--CoA ligase;         Short=4CL;
   34::532     2e-60  33%  548 aa  FADK_ECOLI RecName: Full=Short-chain-fatty-acid--CoA ligase;       
   56::534     2e-60  35%  544 aa  4CL2_PETCR RecName: Full=4-coumarate--CoA ligase 1;       
   56::534     2e-60  35%  544 aa  4CL1_PETCR RecName: Full=4-coumarate--CoA ligase 1;       
   82::543     4e-60  33%  552 aa  4CLL1_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 1;       
  126::597     9e-59  36%  606 aa  ACSF2_DANRE RecName: Full=Acyl-CoA synthetase family member 2,
   16::480     2e-58  36%  490 aa  MENE_GEOKA RecName: Full=2-succinylbenzoate--CoA ligase;       
   37::510     2e-58  35%  510 aa  CAIC_SHIF8 RecName: Full=Probable crotonobetaine/carnitine-CoA
   57::557     4e-58  31%  565 aa  4CLL2_ARATH RecName: Full=4-coumarate--CoA ligase-like 2;       
   46::544     5e-58  32%  552 aa  4CLL3_ARATH RecName: Full=4-coumarate--CoA ligase-like 3;       
   34::544     6e-58  32%  551 aa  4CL2_DICDI RecName: Full=Probable 4-coumarate--CoA ligase 2;       
   62::542     1e-57  32%  550 aa  4CLL8_ARATH RecName: Full=4-coumarate--CoA ligase-like 8;       
   41::536     2e-57  31%  544 aa  4CLL7_ARATH RecName: Full=4-coumarate--CoA ligase-like 7;       
   34::544     2e-57  32%  551 aa  4CL1_DICDI RecName: Full=Probable 4-coumarate--CoA ligase 1;       
   16::468     4e-57  35%  481 aa  MENE_BACC7 RecName: Full=2-succinylbenzoate--CoA ligase;       
   86::544     5e-57  33%  552 aa  4CLL4_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 4;       
   35::542     5e-57  32%  550 aa  4CLL4_ARATH RecName: Full=4-coumarate--CoA ligase-like 4;       
   28::498     7e-57  33%  512 aa  FAT2_SCHPO RecName: Full=Putative peroxisomal-coenzyme A
   23::516     2e-55  31%  523 aa  3HBCL_THAAR RecName:
   66::547     3e-55  31%  556 aa  4CL2_ARATH RecName: Full=4-coumarate--CoA ligase 2;       
   13::478     5e-55  31%  486 aa  MENE_BACSU RecName: Full=2-succinylbenzoate--CoA ligase;       
   45::530     1e-54  31%  546 aa  ALKK_PSEOL RecName: Full=Medium-chain-fatty-acid--CoA ligase;      
   17::469     2e-54  34%  482 aa  MENE_BACC0 RecName: Full=2-succinylbenzoate--CoA ligase;       
   34::544     2e-54  32%  551 aa  4CL3_DICDI RecName: Full=Probable 4-coumarate--CoA ligase 3;       
   89::563     3e-54  34%  569 aa  4CL2_ORYSJ RecName: Full=Probable 4-coumarate--CoA ligase 2;       
   17::469     4e-54  33%  482 aa  MENE_BACCZ RecName: Full=2-succinylbenzoate--CoA ligase;       
   17::469     7e-54  33%  482 aa  MENE_BACHK RecName: Full=2-succinylbenzoate--CoA ligase;       
   16::468     9e-54  33%  481 aa  MENE_BACAN RecName: Full=2-succinylbenzoate--CoA ligase;       
   17::469     9e-54  33%  482 aa  MENE_BACAH RecName: Full=2-succinylbenzoate--CoA ligase;       
   17::469     9e-54  33%  482 aa  MENE_BACAC RecName: Full=2-succinylbenzoate--CoA ligase;       
   17::469     9e-54  33%  482 aa  MENE_BACAA RecName: Full=2-succinylbenzoate--CoA ligase;       
   16::468     1e-53  33%  481 aa  MENE_BACCQ RecName: Full=2-succinylbenzoate--CoA ligase;       
   16::468     2e-53  34%  481 aa  MENE_BACC1 RecName: Full=2-succinylbenzoate--CoA ligase;       
   78::565     2e-53  32%  575 aa  ACSM2_MOUSE RecName: Full=Acyl-coenzyme A synthetase ACSM2,
   68::554     3e-53  30%  561 aa  4CL1_ARATH RecName: Full=4-coumarate--CoA ligase 1;       
   16::466     3e-53  33%  481 aa  MENE_BACWK RecName: Full=2-succinylbenzoate--CoA ligase;       
  199::550     3e-53  37%  562 aa  4CLL9_ARATH RecName: Full=4-coumarate--CoA ligase-like 9;       
   17::469     6e-53  34%  482 aa  MENE_BACCR RecName: Full=2-succinylbenzoate--CoA ligase;       
    5::462     8e-53  35%  467 aa  MENE_LISMO RecName: Full=2-succinylbenzoate--CoA ligase;       
   78::557     8e-53  33%  561 aa  4CL3_ARATH RecName: Full=4-coumarate--CoA ligase 3;       
   86::573     3e-52  31%  580 aa  ACSM3_MOUSE RecName: Full=Acyl-coenzyme A synthetase ACSM3,
   66::525     8e-52  34%  527 aa  BCLA_THAAR RecName: Full=Benzoate--CoA ligase;       
   17::478     1e-51  32%  480 aa  MENE_OCEIH RecName: Full=2-succinylbenzoate--CoA ligase;       
   16::466     1e-51  33%  481 aa  MENE_BACCN RecName: Full=2-succinylbenzoate--CoA ligase;       
    5::462     1e-51  33%  467 aa  MENE_LISMF RecName: Full=2-succinylbenzoate--CoA ligase;       
   86::573     9e-51  30%  580 aa  ACSM3_RAT RecName: Full=Acyl-coenzyme A synthetase ACSM3,
   60::538     3e-50  32%  548 aa  LUCI_LUCMI RecName: Full=Luciferin 4-monooxygenase;       
   78::564     3e-50  32%  572 aa  ACSM2_RAT RecName: Full=Acyl-coenzyme A synthetase ACSM2,
  105::587     1e-49  33%  598 aa  4CLL6_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 6;       
  110::572     1e-49  33%  578 aa  ACSM5_MOUSE RecName: Full=Acyl-coenzyme A synthetase ACSM5,
   41::544     3e-49  31%  555 aa  4CLL9_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 9;       
   63::527     9e-49  29%  543 aa  FAT2_YEAST RecName: Full=Peroxisomal-coenzyme A synthetase;        
   78::567     9e-49  34%  583 aa  ACSF3_MOUSE RecName: Full=Acyl-CoA synthetase family member 3,
   48::536     1e-48  32%  550 aa  LUCI_PHOPY RecName: Full=Luciferin 4-monooxygenase;       
  100::554     1e-48  34%  564 aa  4CL1_ORYSJ RecName: Full=Probable 4-coumarate--CoA ligase 1;       
   64::573     1e-48  30%  580 aa  ACSM4_RAT RecName: Full=Acyl-coenzyme A synthetase ACSM4,
   70::551     3e-48  32%  562 aa  4CL2_SOYBN RecName: Full=4-coumarate--CoA ligase 2;       
   97::569     6e-48  35%  586 aa  ACSF3_BOVIN RecName: Full=Acyl-CoA synthetase family member 3,
  190::542     6e-48  34%  559 aa  4CL4_ORYSJ RecName: Full=Probable 4-coumarate--CoA ligase 4;       
   51::529     7e-48  31%  539 aa  4CL5_ORYSJ RecName: Full=Probable 4-coumarate--CoA ligase 5;       
    5::462     2e-47  32%  467 aa  MENE_LISIN RecName: Full=2-succinylbenzoate--CoA ligase;       
   98::572     2e-47  32%  578 aa  ACSM5_RAT RecName: Full=Acyl-coenzyme A synthetase ACSM5,
   74::561     2e-47  29%  570 aa  4CL4_ARATH RecName: Full=4-coumarate--CoA ligase 4;       
  179::538     3e-47  36%  548 aa  LUCI_LUCCR RecName: Full=Luciferin 4-monooxygenase;       
   69::538     4e-47  31%  548 aa  LUCI_LUCLA RecName: Full=Luciferin 4-monooxygenase;       
   92::579     5e-47  30%  586 aa  ACSM3_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM3,
   99::573     6e-47  32%  579 aa  ACSM5_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM5,
   18::510     1e-46  30%  539 aa  4HBCL_RHOPA RecName: Full=4-hydroxybenzoate--CoA/benzoate--CoA
   40::531     1e-46  30%  537 aa  4CL_PINTA RecName: Full=4-coumarate--CoA ligase;         Short=4CL;
   69::489     2e-46  31%  492 aa  MENE_STAAW RecName: Full=2-succinylbenzoate--CoA ligase;       
   69::489     2e-46  31%  492 aa  MENE_STAAS RecName: Full=2-succinylbenzoate--CoA ligase;       
   70::535     2e-46  31%  545 aa  LUCI_PHOPE RecName: Full=Luciferin 4-monooxygenase;       
   73::532     2e-46  30%  554 aa  4CL3_ORYSJ RecName: Full=Probable 4-coumarate--CoA ligase 3;       
   92::579     2e-46  29%  586 aa  ACSM3_PONAB RecName: Full=Acyl-coenzyme A synthetase ACSM3,
   78::564     3e-46  31%  577 aa  ACS2B_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM2B,
   69::489     5e-46  31%  492 aa  MENE_STAAB RecName: Full=2-succinylbenzoate--CoA ligase;       
   13::478     9e-46  31%  487 aa  MENE_BACA2 RecName: Full=2-succinylbenzoate--CoA ligase;       
   69::489     1e-45  31%  492 aa  MENE_STAAN RecName: Full=2-succinylbenzoate--CoA ligase;       
   69::489     1e-45  31%  492 aa  MENE_STAAM RecName: Full=2-succinylbenzoate--CoA ligase;       
   69::489     1e-45  31%  492 aa  MENE_STAA9 RecName: Full=2-succinylbenzoate--CoA ligase;       
   69::489     1e-45  31%  492 aa  MENE_STAA2 RecName: Full=2-succinylbenzoate--CoA ligase;       
   69::489     1e-45  31%  492 aa  MENE_STAA1 RecName: Full=2-succinylbenzoate--CoA ligase;       
   78::564     1e-45  31%  577 aa  ACS2A_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM2A,
   30::526     2e-45  32%  539 aa  DHBE_BACSU RecName: Full=2,3-dihydroxybenzoate-AMP ligase;       
   64::573     2e-45  30%  580 aa  ACSM4_MOUSE RecName: Full=Acyl-coenzyme A synthetase ACSM4,
   86::573     2e-45  31%  580 aa  ACSM4_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM4,
   69::489     4e-45  31%  492 aa  MENE_STAAR RecName: Full=2-succinylbenzoate--CoA ligase;       
   97::570     6e-45  34%  577 aa  ACSM1_BOVIN RecName: Full=Acyl-coenzyme A synthetase ACSM1,
   50::569     6e-45  34%  576 aa  ACSF3_HUMAN RecName: Full=Acyl-CoA synthetase family member 3,
  107::614     6e-45  28%  651 aa  ACSA_XANP2 RecName: Full=Acetyl-coenzyme A synthetase;       
   69::489     2e-44  31%  492 aa  MENE_STAAU RecName: Full=2-succinylbenzoate--CoA ligase;       
   69::489     2e-44  31%  492 aa  MENE_STAAT RecName: Full=2-succinylbenzoate--CoA ligase;       
   69::489     2e-44  31%  492 aa  MENE_STAAE RecName: Full=2-succinylbenzoate--CoA ligase;       
   69::489     2e-44  31%  492 aa  MENE_STAAC RecName: Full=2-succinylbenzoate--CoA ligase;       
   69::489     2e-44  31%  492 aa  MENE_STAA8 RecName: Full=2-succinylbenzoate--CoA ligase;       
   69::489     2e-44  31%  492 aa  MENE_STAA3 RecName: Full=2-succinylbenzoate--CoA ligase;       
    4::471     4e-44  32%  485 aa  MENE_ENTFA RecName: Full=2-succinylbenzoate--CoA ligase;       
  108::614     5e-44  30%  649 aa  ACSA_NOVAD RecName: Full=Acetyl-coenzyme A synthetase;       
   84::572     6e-44  30%  591 aa  4CLL3_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 3;       
  103::566     8e-44  31%  573 aa  ACSM1_MOUSE RecName: Full=Acyl-coenzyme A synthetase ACSM1,
   83::556     8e-44  30%  572 aa  ACSA_BACSU RecName: Full=Acetyl-coenzyme A synthetase;       
   83::570     2e-43  30%  577 aa  ACSM1_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM1,
    4::284     9e-43  38%  293 aa  4CL1_SOYBN RecName: Full=4-coumarate--CoA ligase 1;       
  105::616     3e-42  30%  649 aa  ACSA_PSYIN RecName: Full=Acetyl-coenzyme A synthetase;       
  107::616     4e-42  29%  650 aa  ACSA_SHEFN RecName: Full=Acetyl-coenzyme A synthetase;       
   88::615     8e-42  28%  649 aa  ACSA_METPB RecName: Full=Acetyl-coenzyme A synthetase;       
   80::612     8e-42  28%  646 aa  ACSA_DESAA RecName: Full=Acetyl-coenzyme A synthetase;       
  119::612     1e-41  27%  650 aa  ACSA_SYNFM RecName: Full=Acetyl-coenzyme A synthetase;       
  107::615     1e-41  28%  648 aa  ACSA_METRJ RecName: Full=Acetyl-coenzyme A synthetase;       
  107::616     2e-41  29%  650 aa  ACSA_SHEAM RecName: Full=Acetyl-coenzyme A synthetase;       
  107::615     2e-41  28%  652 aa  ACSA_METC4 RecName: Full=Acetyl-coenzyme A synthetase;       
  107::615     2e-41  28%  649 aa  ACSA_METEP RecName: Full=Acetyl-coenzyme A synthetase;       
  130::450     3e-41  35%  451 aa  MENE_LACLA RecName: Full=2-succinylbenzoate--CoA ligase;       
  118::615     3e-41  30%  647 aa  ACSA_XANAC RecName: Full=Acetyl-coenzyme A synthetase;       
   86::613     3e-41  28%  648 aa  ACSA_RHOP5 RecName: Full=Acetyl-coenzyme A synthetase;       
  104::613     3e-41  27%  647 aa  ACSA_PARL1 RecName: Full=Acetyl-coenzyme A synthetase;       
   97::571     5e-41  31%  578 aa  ACSF3_XENLA RecName: Full=Acyl-CoA synthetase family member 3,
   88::613     5e-41  29%  645 aa  ACSA2_PSEAE RecName: Full=Acetyl-coenzyme A synthetase 2;       
  101::616     7e-41  29%  650 aa  ACSA_SHESA RecName: Full=Acetyl-coenzyme A synthetase;       
  101::616     1e-40  29%  650 aa  ACSA_SHESM RecName: Full=Acetyl-coenzyme A synthetase;       
  118::613     1e-40  29%  648 aa  ACSA_BRAJA RecName: Full=Acetyl-coenzyme A synthetase;       
  101::616     2e-40  29%  650 aa  ACSA_SHESR RecName: Full=Acetyl-coenzyme A synthetase;       
  118::613     2e-40  28%  650 aa  ACSA_BRASO RecName: Full=Acetyl-coenzyme A synthetase;       
  118::615     3e-40  29%  647 aa  ACSA_XANOM RecName: Full=Acetyl-coenzyme A synthetase;       
   83::142     3e-40  34%  542 aa  4CLL5_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 5;       
   82::616     3e-40  30%  652 aa  ACSA_SODGM RecName: Full=Acetyl-coenzyme A synthetase;       
  107::616     3e-40  29%  650 aa  ACSA_SHEON RecName: Full=Acetyl-coenzyme A synthetase;       
  104::613     4e-40  28%  645 aa  ACSA_HALHL RecName: Full=Acetyl-coenzyme A synthetase;       
  118::615     6e-40  30%  647 aa  ACSA_XANCP RecName: Full=Acetyl-coenzyme A synthetase;       
  118::615     6e-40  30%  647 aa  ACSA_XANC8 RecName: Full=Acetyl-coenzyme A synthetase;       
   54::533     6e-40  28%  542 aa  4CLL1_ARATH RecName: Full=4-coumarate--CoA ligase-like 1;       
 5649::6125    7e-40  29% 7756 aa  LGRC_BREPA RecName: Full=Linear gramicidin synthetase subunit
   91::546     1e-39  31%  558 aa  4CLL7_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 7;       
   96::615     4e-39  29%  647 aa  ACSA_XYLFA RecName: Full=Acetyl-coenzyme A synthetase;       
   96::615     5e-39  30%  647 aa  ACSA_XYLFT RecName: Full=Acetyl-coenzyme A synthetase;       
   88::614     8e-39  28%  645 aa  ACSA_BEII9 RecName: Full=Acetyl-coenzyme A synthetase;       
  105::616     1e-38  30%  649 aa  ACSA_VIBCH RecName: Full=Acetyl-coenzyme A synthetase;       
 1501::1992    3e-38  28% 2560 aa  PPSB_BACSU RecName: Full=Plipastatin synthetase subunit B;       
  119::616     3e-38  30%  652 aa  ACSA_YERPS RecName: Full=Acetyl-coenzyme A synthetase;       
  119::616     3e-38  30%  652 aa  ACSA_YERP3 RecName: Full=Acetyl-coenzyme A synthetase;       
   86::617     3e-38  27%  651 aa  ACSA_RHILO RecName: Full=Acetyl-coenzyme A synthetase;       
  118::614     4e-38  29%  646 aa  ACSA_PSEA6 RecName: Full=Acetyl-coenzyme A synthetase;       
  104::613     4e-38  27%  645 aa  ACSA_ALCBS RecName: Full=Acetyl-coenzyme A synthetase;       
  119::616     5e-38  30%  652 aa  ACSA_YERPP RecName: Full=Acetyl-coenzyme A synthetase;       
  119::616     5e-38  30%  652 aa  ACSA_YERPN RecName: Full=Acetyl-coenzyme A synthetase;       
  119::616     5e-38  30%  652 aa  ACSA_YERPE RecName: Full=Acetyl-coenzyme A synthetase;       
  119::616     5e-38  30%  652 aa  ACSA_YERPA RecName: Full=Acetyl-coenzyme A synthetase;       
  199::510     5e-38  35%  583 aa  4CLL2_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 2;       
  119::616     9e-38  30%  652 aa  ACSA_YERE8 RecName: Full=Acetyl-coenzyme A synthetase;       
   74::615     9e-38  28%  648 aa  ACSA_AERS4 RecName: Full=Acetyl-coenzyme A synthetase;       
  104::633     1e-37  30%  667 aa  ACSA_NEUCR RecName: Full=Acetyl-coenzyme A synthetase;       
  103::616     1e-37  28%  652 aa  ACSA_AGRRK RecName: Full=Acetyl-coenzyme A synthetase;       
   89::616     2e-37  28%  651 aa  ACSA_AGRT5 RecName: Full=Acetyl-coenzyme A synthetase;       
   74::615     2e-37  27%  648 aa  ACSA_AERHH RecName: Full=Acetyl-coenzyme A synthetase;       
  133::645     3e-37  28%  672 aa  ACSA_METSO RecName: Full=Acetyl-coenzyme A synthetase;       
   80::623     3e-37  29%  656 aa  ACSA_RHOCA RecName: Full=Acetyl-coenzyme A synthetase;       
  138::635     3e-37  31%  670 aa  ACSA_EMENI RecName: Full=Acetyl-coenzyme A synthetase;       
  104::613     4e-37  28%  644 aa  ACSA_MAGSM RecName: Full=Acetyl-coenzyme A synthetase;       
  138::643     6e-37  29%  671 aa  ACSA_RHOBA RecName: Full=Acetyl-coenzyme A synthetase;       
  118::614     8e-37  28%  645 aa  ACSA_METSB RecName: Full=Acetyl-coenzyme A synthetase;       
  114::627     1e-36  28%  661 aa  ACSA_LEPIN RecName: Full=Acetyl-coenzyme A synthetase;       
  114::627     1e-36  28%  661 aa  ACSA_LEPIC RecName: Full=Acetyl-coenzyme A synthetase;       
   75::616     1e-36  28%  652 aa  ACSA_ECOLI RecName: Full=Acetyl-coenzyme A synthetase;       
   75::616     1e-36  28%  652 aa  ACSA_ECOL6 RecName: Full=Acetyl-coenzyme A synthetase;       
  132::462     1e-36  32%  474 aa  MENE_STAEQ RecName: Full=2-succinylbenzoate--CoA ligase;       
   75::616     1e-36  27%  652 aa  ACSA_ENTS8 RecName: Full=Acetyl-coenzyme A synthetase;       
  101::616     1e-36  26%  652 aa  ACSA_BARHE RecName: Full=Acetyl-coenzyme A synthetase;       
   41::527     2e-36  26%  536 aa  ENTE_ECOLI RecName: Full=Enterobactin synthetase component
  105::617     2e-36  29%  650 aa  ACSA_VIBVY RecName: Full=Acetyl-coenzyme A synthetase;       
  105::617     2e-36  29%  650 aa  ACSA_VIBVU RecName: Full=Acetyl-coenzyme A synthetase;       
   75::616     2e-36  27%  652 aa  ACSA_CITK8 RecName: Full=Acetyl-coenzyme A synthetase;       
  112::626     4e-36  31%  654 aa  ACSA_CHRVO RecName: Full=Acetyl-coenzyme A synthetase;       
   75::622     5e-36  30%  654 aa  ACSA_GEMAT RecName: Full=Acetyl-coenzyme A synthetase;       
   41::527     6e-36  26%  536 aa  ENTE_ECO57 RecName: Full=Enterobactin synthetase component
  132::462     8e-36  31%  474 aa  MENE_STAES RecName: Full=2-succinylbenzoate--CoA ligase;       
   75::616     1e-35  29%  651 aa  ACSA_PHOLL RecName: Full=Acetyl-coenzyme A synthetase;       
  457::948     2e-35  29% 2378 aa  DHBF_BACSU RecName: Full=Dimodular nonribosomal peptide synthetase;
  107::620     2e-35  28%  654 aa  ACSA_LEPBJ RecName: Full=Acetyl-coenzyme A synthetase;       
  106::613     2e-35  27%  645 aa  ACSA_BDEBA RecName: Full=Acetyl-coenzyme A synthetase;       
  118::613     2e-35  25%  645 aa  ACSA_ALHEH RecName: Full=Acetyl-coenzyme A synthetase;       
 1509::1992    2e-35  29% 3587 aa  TYCB_BREPA RecName: Full=Tyrocidine synthetase 2;AltName:
   75::616     2e-35  27%  652 aa  ACSA_ECO57 RecName: Full=Acetyl-coenzyme A synthetase;       
  101::616     2e-35  28%  647 aa  ACSA_BART1 RecName: Full=Acetyl-coenzyme A synthetase;       
 3593::4074    3e-35  28% 4450 aa  GRSB_BREBE RecName: Full=Gramicidin S synthetase 2;AltName:
 2130::2601    3e-35  28% 5255 aa  BACA_BACLI RecName: Full=Bacitracin synthetase 1;       
  124::625     3e-35  29%  653 aa  ACSA_LARHH RecName: Full=Acetyl-coenzyme A synthetase;       
  101::616     4e-35  29%  650 aa  ACSA_SHESW RecName: Full=Acetyl-coenzyme A synthetase;       
  101::616     4e-35  29%  650 aa  ACSA_SHEPC RecName: Full=Acetyl-coenzyme A synthetase;       
  121::616     4e-35  29%  649 aa  ACSA_PHOPR RecName: Full=Acetyl-coenzyme A synthetase;       
   31::531     5e-35  27%  543 aa  VIBE_VIBCH RecName: Full=Vibriobactin-specific
  101::616     5e-35  28%  650 aa  ACSA_SHEB8 RecName: Full=Acetyl-coenzyme A synthetase;       
  101::616     5e-35  28%  650 aa  ACSA_SHEB5 RecName: Full=Acetyl-coenzyme A synthetase;       
  101::616     5e-35  27%  652 aa  ACSA_BARBK RecName: Full=Acetyl-coenzyme A synthetase;       
  186::596     5e-35  34%  609 aa  4CLL8_ORYSJ RecName: Full=Putative 4-coumarate--CoA ligase-like 8; 
 2404::2890    7e-35  30% 3649 aa  ACVS_NOCLA RecName:
  105::617     7e-35  29%  650 aa  ACSA_VIBPA RecName: Full=Acetyl-coenzyme A synthetase;       
  108::616     7e-35  27%  650 aa  ACSA_SHEHH RecName: Full=Acetyl-coenzyme A synthetase;       
 3594::4075    9e-35  28% 4451 aa  GRSB_ANEMI RecName: Full=Gramicidin S synthetase 2;AltName:
   95::625     9e-35  28%  654 aa  ACSA_METFK RecName: Full=Acetyl-coenzyme A synthetase;       
  108::620     9e-35  29%  652 aa  ACSA_MARMS RecName: Full=Acetyl-coenzyme A synthetase;       
  107::620     9e-35  28%  654 aa  ACSA_LEPBL RecName: Full=Acetyl-coenzyme A synthetase;       
  255::701     9e-35  29%  719 aa  AAS_SALTI RecName: Full=Bifunctional protein aas;Includes:
   75::616     1e-34  28%  652 aa  ACSA_SALTY RecName: Full=Acetyl-coenzyme A synthetase;       
   83::609     1e-34  27%  641 aa  ACSA_PRB01 RecName: Full=Acetyl-coenzyme A synthetase;       
  255::701     1e-34  29%  719 aa  AAS_SALSV RecName: Full=Bifunctional protein aas;Includes:
  255::701     1e-34  29%  719 aa  AAS_SALPB RecName: Full=Bifunctional protein aas;Includes:
  255::701     1e-34  29%  719 aa  AAS_SALHS RecName: Full=Bifunctional protein aas;Includes:
  255::701     1e-34  29%  719 aa  AAS_SALG2 RecName: Full=Bifunctional protein aas;Includes:
  255::701     1e-34  29%  719 aa  AAS_SALEP RecName: Full=Bifunctional protein aas;Includes:
  255::701     1e-34  29%  719 aa  AAS_SALA4 RecName: Full=Bifunctional protein aas;Includes:
  106::624     2e-34  28%  653 aa  ACSA_PASMU RecName: Full=Acetyl-coenzyme A synthetase;       
  255::701     2e-34  29%  719 aa  AAS_SALPC RecName: Full=Bifunctional protein aas;Includes:
  255::701     2e-34  29%  719 aa  AAS_SALCH RecName: Full=Bifunctional protein aas;Includes:
  109::618     2e-34  29%  651 aa  ACSA_SHEDO RecName: Full=Acetyl-coenzyme A synthetase;       
   75::616     2e-34  28%  652 aa  ACSA_SALTI RecName: Full=Acetyl-coenzyme A synthetase;       
  104::613     2e-34  29%  645 aa  ACSA_SACD2 RecName: Full=Acetyl-coenzyme A synthetase;       
  103::616     2e-34  26%  649 aa  ACSA_RHISN RecName: Full=Acetyl-coenzyme A synthetase;       
  255::701     2e-34  28%  719 aa  AAS_SALTY RecName: Full=Bifunctional protein aas;Includes:
  255::701     2e-34  28%  719 aa  AAS_SALPK RecName: Full=Bifunctional protein aas;Includes:
  255::701     2e-34  28%  719 aa  AAS_SALPA RecName: Full=Bifunctional protein aas;Includes:
  255::701     2e-34  28%  719 aa  AAS_SALNS RecName: Full=Bifunctional protein aas;Includes:
  255::701     2e-34  28%  719 aa  AAS_ENT38 RecName: Full=Bifunctional protein aas;Includes:
 4098::4585    3e-34  30% 5162 aa  LGRB_BREPA RecName: Full=Linear gramicidin synthetase subunit
  103::616     3e-34  26%  651 aa  ACSA_RHIE6 RecName: Full=Acetyl-coenzyme A synthetase;       
  101::616     5e-34  28%  650 aa  ACSA_SHEB9 RecName: Full=Acetyl-coenzyme A synthetase;       
  120::614     6e-34  28%  646 aa  ACSA_PSEHT RecName: Full=Acetyl-coenzyme A synthetase;       
  101::616     6e-34  26%  652 aa  ACSA_BARQU RecName: Full=Acetyl-coenzyme A synthetase;       
   89::616     6e-34  28%  651 aa  ACSA_AGRVS RecName: Full=Acetyl-coenzyme A synthetase;       
  117::612     6e-34  27%  644 aa  ACSA2_PSEPK RecName: Full=Acetyl-coenzyme A synthetase 2;       
  103::616     8e-34  26%  651 aa  ACSA_RHIEC RecName: Full=Acetyl-coenzyme A synthetase;       
  120::633     8e-34  29%  670 aa  ACSA_PYRAE RecName: Full=Acetyl-coenzyme A synthetase;       
  470::946     1e-33  26% 5085 aa  LGRD_BREPA RecName: Full=Linear gramicidin synthetase subunit
  255::701     1e-33  28%  719 aa  AAS_SALDC RecName: Full=Bifunctional protein aas;Includes:
  254::701     1e-33  29%  719 aa  AAS_ENTS8 RecName: Full=Bifunctional protein aas;Includes:
   74::617     1e-33  27%  649 aa  ACSA_MARAV RecName: Full=Acetyl-coenzyme A synthetase;       
  107::620     1e-33  27%  654 aa  ACSA_LEPBP RecName: Full=Acetyl-coenzyme A synthetase;       
  107::620     1e-33  27%  654 aa  ACSA_LEPBA RecName: Full=Acetyl-coenzyme A synthetase;       
 5658::6147    2e-33  28% 6486 aa  TYCC_BREPA RecName: Full=Tyrocidine synthetase 3;AltName:
  461::956     2e-33  30% 3587 aa  SRFAA_BACSU RecName: Full=Surfactin synthetase subunit 1;
  106::612     2e-33  28%  647 aa  ACSA_SYNAS RecName: Full=Acetyl-coenzyme A synthetase;       
  255::701     2e-33  28%  719 aa  AAS_KLEP3 RecName: Full=Bifunctional protein aas;Includes:
  108::616     3e-33  27%  650 aa  ACSA_SHEPA RecName: Full=Acetyl-coenzyme A synthetase;       
  103::616     3e-33  26%  651 aa  ACSA_RHILW RecName: Full=Acetyl-coenzyme A synthetase;       
  255::701     4e-33  28%  719 aa  AAS_SHISS RecName: Full=Bifunctional protein aas;Includes:
  255::701     4e-33  28%  719 aa  AAS_SHIFL RecName: Full=Bifunctional protein aas;Includes:
  255::701     4e-33  28%  719 aa  AAS_SHIF8 RecName: Full=Bifunctional protein aas;Includes:
  255::701     4e-33  28%  719 aa  AAS_SHIB3 RecName: Full=Bifunctional protein aas;Includes:
  255::701     4e-33  28%  719 aa  AAS_ECOSE RecName: Full=Bifunctional protein aas;Includes:
  255::701     4e-33  28%  719 aa  AAS_ECOLC RecName: Full=Bifunctional protein aas;Includes:
  255::701     4e-33  28%  719 aa  AAS_ECOHS RecName: Full=Bifunctional protein aas;Includes:
  255::701     4e-33  28%  719 aa  AAS_ECO5E RecName: Full=Bifunctional protein aas;Includes:
  255::701     4e-33  28%  719 aa  AAS_ECO57 RecName: Full=Bifunctional protein aas;Includes:
  255::701     4e-33  28%  719 aa  AAS_ECO55 RecName: Full=Bifunctional protein aas;Includes:
  255::701     4e-33  28%  719 aa  AAS_ECO24 RecName: Full=Bifunctional protein aas;Includes:
  110::628     5e-33  30%  656 aa  ACSA_THEEB RecName: Full=Acetyl-coenzyme A synthetase;       
  255::701     5e-33  28%  719 aa  AAS_ECOLU RecName: Full=Bifunctional protein aas;Includes:
  255::701     7e-33  28%  719 aa  AAS_ECOLI RecName: Full=Bifunctional protein aas;Includes:
  255::701     7e-33  28%  719 aa  AAS_ECODH RecName: Full=Bifunctional protein aas;Includes:
  255::701     7e-33  28%  719 aa  AAS_ECOBW RecName: Full=Bifunctional protein aas;Includes:
  255::701     7e-33  28%  719 aa  AAS_ECO7I RecName: Full=Bifunctional protein aas;Includes:
 2535::3014    9e-33  29% 3603 aa  PPSD_BACSU RecName: Full=Plipastatin synthetase subunit D;       
 5552::6027    9e-33  29% 6359 aa  BACC_BACLI RecName: Full=Bacitracin synthetase 3;       
  108::616     9e-33  27%  650 aa  ACSA_SHESH RecName: Full=Acetyl-coenzyme A synthetase;       
   91::625     9e-33  28%  662 aa  ACSA_SCHPO RecName: Full=Probable acetyl-coenzyme A synthetase;    
  121::616     9e-33  27%  651 aa  ACSA1_PSEAE RecName: Full=Acetyl-coenzyme A synthetase 1;       
  255::701     9e-33  28%  719 aa  AAS_ECOSM RecName: Full=Bifunctional protein aas;Includes:
  255::701     9e-33  28%  719 aa  AAS_ECOL6 RecName: Full=Bifunctional protein aas;Includes:
  255::701     9e-33  28%  719 aa  AAS_ECO27 RecName: Full=Bifunctional protein aas;Includes:
  265::774     1e-32  27% 3712 aa  ACVS_CEPAC RecName:
  253::701     1e-32  28%  719 aa  AAS_KLEP7 RecName: Full=Bifunctional protein aas;Includes:
  255::701     1e-32  28%  719 aa  AAS_ESCF3 RecName: Full=Bifunctional protein aas;Includes:
  255::701     1e-32  28%  719 aa  AAS_ECOUT RecName: Full=Bifunctional protein aas;Includes:
  255::701     1e-32  28%  719 aa  AAS_ECOK1 RecName: Full=Bifunctional protein aas;Includes:
  255::701     1e-32  28%  719 aa  AAS_ECO45 RecName: Full=Bifunctional protein aas;Includes:
   97::627     2e-32  28%  655 aa  ACSA_NITEU RecName: Full=Acetyl-coenzyme A synthetase;       
  107::641     3e-32  28%  675 aa  ACS1_CANAL RecName: Full=Acetyl-coenzyme A synthetase 1;       
  106::634     4e-32  29%  669 aa  ACSA_PENCH RecName: Full=Acetyl-coenzyme A synthetase;       
  103::616     4e-32  27%  652 aa  ACSA_AGRRH RecName: Full=Acetyl-coenzyme A synthetase;       
  327::834     6e-32  26% 3791 aa  ACVS2_PENCH RecName:
  297::804     6e-32  26% 3746 aa  ACVS1_PENCH RecName:
   75::616     6e-32  28%  652 aa  ACSA_SERP5 RecName: Full=Acetyl-coenzyme A synthetase;       
  255::701     6e-32  27%  719 aa  AAS_ECOL5 RecName: Full=Bifunctional protein aas;Includes:
  103::616     7e-32  26%  649 aa  ACSA2_RHIME RecName: Full=Acetyl-coenzyme A synthetase 2;       
  103::616     1e-31  26%  649 aa  ACSA_SINMW RecName: Full=Acetyl-coenzyme A synthetase;       
   85::612     1e-31  27%  644 aa  ACSA_RUBXD RecName: Full=Acetyl-coenzyme A synthetase;       
  101::642     1e-31  28%  682 aa  ACS2L_MOUSE RecName: Full=Acetyl-coenzyme A synthetase 2-like,
  261::616     1e-31  31%  651 aa  ACSA_PSESM RecName: Full=Acetyl-coenzyme A synthetase;       
  111::627     1e-31  29%  655 aa  ACSA_NITEC RecName: Full=Acetyl-coenzyme A synthetase;       
  109::615     1e-31  26%  647 aa  ACSA_CAUCR RecName: Full=Acetyl-coenzyme A synthetase;       
  365::701     1e-31  33%  723 aa  AAS_PECCP RecName: Full=Bifunctional protein aas;Includes:
   71::580     2e-31  31%  667 aa  FCSA_DICDI RecName: Full=Fatty acyl-CoA synthetase A;       
  261::616     2e-31  31%  651 aa  ACSA_PSE14 RecName: Full=Acetyl-coenzyme A synthetase;       
  256::616     3e-31  31%  653 aa  ACSA1_PSEPK RecName: Full=Acetyl-coenzyme A synthetase 1;       
  247::701     3e-31  29%  719 aa  AAS_ERWT9 RecName: Full=Bifunctional protein aas;Includes:
  261::616     4e-31  31%  651 aa  ACSA_PSEU2 RecName: Full=Acetyl-coenzyme A synthetase;       
  365::701     4e-31  33%  738 aa  AAS_ERWCT RecName: Full=Bifunctional protein aas;Includes:
  255::701     4e-31  27%  719 aa  AAS_CITK8 RecName: Full=Bifunctional protein aas;Includes:
  108::616     8e-31  26%  650 aa  ACSA_SHELP RecName: Full=Acetyl-coenzyme A synthetase;       
  247::701     8e-31  28%  718 aa  AAS_YERE8 RecName: Full=Bifunctional protein aas;Includes:
  124::635     1e-30  28%  671 aa  ACS2_CANAL RecName: Full=Acetyl-coenzyme A synthetase 2;       
  122::616     1e-30  31%  699 aa  ACSL1_MOUSE RecName: Full=Long-chain-fatty-acid--CoA ligase 1;     
  129::637     1e-30  29%  670 aa  ACSA_DROME RecName: Full=Acetyl-coenzyme A synthetase;       
  108::649     2e-30  28%  689 aa  ACS2L_HUMAN RecName: Full=Acetyl-coenzyme A synthetase 2-like,
  463::947     4e-30  30% 2561 aa  PPSA_BACSU RecName: Full=Plipastatin synthetase subunit A;       
  247::701     4e-30  29%  718 aa  AAS_YERPY RecName: Full=Bifunctional protein aas;Includes:
  247::701     4e-30  29%  718 aa  AAS_YERPS RecName: Full=Bifunctional protein aas;Includes:
  247::701     4e-30  29%  718 aa  AAS_YERPP RecName: Full=Bifunctional protein aas;Includes:
  247::701     4e-30  29%  718 aa  AAS_YERPG RecName: Full=Bifunctional protein aas;Includes:
  247::701     4e-30  29%  718 aa  AAS_YERPB RecName: Full=Bifunctional protein aas;Includes:
  247::701     4e-30  29%  718 aa  AAS_YERP3 RecName: Full=Bifunctional protein aas;Includes:
  135::643     5e-30  29%  679 aa  ACS2_DEBHA RecName: Full=Acetyl-coenzyme A synthetase 2;       
  102::624     7e-30  28%  651 aa  ACSA_MYCTU RecName: Full=Acetyl-coenzyme A synthetase;       
  102::624     7e-30  28%  651 aa  ACSA_MYCBO RecName: Full=Acetyl-coenzyme A synthetase;       
  469::953     9e-30  29% 2555 aa  PPSC_BACSU RecName: Full=Plipastatin synthetase subunit C;       
  121::615     2e-29  30%  698 aa  ACSL1_CAVPO RecName: Full=Long-chain-fatty-acid--CoA ligase 1;     
   77::618     2e-29  25%  655 aa  ACSA_PSYCK RecName: Full=Acetyl-coenzyme A synthetase;       
  207::677     2e-29  28% 2273 aa  LGRA_BREPA RecName: Full=Linear gramicidin synthetase subunit
  321::831     3e-29  26% 3770 aa  ACVS_EMENI RecName:
  247::701     3e-29  29%  718 aa  AAS_YERPE RecName: Full=Bifunctional protein aas;Includes:
  247::701     3e-29  29%  718 aa  AAS_YERPA RecName: Full=Bifunctional protein aas;Includes:
  109::626     3e-29  27%  653 aa  ACSA_SYNY3 RecName: Full=Acetyl-coenzyme A synthetase;       
   94::628     5e-29  27%  661 aa  ACSA_COPCI RecName: Full=Acetyl-coenzyme A synthetase;       
  138::637     5e-29  28%  671 aa  ACS1_DEBHA RecName: Full=Acetyl-coenzyme A synthetase 1;       
   56::572     6e-29  30%  620 aa  S27A2_RAT RecName: Full=Very long-chain acyl-CoA synthetase;       
  254::615     6e-29  34%  697 aa  ACSL6_RAT RecName: Full=Long-chain-fatty-acid--CoA ligase 6;       
  255::615     6e-29  35%  697 aa  ACSL6_HUMAN RecName: Full=Long-chain-fatty-acid--CoA ligase 6;     
  122::616     6e-29  30%  699 aa  ACSL1_RAT RecName: Full=Long-chain-fatty-acid--CoA ligase 1;       
  105::617     6e-29  28%  651 aa  ACSA_STRCO RecName: Full=Acetyl-coenzyme A synthetase;       
  263::775     8e-29  31%  805 aa  ACVS_STRCL RecName:
  121::615     8e-29  31%  698 aa  ACSL1_HUMAN RecName: Full=Long-chain-fatty-acid--CoA ligase 1;     
   32::512     1e-28  28% 1088 aa  TYCA_BREPA RecName: Full=Tyrocidine synthetase 1;AltName:
  126::619     1e-28  26%  649 aa  ACSA_DEIRA RecName: Full=Acetyl-coenzyme A synthetase;       
 2947::3427    1e-28  26% 3971 aa  MYCA_BACSU RecName: Full=Mycosubtilin synthetase subunit A;       
  113::632     2e-28  28%  660 aa  ACSA_RALEJ RecName: Full=Acetyl-coenzyme A synthetase;       
 1553::2044    3e-28  26% 2607 aa  BACB_BACLI RecName: Full=Bacitracin synthetase 2;       
   94::628     3e-28  28%  661 aa  ACSA_COPC7 RecName: Full=Acetyl-coenzyme A synthetase;       
  266::757     4e-28  29% 2609 aa  MYCC_BACSU RecName: Full=Mycosubtilin synthetase subunit C;        
  255::615     4e-28  34%  697 aa  ACSL6_MOUSE RecName: Full=Long-chain-fatty-acid--CoA ligase 6;     
   77::618     4e-28  25%  653 aa  ACSA_PSYA2 RecName: Full=Acetyl-coenzyme A synthetase;       
  129::635     7e-28  28%  674 aa  ACSA_DICDI RecName: Full=Acetyl-coenzyme A synthetase;       
  148::619     8e-28  31%  667 aa  S27A3_MOUSE RecName: Full=Long-chain fatty acid transport protein
 1499::1984    1e-27  27% 3583 aa  SRFAB_BACSU RecName: Full=Surfactin synthetase subunit 2;
   44::523     1e-27  28% 1098 aa  GRSA_BREBE RecName: Full=Gramicidin S synthetase 1;AltName:
   81::626     1e-27  26%  655 aa  ACSA_THIDA RecName: Full=Acetyl-coenzyme A synthetase;       
  106::645     1e-27  27%  683 aa  ACS2_CANGA RecName: Full=Acetyl-coenzyme A synthetase 2;       
   63::572     2e-27  30%  620 aa  S27A2_MOUSE RecName: Full=Very long-chain acyl-CoA synthetase;     
  125::619     3e-27  28%  648 aa  ACSA_THET2 RecName: Full=Acetyl-coenzyme A synthetase;       
  466::954     4e-27  30% 1275 aa  SRFAC_BACSU RecName: Full=Surfactin synthetase subunit 3;
   94::599     4e-27  30%  628 aa  PRPE_SALTY RecName: Full=Propionate--CoA ligase;       
   44::523     4e-27  28% 1098 aa  GRSA_ANEMI RecName: Full=Gramicidin S synthetase 1;AltName:
  125::619     4e-27  28%  648 aa  ACSA_THET8 RecName: Full=Acetyl-coenzyme A synthetase;       
  113::632     6e-27  28%  660 aa  ACSA_RALEH RecName: Full=Acetyl-coenzyme A synthetase;       
  131::676     6e-27  26%  707 aa  ACS1_KLULA RecName: Full=Acetyl-coenzyme A synthetase 1;       
   36::511     7e-27  28%  520 aa  BAIB_EUBSP RecName: Full=Bile acid-coenzyme A ligase;       
  121::616     7e-27  25%  651 aa  ACSA_PSEU5 RecName: Full=Acetyl-coenzyme A synthetase;       
  113::632     2e-26  27%  660 aa  ACSA_RALSO RecName: Full=Acetyl-coenzyme A synthetase;       
  100::632     2e-26  26%  672 aa  ACSA_PHYBL RecName: Full=Acetyl-coenzyme A synthetase;       
  166::673     2e-26  28%  704 aa  ACS1_CANGA RecName: Full=Acetyl-coenzyme A synthetase 1;       
  113::632     2e-26  28%  660 aa  ACSA_RALME RecName: Full=Acetyl-coenzyme A synthetase;       
  133::636     2e-26  27%  675 aa  ACS2_ZYGBA RecName: Full=Acetyl-coenzyme A synthetase 2;       
   94::599     3e-26  29%  628 aa  PRPE_ECOLI RecName: Full=Propionate--CoA ligase;       
   98::632     3e-26  29%  660 aa  ACSA_BURS3 RecName: Full=Acetyl-coenzyme A synthetase;       
    1::498     5e-26  28%  504 aa  DLTA_BACC2 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  115::645     5e-26  28%  684 aa  ACS2_KLULA RecName: Full=Acetyl-coenzyme A synthetase 2;       
    7::498     6e-26  28%  504 aa  DLTA_BACCR RecName: Full=D-alanine--poly(phosphoribitol) ligase
    7::498     6e-26  28%  504 aa  DLTA_BACC4 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  103::618     6e-26  25%  651 aa  ACSA_OCHA4 RecName: Full=Acetyl-coenzyme A synthetase;       
  118::663     6e-26  27%  694 aa  ACS1_ASHGO RecName: Full=Acetyl-coenzyme A synthetase 1;       
   53::500     8e-26  30%  607 aa  LCFH_HAEIN RecName: Full=Putative long-chain-fatty-acid--CoA
  133::644     8e-26  28%  683 aa  ACS2_YEAST RecName: Full=Acetyl-coenzyme A synthetase 2;       
  142::682     8e-26  29%  713 aa  ACS1_YEAST RecName: Full=Acetyl-coenzyme A synthetase 1;       
  106::583     1e-25  29%  683 aa  ACSL5_HUMAN RecName: Full=Long-chain-fatty-acid--CoA ligase 5;     
  113::632     1e-25  28%  660 aa  ACSA_CUPTR RecName: Full=Acetyl-coenzyme A synthetase;       
  133::601     1e-25  29%  724 aa  ACBG1_HUMAN RecName: Full=Long-chain-fatty-acid--CoA ligase ACSBG1;
   63::578     2e-25  29%  620 aa  S27A2_HUMAN RecName: Full=Very long-chain acyl-CoA synthetase;     
    7::498     2e-25  28%  504 aa  DLTA_BACWK RecName: Full=D-alanine--poly(phosphoribitol) ligase
    7::498     2e-25  28%  504 aa  DLTA_BACC1 RecName: Full=D-alanine--poly(phosphoribitol) ligase
    7::498     3e-25  28%  504 aa  DLTA_BACHK RecName: Full=D-alanine--poly(phosphoribitol) ligase
    7::498     3e-25  28%  504 aa  DLTA_BACC3 RecName: Full=D-alanine--poly(phosphoribitol) ligase
    7::498     3e-25  28%  504 aa  DLTA_BACC0 RecName: Full=D-alanine--poly(phosphoribitol) ligase
    7::498     3e-25  28%  504 aa  DLTA_BACAH RecName: Full=D-alanine--poly(phosphoribitol) ligase
  120::633     3e-25  28%  670 aa  ACSA_PYRAR RecName: Full=Acetyl-coenzyme A synthetase;       
  457::958     4e-25  26% 1293 aa  ENTF_ECO57 RecName: Full=Enterobactin synthetase component F;      
    7::498     4e-25  28%  504 aa  DLTA_BACCZ RecName: Full=D-alanine--poly(phosphoribitol) ligase
    7::498     4e-25  28%  504 aa  DLTA_BACCQ RecName: Full=D-alanine--poly(phosphoribitol) ligase
    7::497     4e-25  28%  503 aa  DLTA_BACAN RecName: Full=D-alanine--poly(phosphoribitol) ligase
    7::497     4e-25  28%  503 aa  DLTA_BACAC RecName: Full=D-alanine--poly(phosphoribitol) ligase
    7::497     4e-25  28%  503 aa  DLTA_BACAA RecName: Full=D-alanine--poly(phosphoribitol) ligase
  157::660     4e-25  26%  694 aa  ACSA_CRYPV RecName: Full=Acetyl-coenzyme A synthetase;       
  115::649     4e-25  28%  687 aa  ACS2_ASHGO RecName: Full=Acetyl-coenzyme A synthetase 2;       
  129::598     4e-25  29%  721 aa  ACBG1_RAT RecName: Full=Long-chain-fatty-acid--CoA ligase ACSBG1;  
  481::955     5e-25  28% 1279 aa  PPSE_BACSU RecName: Full=Plipastatin synthetase subunit E;       
    7::498     5e-25  28%  504 aa  DLTA_BACC7 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  133::601     5e-25  29%  724 aa  ACBG1_MACFA RecName: Full=Long-chain-fatty-acid--CoA ligase ACSBG1;
   98::632     7e-25  28%  660 aa  ACSA_BURP8 RecName: Full=Acetyl-coenzyme A synthetase;       
  129::598     7e-25  29%  721 aa  ACBG1_MOUSE RecName: Full=Long-chain-fatty-acid--CoA ligase ACSBG1;
  190::648     9e-25  30%  690 aa  S27A5_RAT RecName: Full=Bile acyl-CoA synthetase;       
  113::632     1e-24  26%  660 aa  ACSA_RALPJ RecName: Full=Acetyl-coenzyme A synthetase;       
  267::632     1e-24  30%  660 aa  ACSA_HERAR RecName: Full=Acetyl-coenzyme A synthetase;       
  209::620     2e-24  28%  639 aa  AAS_PHOLL RecName: Full=Bifunctional protein aas;Includes:
  243::579     3e-24  35%  689 aa  LCF2_SCHPO RecName: Full=Long-chain-fatty-acid--CoA ligase 2;      
  253::583     3e-24  35%  683 aa  ACSL5_MOUSE RecName: Full=Long-chain-fatty-acid--CoA ligase 5;     
  461::962     4e-24  26% 1281 aa  ENTF_SHIFL RecName: Full=Enterobactin synthetase component F;      
  457::958     4e-24  26% 1293 aa  ENTF_ECOLI RecName: Full=Enterobactin synthetase component F;      
    7::498     4e-24  28%  504 aa  DLTA_BACCN RecName: Full=D-alanine--poly(phosphoribitol) ligase
   15::423     6e-24  31%  455 aa  MENE_SALTY RecName: Full=2-succinylbenzoate--CoA ligase;       
  147::668     6e-24  28%  701 aa  ACSA_HUMAN RecName: Full=Acetyl-coenzyme A synthetase, cytoplasmic;
  189::647     7e-24  31%  689 aa  S27A5_MOUSE RecName: Full=Bile acyl-CoA synthetase;       
  253::583     7e-24  33%  683 aa  ACSL5_RAT RecName: Full=Long-chain-fatty-acid--CoA ligase 5;       
  142::421     1e-23  33%  451 aa  MENE_ECOLI RecName: Full=2-succinylbenzoate--CoA ligase;       
   87::605     1e-23  29%  646 aa  S27A1_BOVIN RecName: Full=Long-chain fatty acid transport protein
  103::618     1e-23  24%  651 aa  ACSA_BRUSU RecName: Full=Acetyl-coenzyme A synthetase;       
  103::618     1e-23  24%  651 aa  ACSA_BRUSI RecName: Full=Acetyl-coenzyme A synthetase;       
  103::618     1e-23  24%  651 aa  ACSA_BRUO2 RecName: Full=Acetyl-coenzyme A synthetase;       
  103::618     1e-23  24%  651 aa  ACSA_BRUME RecName: Full=Acetyl-coenzyme A synthetase;       
  103::618     1e-23  24%  651 aa  ACSA_BRUC2 RecName: Full=Acetyl-coenzyme A synthetase;       
  103::618     1e-23  24%  651 aa  ACSA_BRUAB RecName: Full=Acetyl-coenzyme A synthetase;       
  103::618     1e-23  24%  651 aa  ACSA_BRUA2 RecName: Full=Acetyl-coenzyme A synthetase;       
  103::618     1e-23  24%  651 aa  ACSA_BRUA1 RecName: Full=Acetyl-coenzyme A synthetase;       
   64::577     3e-23  28%  619 aa  S27A6_HUMAN RecName: Full=Long-chain fatty acid transport protein
   98::632     3e-23  27%  660 aa  ACSA_BURTA RecName: Full=Acetyl-coenzyme A synthetase;       
   78::602     4e-23  28%  643 aa  S27A4_MACFA RecName: Full=Long-chain fatty acid transport protein
   98::632     5e-23  27%  660 aa  ACSA_BURPS RecName: Full=Acetyl-coenzyme A synthetase;       
   98::632     5e-23  27%  660 aa  ACSA_BURP6 RecName: Full=Acetyl-coenzyme A synthetase;       
   98::632     5e-23  27%  660 aa  ACSA_BURP1 RecName: Full=Acetyl-coenzyme A synthetase;       
   98::632     5e-23  27%  660 aa  ACSA_BURP0 RecName: Full=Acetyl-coenzyme A synthetase;       
   98::632     5e-23  27%  660 aa  ACSA_BURMS RecName: Full=Acetyl-coenzyme A synthetase;       
   98::632     5e-23  27%  660 aa  ACSA_BURMA RecName: Full=Acetyl-coenzyme A synthetase;       
   98::632     5e-23  27%  660 aa  ACSA_BURM9 RecName: Full=Acetyl-coenzyme A synthetase;       
   98::632     5e-23  27%  660 aa  ACSA_BURM7 RecName: Full=Acetyl-coenzyme A synthetase;       
   11::497     8e-23  27%  502 aa  DLTA_BACLD RecName: Full=D-alanine--poly(phosphoribitol) ligase
   78::602     1e-22  28%  643 aa  S27A4_MOUSE RecName: Full=Long-chain fatty acid transport protein
  103::618     1e-22  24%  651 aa  ACSA_BRUMB RecName: Full=Acetyl-coenzyme A synthetase;       
   78::602     2e-22  28%  643 aa  S27A4_HUMAN RecName: Full=Long-chain fatty acid transport protein
 1159::1640    2e-22  28% 5043 aa  PKSJ_BACSU RecName: Full=Polyketide synthase pksJ;         Short=PKS;
  133::449     3e-22  28%  458 aa  VRAA_STAAR RecName: Full=Putative long chain fatty acid-CoA ligase
  142::500     3e-22  30%  512 aa  DLTA_STRPC RecName: Full=D-alanine--poly(phosphoribitol) ligase
  142::500     3e-22  30%  512 aa  DLTA_STRP6 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  142::500     3e-22  30%  512 aa  DLTA_STRP3 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  142::500     3e-22  30%  512 aa  DLTA_STRP1 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  142::500     4e-22  30%  512 aa  DLTA_STRPZ RecName: Full=D-alanine--poly(phosphoribitol) ligase
  142::500     4e-22  30%  512 aa  DLTA_STRPM RecName: Full=D-alanine--poly(phosphoribitol) ligase
  142::500     4e-22  30%  512 aa  DLTA_STRPG RecName: Full=D-alanine--poly(phosphoribitol) ligase
  142::500     4e-22  30%  512 aa  DLTA_STRPF RecName: Full=D-alanine--poly(phosphoribitol) ligase
  142::500     4e-22  30%  512 aa  DLTA_STRPD RecName: Full=D-alanine--poly(phosphoribitol) ligase
  142::500     4e-22  30%  512 aa  DLTA_STRP8 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  147::668     4e-22  26%  701 aa  ACSA_MOUSE RecName: Full=Acetyl-coenzyme A synthetase, cytoplasmic;
  550::1031    5e-22  27% 1167 aa  MBTB_MYCSS RecName: Full=Phenyloxazoline synthase mbtB;       
  116::584     5e-22  28%  726 aa  ACBG1_BOVIN RecName: Full=Long-chain-fatty-acid--CoA ligase ACSBG1;
 4344::4825    7e-22  24% 5369 aa  MYCB_BACSU RecName: Full=Mycosubtilin synthetase subunit B;       
  278::601     1e-21  33%  763 aa  ACBG2_CHICK RecName: Full=Long-chain-fatty-acid--CoA ligase ACSBG2;
  133::449     3e-21  28%  458 aa  VRAA_STAAW RecName: Full=Putative long chain fatty acid-CoA ligase
  133::449     3e-21  28%  458 aa  VRAA_STAAS RecName: Full=Putative long chain fatty acid-CoA ligase
  133::449     3e-21  28%  458 aa  VRAA_STAAN RecName: Full=Putative long chain fatty acid-CoA ligase
  133::449     3e-21  28%  458 aa  VRAA_STAAM RecName: Full=Putative long chain fatty acid-CoA ligase
  133::449     3e-21  28%  458 aa  VRAA_STAAC RecName: Full=Putative long chain fatty acid-CoA ligase
  133::449     3e-21  28%  458 aa  VRAA_STAA1 RecName: Full=Putative long chain fatty acid-CoA ligase
  217::682     3e-21  29%  730 aa  S27A3_HUMAN RecName: Full=Long-chain fatty acid transport protein
  111::451     3e-21  35%  571 aa  FAD11_MYCTU RecName: Full=Putative fatty-acid--CoA ligase fadD11;  
   93::630     5e-21  26%  662 aa  ACSA_HELPH RecName: Full=Acetyl-coenzyme A synthetase;       
  119::451     1e-20  29%  461 aa  VRAA_STAHJ RecName: Full=Putative long chain fatty acid-CoA ligase
   78::602     1e-20  28%  643 aa  S27A4_PONAB RecName: Full=Long-chain fatty acid transport protein
   13::504     1e-20  27%  510 aa  DLTA_LISMF RecName: Full=D-alanine--poly(phosphoribitol) ligase
   93::630     1e-20  25%  662 aa  ACSA_HELPG RecName: Full=Acetyl-coenzyme A synthetase;       
   93::630     1e-20  25%  662 aa  ACSA_HELP2 RecName: Full=Acetyl-coenzyme A synthetase;       
  471::968     1e-20  24% 5488 aa  PKSN_BACSU RecName: Full=Polyketide synthase pksN;       
   93::630     1e-20  25%  662 aa  ACSA_HELPY RecName: Full=Acetyl-coenzyme A synthetase;       
   13::504     2e-20  27%  510 aa  DLTA_LISMO RecName: Full=D-alanine--poly(phosphoribitol) ligase
   13::504     2e-20  27%  510 aa  DLTA_LISMC RecName: Full=D-alanine--poly(phosphoribitol) ligase
  142::500     2e-20  31%  512 aa  DLTA_STRE4 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  284::607     2e-20  34%  739 aa  ACBG2_XENLA RecName: Full=Long-chain-fatty-acid--CoA ligase ACSBG2;
 1425::1921    3e-20  31% 4114 aa  SID2_USTMA RecName: Full=Ferrichrome siderophore peptide synthetase; 
   13::504     3e-20  28%  510 aa  DLTA_LISMH RecName: Full=D-alanine--poly(phosphoribitol) ligase
   13::504     3e-20  28%  510 aa  DLTA_LISIN RecName: Full=D-alanine--poly(phosphoribitol) ligase
  154::655     3e-20  24%  686 aa  ACSS3_PONAB RecName: Full=Acyl-CoA synthetase short-chain family
  154::655     3e-20  24%  686 aa  ACSS3_HUMAN RecName: Full=Acyl-CoA synthetase short-chain family
   69::497     4e-20  30%  503 aa  DLTA_BACA2 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  211::542     4e-20  32%  681 aa  BGML_DROME RecName: Full=Long-chain-fatty-acid--CoA ligase
   93::630     4e-20  25%  662 aa  ACSA_HELAH RecName: Full=Acetyl-coenzyme A synthetase;       
  217::547     4e-20  34%  667 aa  ACBG2_MOUSE RecName: Full=Long-chain-fatty-acid--CoA ligase ACSBG2;
   76::583     5e-20  30%  676 aa  LCF1_SCHPO RecName: Full=Long-chain-fatty-acid--CoA ligase 1;      
  290::648     7e-20  32%  690 aa  S27A5_HUMAN RecName: Full=Bile acyl-CoA synthetase;       
  146::504     7e-20  27%  516 aa  DLTA_STRMU RecName: Full=D-alanine--poly(phosphoribitol) ligase
   87::605     9e-20  28%  646 aa  S27A1_HUMAN RecName: Full=Long-chain fatty acid transport protein
  108::582     9e-20  29%  700 aa  LCF1_YEAST RecName: Full=Long-chain-fatty-acid--CoA ligase 1;      
  467::943     1e-19  26% 1048 aa  ANGR_VIBAN RecName: Full=Protein angR;
  122::628     1e-19  23%  659 aa  ACSA_CHLTE RecName: Full=Acetyl-coenzyme A synthetase;       
  293::650     2e-19  28%  688 aa  ACSB_DICDI RecName: Full=Acyl-CoA synthetase short-chain family
  147::513     2e-19  29%  521 aa  MBTM_MYCSS RecName:
   13::504     2e-19  27%  510 aa  DLTA_LISW6 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  124::445     3e-19  27%  453 aa  VRAA_STAEQ RecName: Full=Putative long chain fatty acid-CoA ligase
  221::546     4e-19  30%  666 aa  BGM_DROME RecName: Full=Very long-chain-fatty-acid--CoA ligase
  139::650     4e-19  23%  682 aa  ACSS3_MOUSE RecName: Full=Acyl-CoA synthetase short-chain family
   63::497     6e-19  29%  503 aa  DLTA_BACSU RecName: Full=D-alanine--poly(phosphoribitol) ligase
  143::500     7e-19  28%  506 aa  DLTA_LACCB RecName: Full=D-alanine--poly(phosphoribitol) ligase
  143::500     7e-19  28%  506 aa  DLTA_LACC3 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  217::547     9e-19  34%  667 aa  ACBG2_RAT RecName: Full=Long-chain-fatty-acid--CoA ligase ACSBG2;  
   11::562     1e-18  30%  583 aa  FAD26_MYCTU RecName: Full=Putative fatty-acid--CoA ligase fadD26;  
  280::627     1e-18  33%  720 aa  ACSL3_PONAB RecName: Full=Long-chain-fatty-acid--CoA ligase 3;     
  280::627     1e-18  33%  720 aa  ACSL3_HUMAN RecName: Full=Long-chain-fatty-acid--CoA ligase 3;     
  243::566     2e-18  31%  673 aa  FCSB_DICDI RecName: Full=Fatty acyl-CoA synthetase B;       
  673::1035    2e-18  27% 1165 aa  MBTB_MYCPA RecName: Full=Phenyloxazoline synthase mbtB;       
   98::504     2e-18  30%  516 aa  DLTA_STRZP RecName: Full=D-alanine--poly(phosphoribitol) ligase
   98::504     2e-18  30%  516 aa  DLTA_STRR6 RecName: Full=D-alanine--poly(phosphoribitol) ligase
   98::504     2e-18  30%  516 aa  DLTA_STRPN RecName: Full=D-alanine--poly(phosphoribitol) ligase
   98::504     2e-18  30%  516 aa  DLTA_STRP2 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  126::496     2e-18  31%  508 aa  DLTA_LACPL RecName: Full=D-alanine--poly(phosphoribitol) ligase
  142::500     3e-18  29%  511 aa  DLTA_STRA3 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  280::627     3e-18  30%  720 aa  ACSL3_RAT RecName: Full=Long-chain-fatty-acid--CoA ligase 3;       
   98::504     4e-18  30%  516 aa  DLTA_STRP7 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  142::500     4e-18  29%  511 aa  DLTA_STRA5 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  142::500     4e-18  29%  511 aa  DLTA_STRA1 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  118::618     5e-18  27%  711 aa  ACSL4_HUMAN RecName: Full=Long-chain-fatty-acid--CoA ligase 4;     
  105::618     5e-18  25%  652 aa  ACSA_STRAW RecName: Full=Acetyl-coenzyme A synthetase;       
  109::595     6e-18  25%  628 aa  Y3568_PSEAE RecName: Full=Uncharacterized protein PA3568;
  143::654     8e-18  23%  686 aa  ACSS3_BOVIN RecName: Full=Acyl-CoA synthetase short-chain family
   91::626     8e-18  26%  654 aa  ACSA_WOLSU RecName: Full=Acetyl-coenzyme A synthetase;       
  124::391     1e-17  30%  411 aa  VRAA_STAES RecName: Full=Putative long chain fatty acid-CoA ligase
  262::577     1e-17  34%  694 aa  LCF4_YEAST RecName: Full=Long-chain-fatty-acid--CoA ligase 4;      
   98::504     1e-17  29%  516 aa  DLTA_STRZT RecName: Full=D-alanine--poly(phosphoribitol) ligase
   98::504     1e-17  29%  516 aa  DLTA_STRPJ RecName: Full=D-alanine--poly(phosphoribitol) ligase
   86::605     1e-17  27%  646 aa  S27A1_MOUSE RecName: Full=Long-chain fatty acid transport protein
   77::577     2e-17  26%  670 aa  ACSL4_RAT RecName: Full=Long-chain-fatty-acid--CoA ligase 4;       
   77::624     2e-17  24%  657 aa  ACSA_CAMJ8 RecName: Full=Acetyl-coenzyme A synthetase;       
   77::624     3e-17  24%  657 aa  ACSA_CAMJJ RecName: Full=Acetyl-coenzyme A synthetase;       
   77::624     3e-17  24%  657 aa  ACSA_CAMJE RecName: Full=Acetyl-coenzyme A synthetase;       
  118::618     4e-17  26%  711 aa  ACSL4_MOUSE RecName: Full=Long-chain-fatty-acid--CoA ligase 4;     
    1::481     2e-16  28%  487 aa  DLTA_STAXY RecName: Full=D-alanine--poly(phosphoribitol) ligase
   86::605     3e-16  26%  646 aa  S27A1_RAT RecName: Full=Long-chain fatty acid transport protein 1; 
  280::627     4e-16  29%  720 aa  ACSL3_MOUSE RecName: Full=Long-chain-fatty-acid--CoA ligase 3;     
 2750::3226    1e-15  29% 4924 aa  SIB1_SCHPO RecName: Full=Hydroxamate-type ferrichrome siderophore
  143::500     1e-15  29%  506 aa  DLTA_LACRH RecName: Full=D-alanine--poly(phosphoribitol) ligase
  681::1032    2e-15  27% 1414 aa  MBTB_MYCTU RecName: Full=Phenyloxazoline synthase mbtB;       
  681::1032    2e-15  27% 1414 aa  MBTB_MYCBO RecName: Full=Phenyloxazoline synthase mbtB;       
  134::628     2e-15  28%  669 aa  FAT1_YEAST RecName: Full=Very long-chain fatty acid transport
  582::1015    5e-15  26% 2035 aa  HMWP2_YERE8 RecName: Full=High-molecular-weight protein 2;       
  136::479     5e-15  30%  485 aa  DLTA_STAES RecName: Full=D-alanine--poly(phosphoribitol) ligase
  220::547     6e-15  32%  666 aa  ACBG2_HUMAN RecName: Full=Long-chain-fatty-acid--CoA ligase ACSBG2;
  127::441     1e-14  29%  452 aa  MENE_HAEIN RecName: Full=2-succinylbenzoate--CoA ligase;       
  226::600     2e-14  29%  643 aa  FAT1_COCHE RecName: Full=Fatty acid transporter protein;
  292::351     4e-14  33%  744 aa  LCF2_YEAST RecName: Full=Long-chain-fatty-acid--CoA ligase 2;      
   87::472     4e-14  24%  480 aa  ACSM6_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM6,
  109::479     7e-14  28%  485 aa  DLTA_STAAB RecName: Full=D-alanine--poly(phosphoribitol) ligase
   24::284     9e-14  27%  307 aa  PABL_STRGR RecName: Full=Protein Y;AltName: Full=ORF-3;Flags:
  260::554     9e-14  30%  694 aa  LCF3_YEAST RecName: Full=Long-chain-fatty-acid--CoA ligase 3;      
  109::479     9e-14  28%  485 aa  DLTA_STAAW RecName: Full=D-alanine--poly(phosphoribitol) ligase
  109::479     9e-14  28%  485 aa  DLTA_STAAU RecName: Full=D-alanine--poly(phosphoribitol) ligase
  109::479     9e-14  28%  485 aa  DLTA_STAAT RecName: Full=D-alanine--poly(phosphoribitol) ligase
  109::479     9e-14  28%  485 aa  DLTA_STAAS RecName: Full=D-alanine--poly(phosphoribitol) ligase
  109::479     9e-14  28%  485 aa  DLTA_STAAN RecName: Full=D-alanine--poly(phosphoribitol) ligase
  109::479     9e-14  28%  485 aa  DLTA_STAAM RecName: Full=D-alanine--poly(phosphoribitol) ligase
  109::479     9e-14  28%  485 aa  DLTA_STAAE RecName: Full=D-alanine--poly(phosphoribitol) ligase
  109::479     9e-14  28%  485 aa  DLTA_STAAC RecName: Full=D-alanine--poly(phosphoribitol) ligase
  109::479     9e-14  28%  485 aa  DLTA_STAA9 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  109::479     9e-14  28%  485 aa  DLTA_STAA8 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  109::479     9e-14  28%  485 aa  DLTA_STAA3 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  109::479     9e-14  28%  485 aa  DLTA_STAA2 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  109::479     9e-14  28%  485 aa  DLTA_STAA1 RecName: Full=D-alanine--poly(phosphoribitol) ligase
  138::491     9e-14  27%  499 aa  DLTA_LACLA RecName: Full=D-alanine--poly(phosphoribitol) ligase
  227::807     1e-13  27% 1374 aa  LYS2_CANGA RecName: Full=L-aminoadipate-semialdehyde dehydrogenase
  159::514     2e-13  30%  521 aa  MBTM_MYCPA RecName:
  242::822     2e-13  26% 1392 aa  LYS2_YEAST RecName: Full=L-aminoadipate-semialdehyde dehydrogenase;
  126::479     2e-13  28%  485 aa  DLTA_STAAR RecName: Full=D-alanine--poly(phosphoribitol) ligase
  136::479     3e-13  29%  485 aa  DLTA_STAEQ RecName: Full=D-alanine--poly(phosphoribitol) ligase
    5::507     8e-13  28%  580 aa  FAD28_MYCBO RecName: Full=Putative fatty-acid--CoA ligase fadD28;  
    1::479     1e-12  26%  485 aa  DLTA_STAHJ RecName: Full=D-alanine--poly(phosphoribitol) ligase
  191::532     2e-12  27% 1100 aa  ACSF4_MOUSE RecName: Full=Acyl-CoA synthetase family member 4;     
  621::986     4e-12  27% 3131 aa  ESYN_FUSEQ RecName: Full=Enniatin synthetase;Includes:  RecName:
  181::490     2e-11  28%  701 aa  ORA_PLAFN RecName: Full=Octapeptide-repeat antigen;       
  234::723     2e-10  25% 5218 aa  HTS1_COCCA RecName: Full=HC-toxin synthetase;         Short=HTS;   
   45::315     2e-10  23%  337 aa  ACSA_NOSLI RecName: Full=Acetyl-coenzyme A synthetase;       
  168::549     3e-10  26% 1149 aa  ACSF4_DANRE RecName: Full=Acyl-CoA synthetase family member 4;     
    1::526     5e-10  28%  579 aa  FAD21_MYCLE RecName: Full=Putative fatty-acid--CoA ligase fadD21;  
  148::514     4e-09  28%  521 aa  MBTM_MYCTU RecName:
  148::514     4e-09  28%  521 aa  MBTM_MYCBO RecName:
  284::740     5e-09  26% 1409 aa  LYS2_PENCH RecName: Full=L-aminoadipate-semialdehyde dehydrogenase
  242::821     9e-09  26% 1385 aa  LYS2_ASHGO RecName: Full=L-aminoadipate-semialdehyde dehydrogenase
   75::363     9e-09  27%  983 aa  ESYN_GIBPU RecName: Full=Enniatin synthetase;Includes:  RecName:
  315::858     1e-08  25% 1419 aa  LYS2_SCHPO RecName: Full=L-aminoadipate-semialdehyde dehydrogenase;
   64::530     2e-08  26%  583 aa  FAD25_MYCTU RecName: Full=Putative fatty-acid--CoA ligase fadD25;  
   55::223     3e-08  36%  578 aa  FAD21_MYCTU RecName: Full=Putative fatty-acid--CoA ligase fadD21;  
   55::223     3e-08  36%  578 aa  FAD21_MYCBO RecName: Full=Putative fatty-acid--CoA ligase fadD21;  
  192::451     3e-08  29% 1098 aa  ACSF4_HUMAN RecName: Full=Acyl-CoA synthetase family member 4;     
  237::820     6e-08  26% 1391 aa  LYS2_CANAL RecName: Full=L-aminoadipate-semialdehyde dehydrogenase
  296::390     5e-07  40%  391 aa  PCL_HALHA RecName: Full=4-coumarate--CoA ligase;         Short=4CL;
  375::533     2e-05  30% 1571 aa  DIP2A_HUMAN RecName: Full=Disco-interacting protein 2 homolog A;   
  309::408     3e-05  33%  411 aa  PCL_RHOS4 RecName: Full=4-coumarate--CoA ligase;         Short=4CL;
  184::300     2e-04  31%  871 aa  PATJ_DROME RecName: Full=Patj homolog;
  327::425     2e-04  36% 1523 aa  DIP2A_MOUSE RecName: Full=Disco-interacting protein 2 homolog A;   
   11::92      3e-04  27%  107 aa  YAC2_METSO RecName: Full=Uncharacterized protein in acs
  377::496     5e-04  34% 1574 aa  DIP2B_MOUSE RecName: Full=Disco-interacting protein 2 homolog B;   
  360::456     7e-04  34% 1556 aa  DIP2C_HUMAN RecName: Full=Disco-interacting protein 2 homolog C;   
  379::440     7e-04  37% 1576 aa  DIP2B_HUMAN RecName: Full=Disco-interacting protein 2 homolog B;   
  380::500     7e-04  31% 1577 aa  DIP2B_DANRE RecName: Full=Disco-interacting protein 2 homolog B;   
    1::515

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLNLSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYF
LCFB_BACSU      -MNLVSKLEETASEKPDSIACRFKDHMMTYQELNEYIQRFADGLQEAGMEKGDHLALLLGNSPDFIIAFF
LCFA_BACSU      ---LQSILTDSAARFPDKTAISFYGKKLTFHDILTDALKLAAFLQCNGLQKGDRVAVMLPNCPQTVISYY
LCFA_ECO57      -----------------------------------------------GLKKGDRVALMMPNLLQYPVALF
LCFA_ECOLI      -----------------------------------------------GLKKGDRVALMMPNLLQYPVALF
LCFA_ECOL6      -----------------------------------------------GLKKGDRVALMMPNLLQYPVALF
LCFA_SALTY      --SLVELFEHAATRYADQPAFVMGEVMTFRKLEERSRAFAAYLQQGLGLKKGDRVALMMPNLLQYPVALF
LCFA_SALTI      --SLVELFEHAATRYADQPAFVMGEVMTFRKLEERSRAFAAYLQQGLGLKKGDRVALMMPNLLQYPVALF
LCFA_YERPE      -----------------------------------------------GLQKGDRVALMMPNLLQYPIALF
LCFA_HAEIN      ------MFDKAVREHPDRPAYINMGQVLTFRKLEERSRAFAAYLQNEKLQRGDRVALMMPNLLQYPIALF
CAIC_SALAR      --HLRQMWDDLAGIYEDKTALIFGEVQFSYASLNREINRTANLFYSLGIRKGDNVALHLDNCPEFIFCWF
ACSF2_RAT       -------LDATAQRFPNREALVIENIRLNFAQLKEEVDRAASGLLSIGLRKGDRLGMWGPNSYAWVLIQL
CAIC_CITK8      --NLRQMWDDLAEVYGNKTALIFESSQFSYASLNEEINRTANLFLASGIQKGDNVALHLDNCPEFFFCWF
CAIC_ECOSM      --------------------------RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWF
CAIC_ECO27      --------------------------RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWF
CAIC_ECOUT      --------------------------RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWF
CAIC_ECOK1      --------------------------RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWF
CAIC_ECO81      --------------------------RYSYLELNQEINRTANLFYVLGIRKGDKVALHLDNCPEFIFCWF
CAIC_ECO45      --------------------------RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWF
4CL2_SOLTU      ------------------------DRIYTYAEVELTSRKVAVGLNKLGIQQKDTIMILLPNCPEFVFAFI
ACSF2_MOUSE     -------LDATAQRFPDREALVIENIRLNFAQLKEEVDKAASGLLSIGLRKGDRLGMWGPNSYAWVLIQL
CAIC_SHIFL      --------------------------RYSYLELNQEINRTANLFYTLGIRKGNKVALHLDNCPEFIFCWF
CAIC_ECO7I      --------------------------RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWF
CAIC_ECO5E      --------------------------RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWF
CAIC_ECO57      --------------------------RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWF
CAIC_ECOLC      --------------------------RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWF
CAIC_ECOL6      --------------------------RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWF
CAIC_ECOL5      --------------------------RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWF
CAIC_ECO55      --------------------------RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWF
4CL1_SOLTU      ------------------------DRIYTYAEVELTSRKVAVGLNKLGIQQKDTIMILLPNCPEFVFAFI
CAIC_ECO8A      --------------------------RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWF
CAIC_ECOHS      --------------------------RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWF
CAIC_ESCF3      --------------------------RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWF
CAIC_ECO24      --------------------------RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWF
CAIC_ECOSE      --------------------------RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWF
CAIC_ECOLU      --------------------------RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWF
CAIC_SHISS      --------------------------RYSYLELNQEINRTTNLFYTLGIRKGDKVALHLDNCPEFIFCWF
CAIC_ECOLI      --------------------------RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWF
CAIC_ECODH      --------------------------RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWF
CAIC_ECOBW      --------------------------RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWF
CAIC_SALPK      --NLRQMWDDLAEVYGDKTALIFESCQFSYASLNEEINRTANLFHSLGIRKGDRVALHLDNCPEFIFCWF
CAIC_SALPA      --NLRQMWDDLAEVYGDKTALIFESCQFSYASLNEEINRTANLFHSLGIRKGDRVALHLDNCPEFIFCWF
ACSF2_MACFA     -------LEATAQRVPEREALVHENIRLTFAQLKEEVDKAASGLLSIGLCKGDRLGMWGPNSYAWVLIQL
CAIC_SALNS      --NLRQMWDDLAGVYGDKTALIFESCQFSYASINEEINRTANLFYSLGIRKGDRVALHLDNCPEFIFCWF
CAIC_PROMH      --HLRQMWDDLAEVYDKKTALIFGKVRFSYSELNEEINRAANLFHACGIKKGDHVALHLDNCPEFFFCWF
ACSF2_PONAB     -------LDTTAQRVPEREALVVEDVRLTFGQLKEEVDKAASGLLSIGLCKGDRLGMWGPNSYAWVLMQL
4CL1_TOBAC      ------------------------DQIYTYAEVELTCRKVAVGLNKLGIQQKDTIMILLPNSPEFVFAFM
CAIC_SALSV      --NLRQMWDDLAGVYGDKTALIFESCQFSYASLNEEINRTANLFYALGIRKGDRVALHLDNCPEFIFCWF
CAIC_SALDC      --NLRQMWDDLAGVYGDKTALIFESCQFSYASLNEEINRTANLFYSLGIRKGDRVALHLDNCPEFIFCWF
CAIC_SHIDS      --------------------------RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWF
CAIC_SALTI      --NLRQMWDDLAGMYGDKTALIFESCQFSYASLNEEINRTANLFYYLGIRKGDRVALHLDNCPEFIFCWF
CAIC_SALPC      --NLRQMWDDLAGVYGDKTALIFESCQFSYASLNEEINRTANLFYSLGIRKGDRVALHLDNCPEFIFCWF
CAIC_SALPB      --NLRQMWDDLAGVYGDKTALIFESCQFSYASLNEEINRTANLFYSLGIRKGDRVALHLDNCPEFIFCWF
CAIC_SALEP      --NLRQMWDDLAGVYGDKTALIFESCQFSYASLNEEINRTANLFYSLGIRKGDRVALHLDNCPEFIFCWF
CAIC_SALCH      --NLRQMWDDLAGVYGDKTALIFESCQFSYASLNEEINRTANLFYSLGIRKGDRVALHLDNCPEFIFCWF
CAIC_SALTY      --NLRQMWDDLAGVYGDKTALIFESCQFSYASLNEEINRTANLFYSLGIRKGDRVALHLDNCPEFIFCWF
CAIC_SALHS      --NLRQMWDDLAGVYGDKTALIFESCQFSYASLNEEINRTANLFYSLGIRKGDRVALHLDNCPEFIFCWF
CAIC_SALA4      --NLRQMWDDLAGVYGDKTALIFESCQFSYASLNEEINRTANLFYSLGIRKGDRVALHLDNCPEFIFCWF
ACSF2_HUMAN     -------LETTAQRVPEREALVVEDVRLTFAQLKEEVDKAASGLLSIGLCKGDRLGMWGPNSYAWVLMQL
YDAB_BACSU      METLQHLILHDMPNSEEIEAVKSGDHTLTYKGYRKRINQLANAMLQKGIQKGDRVALLCKNGHPASTVMF
CAIC_PROSL      --HLRQMWDDLAEVYDKKTALIFGKVRFSYSELNEEINRAANLFHACGIKKGDHVALHLDNCPEFFFCWF
MENE_BACLD      -------LKQRAELTPDRMAVIQGDHKLTFIQLFHEAKKTAGRLKSFGLKNGDTAALLLTNRMEMVIAVH
ACSF2_BOVIN     -------LDATAQRVPDQEALVVHNIRLTFAQLKEEVDKAASGLLSIGLRKGDRLGMWGPNSYAWVLMQL
4CLL6_ARATH     ----------------------------------MVQSMAAGIYHVLGVRQGDVVSLVLPNSVYFPMIFL
4CL2_TOBAC      -----------------------------YADVELNSRKVAAGLHKQGIQPKDTIMILLPNSPEFVFAFI
MENE_BACP2      ---------------PERVALIYQDKKWTFRDLADEVNELSNRLAQTSLKKGEAVGLLMNNHPQMVMLVH
MENE_GEOSW      ---------------PERIAVYDGQGKKTFMELHESVMKRARQLANTGVRKGDIVAIFMKNSVAMIECIH
4CLL5_ARATH     ---------------------------------------VADCLSEIGIRKGHVVLLLSPNSILFPVVCL
4CL_VANPL       ------------------------DEIFTYADVELISRRVGSGLSKLGIKQGDTIMILLPNSPEFVFAFL
FADK_ECOLI      -----------ARAMPDKIAVVDNHASYTYSALDHAASCLANWMLAKGIESGDRIAFQLPGWCEFTVIYL
4CL2_PETCR      -----------------------------YSQVELLSRKVASGLNKLGIQQGDTIMLLLPNSPEYFFAFL
4CL1_PETCR      -----------------------------YSQVELLSRKVASGLNKLGIQQGDTIMLLLPNSPEYFFAFL
4CLL1_ORYSJ     -----------------------------------------------GVRPGDAVLLLAPNCVLYPVCFF
ACSF2_DANRE     -----------------------------------------------------------PNIYEWVLMQF
MENE_GEOKA      ---------------PERIAVSDGRRTKTFAELYEXXXXXXXXXXXXGVKEGDIVALLMKNRIEMIEIIH
CAIC_SHIF8      --------------------------RYSYLELNQEINRTANLFYTLGIRKGNKVALHLDNCPEFIFCWF
4CLL2_ARATH     -------------SQPHRGKTVFVDARLSFPELWLGVERVAGCLYALGVRKGNVVIILSPNSILFPIVSL
4CLL3_ARATH     -------------SQPQRGTTAFIDARLTFSDLWRVVDRVADCLYHEGIRRGDVVLILSPNSIYIPVVCL
4CL2_DICDI      ------------RSKPDQVLLVDGLTFKEYSFVADTIEKVACGLNKLNIKKGDVLGVILPNLPEYVPIFH
4CLL8_ARATH     ------------------------DHRISFSDLWMAVDRVADLLHDVGIRRGDVVLVLSPNTISIPIVCL
4CLL7_ARATH     ---------------PSKLAIADSDTSLTFSQLKSAVARLAHGFHRLGIRKNDVVLIFAPNSYQFPLCFL
4CL1_DICDI      ------------RSKPDQVLLVDGLTFKEYSFVADTIEKVACGLNKLNIKKGDVLGVILPNLPEYVPIFH
MENE_BACC7      ---------------PDRTAIEIEEEKVTFMQLHEKVVSVCEHLTHVGVKRGQKVAVLMKNGMEMITVIH
4CLL4_ORYSJ     ------------------------------------------------LRKGHVALILSPNSVHFPVAAL
4CLL4_ARATH     --NLSRDVTTFISSQPHRGKTAFIDAALTFSDLWRAVDRVADCLYHEGIRRGDVVLILSPNSIFIPVVCL
FAT2_SCHPO      ---------------------------LSFSELRIAIMDLQRQIASLGIKVGDPVNIAIPNGLEFVVAFY
3HBCL_THAAR     -----------AQGLGEQTAMLCAERSITYRELDAATNRHGNALRAHGVGKGDRVLFLMDDSPELVAAYL
4CL2_ARATH      -----------------------------YADVHVTSRKLAAGLHNLGVKQHDVVMILLPNSPEVVLTFL
MENE_BACSU      -----------AQLTPERIALIYEDQTVTFAELFAASKRMAEQLAAHSVRKGDTAAILLQNRAEMVYAVH
ALKK_PSEOL      --------------------------------VELRARKLASALGKMGLTPSDRCAIAWNNIRHLE-VYY
MENE_BACC0      ---------------PDRTAIEIEEEKVTFMQLHEKVVSVCEHLTHVGVKRGQKVAVLMKNGIEMITVIH
4CL3_DICDI      ------------RYKPDQVLLVDGLTFKEYSFVADTIEKVACGLNKLNIKKGDVLGVILPNLPEYVPIFH
4CL2_ORYSJ      -----------------------------------------------GVGHGDRVMVLLQNCVEXXXXXX
MENE_BACCZ      ---------------PDRTAIEMEEEKVTFMQLHEKVVSVCEHLTHVGVKRGQKVAVLMKNGMEMITVIH
MENE_BACHK      ---------------PDRTAIEIEEEKVTFMQLHEKVVSVCEHLTHVGVKRGQKVAVLMKNGMEMITVIH
MENE_BACAN      ---------------PDRTAIEIEEEKVTFMQLHEKVVSVCEHLTHVGVNRGQKVAVLMKNGMEMITVIH
MENE_BACAH      ---------------PDRTAIEIEEEKVTFVQLHEKVVSVCEHLTHVGVKRGQKVAVLMKNGMEMITVIH
MENE_BACAC      ---------------PDRTAIEIEEEKVTFMQLHEKVVSVCEHLTHVGVNRGQKVAVLMKNGMEMITVIH
MENE_BACAA      ---------------PDRTAIEIEEEKVTFMQLHEKVVSVCEHLTHVGVNRGQKVAVLMKNGMEMITVIH
MENE_BACCQ      ---------------PDRTAIEIEEEKVTFMQLHEKVVSVCGNLTHVGVKRGQKVAVLMKNGMEMITVIH
MENE_BACC1      ---------------PDRTAIEIEEEKVTFMQLHEKVVSVCEHLTHIGVKRGQKVAVLMKNGMEMITVIH
ACSM2_MOUSE     ------------------------EIKWSFRELSEASKQTANVLSGAGLHRGDRVAVVLPRIPEWWLMIL
4CL1_ARATH      -----------------------------YSDVHVISRQIAANFHKLGVNQNDVVMLLLPNCPEFVLSFL
MENE_BACWK      ---------------PDRTAIEIEEEKVTFVQLHEKVVSVCEHLTHVGVKRAQKVAVLMKNGMEMITVIH
4CLL9_ARATH     ----------------------------------------------------------------------
MENE_BACCR      ---------------PDRTAIEIEEEKVTFMELHEKVVSVCEHLTHVGVERGQKVAVLMKNGMEMITVIH
MENE_LISMO      -------LQKRVRLSPKETALVFEGKEETFEEISEAVERLAGKLFALGIRKDEMIALLGKNDRMTFLLIH
4CL3_ARATH      -----------------------------YGETHLICRRVASGLYKLGIRKGDVIMILLQNSAEFVFSFM
ACSM3_MOUSE     ------------------------ELRWSFEELGLLSRKFANILTEASLQRGDRVMVILPKIPEWWLANV
BCLA_THAAR      ------------------------------------------LRTTLGLQPKDRVLVCVLDGIDFPTTFL
MENE_OCEIH      ---------------PDKKAIEFEDSSITYLELFHRSQSYARKLGKLGFRQGDHIAILSTNCAEMIQIIY
MENE_BACCN      ---------------PDRIAIETKEEKITFFALHEKVVSVCENLAYLQIKKGQKVAVLMKNGMEMIAVIH
MENE_LISMF      -------LQKRVRLSPKETALVFEGKEETFEEISEAVKQLAGKLFALGIRKDEMVALLGKNDRMTFLLIH
ACSM3_RAT       ------------------------EVRWSFEELGSLSRKFANILTEASLQRGDRVMVILPKIPEWWLANV
LUCI_LUCMI      -----------------------------------ITCRLAEAMKNFGMKPEEHIALCSENCEEFFIPVL
ACSM2_RAT       ------------------------ELKWNFRELSEISKQTANVLTGAGLQRGDRVAVVLPRVPEWWLVTL
4CLL6_ORYSJ     ------------------------------AFVARVRFLAGGLWCSLGLRPGDVALVVSPSCLDVAVLYF
ACSM5_MOUSE     -----------------------------------------------GLQPGDRMMLVLPRLPDWWLISV
4CLL9_ORYSJ     ---------DGAEAYADRVALVAGGRSYTYGEVARDTARFARALRSXXXXXXXXXXXALPNLAVYPVVSL
FAT2_YEAST      ----------------------------------------------------DTVAISMRNGLEFIVAFL
ACSF3_MOUSE     -----------------------------------LAQEICRL---QGCKVGDRVSFLCSNDVSYVVAQW
LUCI_PHOPY      ------------------------EVNITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSENSLQFFMPVL
4CL1_ORYSJ      ------------------------------------------------------------NSPEFVLSFF
ACSM4_RAT       -------LKEKSGERPANPALWWDEVKWSFQELGSLSRKAANVLTKPGLQRGDRVAVILPRIPEWWLINV
4CL2_SOYBN      -----------------------------YADTHLISSKIAAGLSNLGILKGDVVMILLQNSADFVFSFL
ACSF3_BOVIN     ----------------------------------------------------ERVSLLCSNDVSFVVAQW
4CL4_ORYSJ      ----------------------------------------------------------------------
4CL5_ORYSJ      ---------------------------LSFGDVDALSRRVAAGLSSIGVCHGSTVMLLLPNSVEFAVAFL
MENE_LISIN      -------LQKRVRLSPGETALVFEGKQETFEEIYEAVEKLAGKLFARGIRKDEMVALLGKNDRMTFLLIH
ACSM5_RAT       ------------------------------------SRKAANILEGAGLKPGDRLMLVLPRLPEWWLTIV
4CL4_ARATH      ---------------------------LTYADVQTNMRRIAAGIHRLGIRHGDVVMLLLPNSPEFALSFL
LUCI_LUCCR      ----------------------------------------------------------------------
LUCI_LUCLA      -------------------------------------------LKNYGLVVDGRIALCSENCEEFFIPVL
ACSM3_HUMAN     ------------------------EMRWSFEELGSLSRKFANILSEASLQRGDRVILILPRVPEWWLANV
ACSM5_HUMAN     ------------------------------------SRKAANVLGGAGLQPGDRMMLVLPRLPEWWLVSV
4HBCL_RHOPA     -----------AEGRGGKIAFIDPQRSLSYGELRDAVARVGPMLARLGVEQENRIALVLKDTVDFPILFW
4CL_PINTA       ----------------DRPCLIDGDRTYCFSEVELISRKVAAGLAKXXXXXXXXXXXXXPNCIEFAFVFM
MENE_STAAW      ----------------------------------------------------------------------
MENE_STAAS      ----------------------------------------------------------------------
LUCI_PHOPE      -----------------------------------------------GLKQNDTIAVCSENGLQFFLPLI
4CL3_ORYSJ      -----------------------------------------------GVGKGDVVMSLLRNCPEFAFSFX
ACSM3_PONAB     ------------------------EVRWSFEELGSLSRKFANILSEASLQRGDRVILILPRVPEWWLANV
ACS2B_HUMAN     ------------------------ELMWNFRELSENSQQAANVLSGAGLQRGDRVAVMLPRVPEWWLVIL
MENE_STAAB      ----------------------------------------------------------------------
MENE_BACA2      -----------AQLTPERIALIFENKQMTFRELYHASKQMAARLSKYSLKKGDRAAILLSNRPEMVYAVH
MENE_STAAN      ----------------------------------------------------------------------
MENE_STAAM      ----------------------------------------------------------------------
MENE_STAA9      ----------------------------------------------------------------------
MENE_STAA2      ----------------------------------------------------------------------
MENE_STAA1      ----------------------------------------------------------------------
ACS2A_HUMAN     ------------------------ELMWNFRELSENSQQAANVLSGAGLQRGDRVAVVLPRVPEWWLVIL
DHBE_BACSU      ------LLRDRAAKYGDRIAITCGNTHWSYRELDTRADRLAAGFQKLGIQQMDRVVVQLPNIKEFFEVIF
ACSM4_MOUSE     -------LKEKSGERPANPALWWDEVKWSFQELGSLSRKAANVLTKPGLQRGDRVAVILPRIPEWWLINV
ACSM4_HUMAN     ------------------------EVKWSFRELGSLSRKAANVLTKPGLQRGDRLAVILPRIPEWWLVNV
MENE_STAAR      ----------------------------------------------------------------------
ACSM1_BOVIN     --------------------------------------RTANVLTQTGLQTGDRLALILPRVPEWWLVCV
ACSF3_HUMAN     -------------------ALAFGD---RIALVDQHGRHTYRELYSRSLRLSERVSFLCANDASYVVAQW
ACSA_XANP2      ---------------------------ITYRELSSEVNKLANVLRNRGVEKGDRVTIYLPMIPEAAFAML
MENE_STAAU      ----------------------------------------------------------------------
MENE_STAAT      ----------------------------------------------------------------------
MENE_STAAE      ----------------------------------------------------------------------
MENE_STAAC      ----------------------------------------------------------------------
MENE_STAA8      ----------------------------------------------------------------------
MENE_STAA3      ----------------------------------------------------------------------
MENE_ENTFA      -------LNKQVQKRPDHPAFYFQDESWTFLEVQQVSHWVATY--QQVLAPEEKVALFSKNSKELYFSIL
ACSA_NOVAD      ---------------------------ITYRQLHADVCRFANLLKAKGVQKGERVTIYLPMVPEAAVAML
4CLL3_ORYSJ     -------------------------------LRRLVASLAAGLRRRHGVRKGSVVLLLLPNSVAFPVSFX
ACSM1_MOUSE     -----------------------------------------------GLQQGDHLALILPRVPEWWLVTV
ACSA_BACSU      ------------------------------------SNRAGNVLRRYGVEKGDRVFIFMPRSPELYFIML
ACSM1_HUMAN     ------------------------EVKWSFREMGDLTRRVANVFTQTGLQQGDHLALMLPRVPEWWLVAV
4CL1_SOYBN      ----------------------------------------------------------------------
ACSA_PSYIN      ------------------------DEKITYKQLHQRVCQFANVLKSQGVRKGDVVCLYMPMTPEAAVAML
ACSA_SHEFN      --------------------------KLTYAELHTQVCKFANALRSQGVNKGDIVTIYMPMVPEAAVAML
ACSA_METPB      --------------RGDQTAIIWGDQHITYKQLHAEVCRMANVLRNRGVGKGDRVTLYLPMIPEAAYAML
ACSA_DESAA      -------LDRHLEKRGDQTAIIFEEEKITYRQLYERVCRFSNVLKSCGVKKGDRVSIYLPMIPQLAVAML
ACSA_SYNFM      ----------------------------------------ANVLKAQGLKKGDRATIYLPMIPELAVAML
ACSA_METRJ      ---------------------------ISYRELHAQVCRMANVLRNRGVGKGDRVTLYMPMIPEAAYAML
ACSA_SHEAM      --------------------------KVTYRELHAEVCQFANALKAEGVKRGDVVTIYMPMVVEATVAML
ACSA_METC4      ---------------------------ITYRQLHAEVCRMANVLRNRGVGKGDRVTLYLPMIPEAAYAML
ACSA_METEP      ---------------------------ITYRQLHAEVCRMANVLRNRGVGKGDRVTLYLPMIPEAAYAML
MENE_LACLA      ----------------------------------------------------------------------
ACSA_XANAC      --------------------------------------KLGNALRNLGVKKGDRVTIYLPMIVDAAVAML
ACSA_RHOP5      ------------KDRADQVAIIWGDRKITYRQLHDEVCKMANVLRNRNVQKGDRVTIYLPMIPEAAFAML
ACSA_PARL1      ------------------------DRKITYRELHDEVCRFANVLKARGVKKGDRVTIYMPMIPEAAYAML
ACSF3_XENLA     ----------------------------------------------------ERVSFLCPNNSSYVVCQW
ACSA2_PSEAE     --------------RGEQIAIVWGDAHITYRKLHHNVCRLANVLKSRGVEKGDRVCIYMPMIPEAAYAML
ACSA_SHESA      -------------NASEQRQITYGELHTQVC-------KFANALRSQGVRRGDIVTIYMPMVPEAAVAML
ACSA_SHESM      -------------NASEQRKITYGELHTQVC-------KFANALRSQGVRRGDIVTIYMPMVPEAAVAML
ACSA_BRAJA      --------------------------------------RMANILRTRNVKKGDRVTIYLPMIPEAAYAML
ACSA_SHESR      -------------NASEQRKITYGELHTQVC-------KFANALRSQGVRRGDIVTIYMPMVPEAAVAML
ACSA_BRASO      --------------------------------------KMANILRNRNVKKGDRVTIYLPMIPEAAYAML
ACSA_XANOM      --------------------------------------KLGNALRNLGVKKGDRVTIYLPMIVDAAVAML
4CLL5_ORYSJ     -----------------------------------VRSLAGGLWCSLGLRPGDVALVVAPSRLEVPVLDF
ACSA_SODGM      -------LDRHLQERGDQTAIIWGDKTLTYRQLHQAVCRFANVLKAQGIGKGDVVALYMPMVPEAAVAML
ACSA_SHEON      --------------------------KITYGELHTQVCKFANALRSQGVRRGDIVTIYMPMVPEAAVAML
ACSA_HALHL      ------------------------DEHITYRDLYERVGRLANALKARGVKKGDRVCIYLPMVPEAAVAML
ACSA_XANCP      --------------------------------------KLGNALRNLGVKKGDRVTIYLPMIVDAAVAML
ACSA_XANC8      --------------------------------------KLGNALRNLGVKKGDRVTIYLPMIVDAAVAML
4CLL1_ARATH     ---------------------------VTYGDVVRDTKRLAKALTSLGLRKGQVMVVVLPNVAEYGIIAL
LGRC_BREPA      --------EQQVEKTPDAVALVYKDVELTYAELNERANQLAHRLLAEGVKPDELVGICVERSPEMIVAFL
4CLL7_ORYSJ     ---------------------------------------LAGALRSRGLRGGDVAFVLAPAGLDVPVLYF
ACSA_XYLFA      ----------------EPDAPDAPSSRITYRELYERVCQLGNALRHLNIEKGDRVTIYLPMIPDAVVAIL
ACSA_XYLFT      ----------------EPDAPDAPSSRITYRELYERVCQLGNALRHLGIEKGDRVTIYLPMIPDAVVAIL
ACSA_BEII9      --------------RGDQTAILFADSRITYKELHDSVCRLANVLKAHGVGKGDTVSLYLPMIPEAAFAML
ACSA_VIBCH      ------------------------DKTLTYKQLHQEVCRFANALKEQGVRKGDVVCIYMPMVPEAAVAML
PPSB_BACSU      --NIVSLFEKQVAQYPEHIAVVCGHSQLTYRDLNEKAERAAAMLIKQGVRTGDIVGLMLDRSPDMIIGVL
ACSA_YERPS      --------------------------------------QFANVLKSLGIKKGDVVAIYMPMVPEAAVAML
ACSA_YERP3      --------------------------------------QFANVLKSLGIKKGDVVAIYMPMVPEAAVAML
ACSA_RHILO      ------------KKRGDQTAIIYDDKKITYNELYERVCRLANVMKKHGVKKGDRVTIYMPMIPEAAYAML
ACSA_PSEA6      --------------------------------------KIANGLRKLGVGKGDRVAIYMPMIPQAVYAML
ACSA_ALCBS      ------------------------DKHISYQQLFEEVSKFGNVLKNRGVKKGDRVVIYMPMIPEAAYAML
ACSA_YERPP      --------------------------------------QFANVLKSLGVKKGDVVAIYMPMVPEAAVAML
ACSA_YERPN      --------------------------------------QFANVLKSLGVKKGDVVAIYMPMVPEAAVAML
ACSA_YERPE      --------------------------------------QFANVLKSLGVKKGDVVAIYMPMVPEAAVAML
ACSA_YERPA      --------------------------------------QFANVLKSLGVKKGDVVAIYMPMVPEAAVAML
4CLL2_ORYSJ     ----------------------------------------------------------------------
ACSA_YERE8      --------------------------------------QFANVLKKLGIKKGDVVAIYMPMVPEAAVAML
ACSA_AERS4      LLNVSACLDRHLAQRGDKVAIIWEDRKLTYRELHAEVCKFSNVLKAQGVHRGDVVCLYMPMVPEAAIAML
ACSA_NEUCR      -----------AHKDPNRVAIIYGQGRVTYGELLREVSKLAHVLTNLGVRKGDTVAIYLPMIPEAIVAML
ACSA_AGRRK      ------------------------DKKVTYNELYEHVCRLANVLKKHGVKKGDRVTIYMPMIPEAAYAML
ACSA_AGRT5      ----------------ERTAIIWEDKKITYNQLYDYVCRLANVLKKHGVKKGDRVTIYMPMIPEAAYAML
ACSA_AERHH      LLNVSACLDRHLAQRGDKVAIIWEDRKLTYRELHTEVCKFANVLKAQGVHRGDVVCLYMPMVPEAAIAML
ACSA_METSO      --------------------------KITYGDLYKEVNKFANGLKSLGLKKGDRVSIYMPMIPQLPIAML
ACSA_RHOCA      VLNASVCIDRHLRDRALQTAIIFEPRHITYKELSEKVNRMANVLLSQGIMRGDRVVIYLPMIPEAAYAML
ACSA_EMENI      -------------------------------------SRVAWVLKQRGVKKGDTVAIYLPMIPEAIIAFL
ACSA_MAGSM      ------------------------DRKITYRELSALVNKFANALKARGVKKGDRVCIYMPMIPEAAVAML
ACSA_RHOBA      ---------------------------LTYAELQTEVAKCAEGLTQLGIGVGDVVSIYMPMTPELAVAML
ACSA_METSB      --------------------------------------RLANVLKSYGISKGDTVTIYLPMIPEAAYAML
ACSA_LEPIN      ---------------------------LTYYDVYREVNRFANILKKFGVKKGDRVLVYLPMIPELAITIL
ACSA_LEPIC      ---------------------------LTYYDVYREVNRFANILKKFGVKKGDRVLVYLPMIPELAITIL
ACSA_ECOLI      -LNLAACLDRHLQENGDRTAIIWGDKHISYKELHRDVCRFANTLLELGIKKGDVVAIYMPMVPEAAVAML
ACSA_ECOL6      -LNLAACLDRHLQENGDRTAIIWGDKHISYKELHRDVCRFANTLLELGIKKGDVVAIYMPMVPEAAVAML
MENE_STAEQ      ----------------------------------------------------------------------
ACSA_ENTS8      -LNLAACLDRHLSERGDQTAIIWGDKHISYRELHRDVCRFANTLTSLGIKKGDVVAIYMPMVPEAAVAML
ACSA_BARHE      ----------------------YHDKKITYNELYEHVCRFANILKNHGVKKGDKVTIYLTMIPEAAYAML
ENTE_ECOLI      -------------------AVIDGERQLSYRELNQAADNLACSLRRQGIKPGETALVQLGNVAELYITFF
ACSA_VIBVY      ------------------------DKTLTYNELYTEVCRFSNALKEQGVRKGDVVCLYMPMVPEAAVAML
ACSA_VIBVU      ------------------------DKTLTYNELYTEVCRFSNALKEQGVRKGDVVCLYMPMVPEAAVAML
ACSA_CITK8      -LNLAACLDRHLQENGDRTAIIWGDKHISYRELHRDVCRFANTLLELGIKKGDVVAIYMPMVPEAAVAML
ACSA_CHRVO      --------------------------RVTYSELHRRVCQFANGLKSLGVKKGDRVVVACARIGAIHSVVF
ACSA_GEMAT      -LNASVNCIDRHVHGPRRNALIWGDRRFTYWDLYREVNLAANMLKKLGVGRGDRVAIYLPMIPEAVIAML
ENTE_ECO57      -------------------AVIDGERQLSYRELNQAADNLACSLRRQGIKPGETALVQLGNVAELYITFF
MENE_STAES      ----------------------------------------------------------------------
ACSA_PHOLL      -LNLSACLDRHLKERGEQTAIIWGDKAITYRELHHDVCQFANVLKNMGIKKGDVVAIYMPMVPEAAVAML
DHBF_BACSU      LVSLQDMFEKQAVLTPERIALMCDDIQVNYRKLNEEANRLARLLIEKGIGPEQFVALALPRSPEMVASML
ACSA_LEPBJ      ---------------------------LTYYDVYREVNRFANVLKKYGVKKGDRVLVYLPMIPELAITIL
ACSA_BDEBA      --------------------------KITYKELHLEVCRFANVLKKMGVKKGDVVTIYMPMIPDTAVAML
ACSA_ALHEH      --------------------------------------RLANAMKARGVKKGDRVCIYLPMIPEAAVAML
TYCB_BREPA      ---LSQLFEDQAQKTPEQTAVVFGDKRLTYRELNERANQLAHTLRAKGVQAEQSVGIMAQRSLEMXXXXX
ACSA_ECO57      -LNLAACLDRHLQENGDRTAIIWGDKHISYKELHRDVCRFANTLLKLGIKKGDVVAIYMPMVPEAAVAML
ACSA_BART1      ----------------------YHDKKITYNELYEHVCRFANLLKNHGVKKGDKVTIYLPMIPEAAYAML
GRSB_BREBE      ------LFEEQVKKTPEHIAIVWEGQALTYHELNIKANQLARVLREKGVTPNHPVAIMTERSLEMIVGIF
BACA_BACLI      ------LFEEQAKRIPDHTAVVFEDQKLTYRQLNEKANQVARLLREKGVKPDTLVGIMMERSSDMIAAIL
ACSA_LARHH      --------------------------------------QFANGLKSLGVGKGDRVVIYMPMVPQAIVAMQ
ACSA_SHESW      -------------NASEQRKITYGELHADVC-------KFANALRSQGVRRGDIVTIYMPMVPEAAVAML
ACSA_SHEPC      -------------NASEQRKITYGELHADVC-------KFANALRSQGVRRGDIVTIYMPMVPEAAVAML
ACSA_PHOPR      ----------------------------------------SNALKSQGVRKGDVVCLYMPMVAEAAIAML
VIBE_VIBCH      -------LQQSAERTPNALALVGDNQQWRYQAMLERIEQLAAGFTELGLGCGDNVVLQLGNVAEFYLCFF
ACSA_SHEB8      -------------NASEQRKITYGELHADVC-------KFANALRSQGVRRGDIVTIYMPMVPEAAVAML
ACSA_SHEB5      -------------NASEQRKITYGELHADVC-------KFANALRSQGVRRGDIVTIYMPMVPEAAVAML
ACSA_BARBK      ----------------------YSDKKITYNELYEHVCRFANILKNHGVKKGDRVSIYLPMIPEAAYAML
4CLL8_ORYSJ     ----------------------------------------------------------------------
ACVS_NOCLA      ------LFEEVAATWPDRVAVVHGDVRLTYRELNERANRLAHHLRSVAEPRADEIALVLDKSELTLVAIL
ACSA_VIBPA      ------------------------DKTLTFNELHKEVCKFSNALKDQGVRKGDVVCLYMPMVPEAAIAML
ACSA_SHEHH      ---------------------------LTYGQLHTQVCKFANALRSQGVRRGDVVTIYMPMVPEAAVAML
GRSB_ANEMI      ------LFEEQVKKTPEHIAIVWEGQALIYHELNIKANQLARVLREKGVTPNHPVAIMTERSLEMIVGIF
ACSA_METFK      --------------RANKIALIFGDVNITYRELHQRVCRFANALKKQGVGLGDRVIIYLPMSIEAIVAMQ
ACSA_MARMS      ---------------------------ITYQTLHDEVGRLANLLKRQGVKKGDRVAIYMPMIPQAVYAML
ACSA_LEPBL      ---------------------------LTYYDVYREVNRFANVLKKYGVKKGDRVLVYLPMIPELAITIL
AAS_SALTI       ---------------------------------------------------GEKIGLMLPNAAISAAVIF
ACSA_SALTY      -LNLAACLDRHLQENGDRTAIIWGDKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAML
ACSA_PRB01      -------------NDPNKIALIWGDKELTYKELHDEVCKFANVLKDLGVQKGSRVCIYMPMIIETAFAML
AAS_SALSV       ---------------------------------------------------GEKIGLMLPNAAISAAVIF
AAS_SALPB       ---------------------------------------------------GEKIGLMLPNAAISAAVIF
AAS_SALHS       ---------------------------------------------------GEKIGLMLPNAAISAAVIF
AAS_SALG2       ---------------------------------------------------GEKIGLMLPNAAISAAVIF
AAS_SALEP       ---------------------------------------------------GEKIGLMLPNAAISAAVIF
AAS_SALA4       ---------------------------------------------------GEKIGLMLPNAAISAAVIF
ACSA_PASMU      ----------------------FGQVQLTYAKLHNRVCRFANALRELGIKKGDRVIIYLPMLVEAVIAMQ
AAS_SALPC       ---------------------------------------------------GEKIGLMLPNAAISAAVIF
AAS_SALCH       ---------------------------------------------------GEKIGLMLPNAAISAAVIF
ACSA_SHEDO      --------------------------QLSYRELHTQVCQFANVLKAQGVVKGDIVTLYMPMVPEAAVAML
ACSA_SALTI      -LNLAACLDRHLQENGDRTAIIWGDKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAML
ACSA_SACD2      ------------------------DASITYQQLHDAVCKFANVLKARGVAKGDRVCIYMPMIPEAAYAML
ACSA_RHISN      ------------------------DKRITYNELYDKVCRLANVLKKHGVEKGDRVTIYMPMVPEAAYAML
AAS_SALTY       ---------------------------------------------------GEKIGLMLPNAAISAAVIF
AAS_SALPK       ---------------------------------------------------GEKIGLMLPNAAISAAVIF
AAS_SALPA       ---------------------------------------------------GEKIGLMLPNAAISAAVIF
AAS_SALNS       ---------------------------------------------------GEKIGLMLPNAAISAAVIF
AAS_ENT38       ---------------------------------------------------GEKIGLMLPNAGISAAVIF
LGRB_BREPA      ------LFRETALLYPERLAVVAGNQTLTYAELERRANQTANYLQQKGVRPGALVGLCVKRSLEMLIGML
ACSA_RHIE6      ------------------------DKKITYNELYEHVCRMANVLKKHGVKKGDRVTIYMPMIPEAAYAML
ACSA_SHEB9      -------------NASEQRKITYGELHAEVC-------KFANALRSQGVRRGDIVTIYMPMVPEAAVAML
ACSA_PSEHT      ----------------------------------------ANGLKKLGVQKGDRVAIYMPMSPQAIYAMQ
ACSA_BARQU      ----------------------YHDKKITYNELYEHVCRFANILKNHGVKKGDRVTIYLPMIPEAAYAML
ACSA_AGRVS      ----------------ERTAIIWEDKRITYNQLYDNVCRLANVLKAHGVKKGDRVTIYMPMVPEATYAML
ACSA2_PSEPK     --------------------------------------RLANAMKARGVKKGDRVSIYMPMIPEAAFAML
ACSA_RHIEC      ------------------------DKKITYNELYEHVCRMANVLKKHGVKKGDRVTIYMPMIPEAAYAML
ACSA_PYRAE      --------------------------KLTYYDLYREVNRVAYMLKQNGVKKGDKITLYLPMVPELPITML
LGRD_BREPA      --------EQQAEKTPDAVAVAYKNRELTYAQLNERANQLAHRLIRKGVKPDTLVGICLERSPEMIIGIL
AAS_SALDC       ---------------------------------------------------GEKIGLMLPNAAISAAVIF
AAS_ENTS8       --------------------------------------------------PREAIGLMLPNASISAAVIF
ACSA_MARAV      VLNASACLDRHLEQRGDQTAIIFGDRNVTYRELYEETCKFANVLKDQGVKKGDVVTIYMPMIVETAVAML
ACSA_LEPBP      ---------------------------LTYHDLHREVNHFANVLKKFKVKKGDRVLIYLPMVPELAIATL
ACSA_LEPBA      ---------------------------LTYHDLHREVNHFANVLKKFKVKKGDRVLIYLPMVPELAIATL
TYCC_BREPA      ---LHQLFEEQVDKTPDQAALLFSEQSLTYSELNERANRLARVLRAKGVGPDRLVAIMAERSPEMVXXXX
SRFAA_BACSU     -MTIPELFQEKAELLSDHPAVVFEDRTLSYRTLHEQSARIANVLKQKGVGPDSPVAVLIERSERMITAIM
ACSA_SYNAS      ---------------------------LTYRRLHEEVCRFANVMKSLGLRRGDRVTIYLPMIPELAVAML
AAS_KLEP3       ---------------------------------------------------GEKIGLMLPNAGISAAVIF
ACSA_SHEPA      ---------------------------LTYGQLHAEVCKFANALRSQGVRRGDVVTVYMPMVPEAAVAML
ACSA_RHILW      ------------------------DKKVTYNELYEHVCRMANVLKKHGVKKGDRVTIYMPMIPEAAYAML
AAS_SHISS       ---------------------------------------------------GERIGLMLPNAGISAAVIF
AAS_SHIFL       ---------------------------------------------------GERIGLMLPNAGISAAVIF
AAS_SHIF8       ---------------------------------------------------GERIGLMLPNAGISAAVIF
AAS_SHIB3       ---------------------------------------------------GERIGLMLPNAGISAAVIF
AAS_ECOSE       ---------------------------------------------------GERIGLMLPNAGISAAVIF
AAS_ECOLC       ---------------------------------------------------GERIGLMLPNAGISAAVIF
AAS_ECOHS       ---------------------------------------------------GERIGLMLPNAGISAAVIF
AAS_ECO5E       ---------------------------------------------------GERIGLMLPNAGISAAVIF
AAS_ECO57       ---------------------------------------------------GERIGLMLPNAGISAAVIF
AAS_ECO55       ---------------------------------------------------GERIGLMLPNAGISAAVIF
AAS_ECO24       ---------------------------------------------------GERIGLMLPNAGISAAVIF
ACSA_THEEB      -----------------------GDSRLTYAQLHREVCQFANVLKQLGVKKGDRVGIYMPMIPEAAIAML
AAS_ECOLU       ---------------------------------------------------GERIGLMLPNAGISAAVIF
AAS_ECOLI       ---------------------------------------------------GERIGLMLPNAGISAAVIF
AAS_ECODH       ---------------------------------------------------GERIGLMLPNAGISAAVIF
AAS_ECOBW       ---------------------------------------------------GERIGLMLPNAGISAAVIF
AAS_ECO7I       ---------------------------------------------------GERIGLMLPNAGISAAVIF
PPSD_BACSU      ---ISQLFEQQAARTPKASALVSGDKTLTYQELDEWSNGIARALRSRGVKPDTPVGIMMHRSFSMIASIL
BACC_BACLI      ------LFEEQAEKTPELAAVVSGNDKLTYRELNEKSNQLARYLRDKGVKADTIVAIMAERSPEMVVGIM
ACSA_SHESH      ---------------------------ITYGELHSDVCKFANALRSQGVRRGDIVTVYMPMVPEAAVVML
ACSA_SCHPO      ------LVDRHAIARPDAVALIYEADEPNYRELLASVSQCAGALQSMGVGMGDRVAIYMPMIPETIIAML
ACSA1_PSEAE     ----------------------------------------ANALRGQDVHRGDVVTIYMPMIPEAVVAML
AAS_ECOSM       ---------------------------------------------------GEHIGLMLPNAGISAAVIF
AAS_ECOL6       ---------------------------------------------------GERIGLMLPNAGISAAVIF
AAS_ECO27       ---------------------------------------------------GERIGLMLPNAGISAAVIF
ACVS_CEPAC      ------LFEEAAVRRPQHVALICGDKRITYEELNAMANRLAHHLVSSGIQTEQLVGLFLDKTELMIATIL
AAS_KLEP7       -------------------------------------------------QPGEKIGLMLPNAGISAAVIF
AAS_ESCF3       ---------------------------------------------------GERIGLMLPNAGISAAVIF
AAS_ECOUT       ---------------------------------------------------GERIGLMLPNAGISAAVIF
AAS_ECOK1       ---------------------------------------------------GERIGLMLPNAGISAAVIF
AAS_ECO45       ---------------------------------------------------GERIGLMLPNAGISAAVIF
ACSA_NITEU      ----------------DKTAIIFESDEVNHCSYRELHRQVANGLKSLGIRQGDRVVIYMPMRIEAVVAMQ
ACS1_CANAL      -----------AIKNPDKPAIIYGDEPITYGELLKQVSKLAQALTKLGVKKGDSVAVYLPMIPEAIVTLL
ACSA_PENCH      -----------ALKNPDKVAIIYEGRKITYGELMREVSRVAWTLKERGVKKGDTVGIYLPMIPEAVIAFL
ACSA_AGRRH      ------------------------DRKITYRELYEHVCRMANVLKKHGVKKGDRVTIYMPMVPEAAYAML
ACVS2_PENCH     ------LIEEVVERHEDKIAVVCDERELTYGELNAQGNSLARYLRSIGILPEQLVALFLDKSEKLIVTIL
ACVS1_PENCH     ------LIEEVVERHEDKIAVVCDERELTYGELNAQGNSLARYLRSIGILPEQLVALFLDKSEKLIVTIL
ACSA_SERP5      -LNLAACLDRHLAERGDQTAIIWGDKQVTYKQLHHDVCQFANXXXXXXXXXXXXXAIYMPMVPEAAVAML
AAS_ECOL5       ---------------------------------------------------GERIGLMLPNAGISAAVIF
ACSA2_RHIME     ------------------------DKKITYNELYDKVCRLANVLKEQGVKKGDRVTIYMPMIPEAAYAML
ACSA_SINMW      ------------------------DKKITYNELYDTVCRLANVLKKHGVKKGDRVTIYMPMIPEAAYAML
ACSA_RUBXD      ------------QGRGDKRAIIWGENRLTYSELKAEVEKFANVLKGLGVRKGDAVSIYLPMIPELPIAML
ACS2L_MOUSE     -LNVSVCLDQHVQKSPETIALIWEEVRITYRELLETTCRLANTLKRHGVHRGDRVAIYMPVSPLAVAAML
ACSA_PSESM      ----------------------------------------------------------------------
ACSA_NITEC      -------------------------IRCSYRELHQRVCRFANGLKALGIRQGDRIVIACARIGVIHSVVF
ACSA_CAUCR      ---------------------------LTYGQLHEEVCRMANVLKAQGVKKGDRVTIYLPMVPLAAVAML
AAS_PECCP       ----------------------------------------------------------------------
FCSA_DICDI      -LGIRELLADGKR----------GDYKISYKQACIRANNIGSALVQLGLNKGDRIGIFSINRPEWVLSDM
ACSA_PSE14      ----------------------------------------------------------------------
ACSA1_PSEPK     ----------------------------------------------------------------------
AAS_ERWT9       -------------------------------------------ILERYSQPGEYVGLLLPNATVTAAAIL
ACSA_PSEU2      ----------------------------------------------------------------------
AAS_ERWCT       ----------------------------------------------------------------------
AAS_CITK8       ---------------------------------------------------GENIGLMLPNAAISAAVIF
ACSA_SHELP      ---------------------------LTYGELHTEVCKFANALRSQGVRRGDVVTVYMPMVPEAAVVML
AAS_YERE8       -------------------------------------------ILQRFTAQGEHVGMLLPNXXXXXXXXF
ACS2_CANAL      ---------------------------LTYGDLLREVSKVAGVLQSWGIKKGDTVAVYLPMNAQAIIAML
ACSL1_MOUSE     ---------------------------ISYKEVAELAECIGSGLIQKGFKPCSEIGLFSQNRPEWVIVEQ
ACSA_DROME      ----------------------------------------ANVLKDHGIRKGDRVSIYMPMILELPIAML
ACS2L_HUMAN     -LNVSVCLDQHVRKSPESVALIWEEVRITYRELLETTCRLANTLKRHGVHRGDRVAIYMPVSPLAVAAML
PPSA_BACSU      ------LFERQAAFTPERLAIRFSGGSLTYAELDMYASRLAAHLAARGVTNESIVGVLSERSPDMLIAVL
AAS_YERPY       -------------------------------------------ILQRFTVPGEHVGMLLPNATITAAAIF
AAS_YERPS       -------------------------------------------ILQRFTVPGEHVGMLLPNATITAAAIF
AAS_YERPP       -------------------------------------------ILQRFTVPGEHVGMLLPNATITAAAIF
AAS_YERPG       -------------------------------------------ILQRFTVPGEHVGMLLPNATITAAAIF
AAS_YERPB       -------------------------------------------ILQRFTVPGEHVGMLLPNATITAAAIF
AAS_YERP3       -------------------------------------------ILQRFTVPGEHVGMLLPNATITAAAIF
ACS2_DEBHA      --------------------------------------QVAGVLQSWGIKKGDTVAIYMPMNSQAIIAML
ACSA_MYCTU      -----------------------GDRRLTYSDLLAEVSKAANALTDLGLVAGDRVAIYLPLIPEAVIAML
ACSA_MYCBO      -----------------------GDRRLTYSDLLAEVSKAANALTDLGLVAGDRVAIYLPLIPEAVIAML
PPSC_BACSU      ------LFERQAAVTPERLAIRFSGGSLTYAELDMYASRLAAHLAARGVTNESIVGVLSERSPDMLIAVL
ACSL1_CAVPO     ---------------------------LSYKQVEDLSECIGSALLQKGFQPDQFIGIFAQNRPEWVIIEQ
ACSA_PSYCK      -LNISVCLDRHVRNNPYKPAIIWGDHPSLHKIISFAVCRLGNAMRKLGVKKGDRVTLYMPMIPEAMVAML
LGRA_BREPA      ------LFEQQVEMTPDHVAVVDRGQSLTYKQLNERANQLAHHLRGKGVKPDDQVAIMLDKSLDMIVSIL
ACVS_EMENI      ---LNHLIEEATQLHEDKVAIVYKRRQLTYGELNAQANCFAHYLRSIGILPEQLVALFLEKSENLIVTIL
AAS_YERPE       -------------------------------------------ILQRFTVPGEHVGMLLPNATITAAAIF
AAS_YERPA       -------------------------------------------ILQRFTVPGEHVGMLLPNATITAAAIF
ACSA_SYNY3      -----------------------GDSRITYAQLHREVCQFANALKSLGVQKGDRVAIYLPMIPEAAITML
ACSA_COPCI      -----------AFKHPEKTAIIYGEGRISYAELLREVCSIANVLKSFGVKKGDTVSVYLPMTWQAVAAFL
ACS1_DEBHA      --------------------------------------KLAQCLTKLGIRKGDSVAVYLPMIPEALVTLL
S27A2_RAT       ---LHVFLEQ-ARKTPHKPFLLFRDETLTYAQVDRRSNQVARALHDHGLRQGDCVALFMGNEPAYVWLWL
ACSL6_RAT       ----------------------------------------------------------------------
ACSL6_HUMAN     ----------------------------------------------------------------------
ACSL1_RAT       ---------------------------ISYKQVAEMAECIGSALIQKGFKPCSEIGIFSQNRPEWVTIEQ
ACSA_STRCO      -----------------------GDSRLTYAQLKDEVSKAANALLELGVQKGDRVAIYMPMIPETAIAML
ACVS_STRCL      ---LNDLVEAAVRRSPDREAVVFGTQRLTYREVDARANRFAHWLLGLGVRSQQLVGIFLDKSDLGVVATL
ACSL1_HUMAN     ---------------------------LSYKQVAELSECIGSALIQKGFKPDQFIGIFAQNRPEWVIIEQ
TYCA_BREPA      ------LFEEQAEAFPDRVAIVFENRRLSYQELNRKANQLARALLEKGVQTDSIVGVMMEKSIENVIAIL
ACSA_DEIRA      --------------------------------------KAANALEELGVVAGDRVTLYMPLIPEAAIAML
MYCA_BACSU      --------ETQAEQRPDDEAVIFGNERCTYGQLNERVNQLARTLRTKGVQADQFVAIICPHRIELIVGIL
ACSA_RALEJ      --------------------------RVSYRDLHAKVCRFANGLKALGIKKGDRVVIYMPMSVEGVVAMQ
BACB_BACLI      ----SELFEEQAEKSPNHPAAVFKDQMLTYRELNEKANQLARTLRQKGVQRESVVGIMAERSLEMLTGIL
ACSA_COPC7      -----------AFKHPEKTAIIYGEGRISYAELLREVCSIANVLKSFGVKKGDTVSVYLPMTWQAIAAFL
MYCC_BACSU      ------LFEEQANRTPDQVAVVYEENQLTYQELNEKANQIARTLQSEGVHPDQPVGIMAERSLEMIVGLF
ACSL6_MOUSE     ----------------------------------------------------------------------
ACSA_PSYA2      -LNISVCLDRHVKNNPYKPAIIWGDHPSLHKIISFAVCRLGNAMRKLGVKKGDRVTLYMPMIPEAVVAML
ACSA_DICDI      --------------------------------------RLSNLLISLGVGKGDTVAIYLPNTPTAIYSML
S27A3_MOUSE     ------------------------------------------------LAPGATVALLLPAGPDFLWIWF
SRFAB_BACSU     ----AALFEKQAQQTPDHSAVKAGGNLLTYRELDEQANQLAHHLRAQGAGNEDIVAIVMDRSAEVMVSIL
GRSA_BREBE      ------LFEEQVSKRPNNVAIVCENEQLTYHELNVKANQLARIFIEKGIGKDTLVGIMMEKSIDLFIGIL
ACSA_THIDA      -LNVSYCLDRHLATRGDKTALIFGSVRVTYKELHARVCQFANGLKSLGVGKGDRVIVYMPMSIEAVVAMQ
ACS2_CANGA      ---------------PDKPAIIYDDEKDNYTILLRRVSKVAGILKSWGVKKGDTVAIYLPMIPEAIIAML
S27A2_MOUSE     -----------ARKTPHKPFLLFRDETLTYAQVDRRSNQVARALHDQGLRQGDCVALFMGNEPAYVWIWL
ACSA_THET2      ----------------------------------------ANVLKRLGVKKGDRVTIYLPMIPEAAIAML
SRFAC_BACSU     ---LTYWFKEAVNANPDAPALTYSGQTLSYRELDEEANRIARRLQKHGAGKGSVVALYTKRSLELVIGIL
PRPE_SALTY      -------------------------------------NIVAAMLLSLGVQRGDRVLLACARIGAIHSVVF
GRSA_ANEMI      ------LFEEQVSKRPNNVAIVCENEQLTYHELNVKANQLARIFIEKGIGKDTLVGIMMEKSIDLFIGIL
ACSA_THET8      ----------------------------------------ANVLKRLGVKKGDRVTIYLPMIPEAAIAML
ACSA_RALEH      --------------------------RVTYRELHGKVCRFANGLKALGIRKGDRVVIYMPMSVEGVVAMQ
ACS1_KLULA      ------LVDRHAFTQPNKVAILYEGYSLTYALLEQVCKVAQILQYSMNVKKGDTVAVYMPMIPQALITLL
BAIB_EUBSP      -------LEYVSECKPDSTAVICLDKEQNCSVIHVYSSQLAWYLIENEIGPGSIVLTMFPNSIEHIIAVF
ACSA_PSEU5      ----------------------------------------ANALRGQDVHRGDVVTIYMPMIPEAAVAML
ACSA_RALSO      --------------------------RITYRELHARVCRFANGLKALGIRKGDRVVIYMPMSIEGVVAMQ
ACSA_PHYBL      -----------AFKNPDKIAIIHGDRRITYGELLREVCRMANVLKGLGVRKGDPVAIYMPMIPETIVAIL
ACS1_CANGA      --------------------------------------QVAQILYSMNVKKGDTVAVYMPMIPEALITLL
ACSA_RALME      --------------------------RVSYQELLAKVSRFANGMKALGIKKGDRVVIYMPMSVEGVVAMQ
ACS2_ZYGBA      -------------------------------------SRVAGVLQSWGVKKGDTVAVYLPMIPEAVVAML
PRPE_ECOLI      -------------------------------------NAVASMLRSLGVQRGDRVLLACARIGAIHSVVF
ACSA_BURS3      ----------------ERVAVIFEATRVTYADLLARVSRFANALKKRGIGKGDRVVIYIPMSIEGIVAMQ
DLTA_BACC2      -MKLLELIEKWAIETPDQTAFVWRDAKITYKQLKEDSDALAHWISSAYPDDRSPIMVYGHMQPEMIINFL
ACS2_KLULA      -----------ADDESENKVITFGELLRQ-------VSEVAGVLQSWGVKKGDTVAVYLPMIPXXXXXXX
DLTA_BACCR      -------IEKWAAETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFL
DLTA_BACC4      -------IEKWAAETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFL
ACSA_OCHA4      ------------------------DKKITYRELHENVCRLANVLKKHGVKKGDRVTIYLPMIPEAAYAML
ACS1_ASHGO      ------LVDRHAARTPDKVAIIYEGYSLTYRELLAQVCKVAQVLYSMGVRKGDTVAVYMPMIPQALVTLL
LCFH_HAEIN      -------------------------------------NQLSRALLAHNIDVQDKIAIFAHNMERWTIVDI
ACS2_YEAST      -------------------------------------SQIAGVLKSWGVKKGDTVAIYLPMIPEAVIAML
ACS1_YEAST      -----------ALKTPNKKAIIFGDYSITYKELLEEVCQVAQVLTSMGVRKGDTVAVYMPMVPEAIITLL
ACSL5_HUMAN     ---------------------------LSYKQVSDRAEYLGSCLLHKGYKPDQFVGIFAQNRPEWIISEL
ACSA_CUPTR      --------------------------RVTYRELHAKVCRLANGLKTLGIRKGDRVVIYMPMSVEGVAAMQ
ACBG1_HUMAN     ---------------------------ISYSQYYLLARRAAKGFLKLGLKQAHSVAILGFNSPEWFFSAV
S27A2_HUMAN     -----------ARQTPHKPFLLFRDETLTYAQVDRRSNQVARALHDHGLRQGDCVALLMGNEPAYVWLWL
DLTA_BACWK      -------IEKWAVETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFL
DLTA_BACC1      -------IEKWAIETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFL
DLTA_BACHK      -------IEKWAIETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFL
DLTA_BACC3      -------IEKWAIETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFL
DLTA_BACC0      -------IEKWAIETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFL
DLTA_BACAH      -------IEKWAIETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFL
ACSA_PYRAR      --------------------------KLTYYDLFREVNRVACMLKCNGVKKGDRVTLYLPMVPELPITML
ENTF_ECO57      ---LSALVAEQAAKTPDAPALADARYQFSYREMREQVVALANLLREHGVKPGDSVAVALPRSVFLTLALH
DLTA_BACCZ      -------IEKWAIETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFL
DLTA_BACCQ      -------IEKWAIETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFL
DLTA_BACAN      -------IEKWAIETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFL
DLTA_BACAC      -------IEKWAIETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFL
DLTA_BACAA      -------IEKWAIETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFL
ACSA_CRYPV      --------------------------------------KMANVLKRFGIKKGDSVGIYMPMIPETIYTML
ACS2_ASHGO      --------DDEADNR----VVTFGELLRQ-------VSQVAGVLQSWGVKKGDTVAVYMPMIPEAVVAML
ACBG1_RAT       --------------------------RISYYQYYLIARKVAKGFLKLGLERAHSVAILGFNSPEWFFSAV
PPSE_BACSU      ------LFREQAEKTPDHTALVYGNMSISYKELDKRSNALARELIQKGFRKNETAGILAAHSPEFMISVL
DLTA_BACC7      -------IEKWAIETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFL
ACBG1_MACFA     ---------------------------ISYSQYYLLARRAAKGFLKLGLERAHSVAILGFNSPEWFFSAV
ACSA_BURP8      ----------------ERVAIIFDDGTITNVTYNDLLQRVANALKQRGIKKGDRVVIYMPMSVEGIVAMQ
ACBG1_MOUSE     --------------------------RISYYQYYLIARKVAKGFLKLGLERAHSVAILGFNSPEWFFSAV
S27A5_RAT       -------------------------------------------------------------------VFL
ACSA_RALPJ      --------------------------RTTYRELHARVCRFANGLKALGIKKGDRVVIYMPMSVEGIVAMQ
ACSA_HERAR      ----------------------------------------------------------------------
AAS_PHOLL       --SLLVARKQFGRFKPCIEDVSFKEDSYNSLLKKVLA---ASRILQRFTCQGERIGFLLPNATIMVAAIF
LCF2_SCHPO      ----------------------------------------------------------------------
ACSL5_MOUSE     ----------------------------------------------------------------------
ENTF_SHIFL      ---LSALVAEQAAKTPDAPALADARYLFSYREMHEQVVALANLLRERGVKPGDSVAVALPRSVFLTLALH
ENTF_ECOLI      ---LSALVAEQAAKTPDAPALADARYLFSYREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALH
DLTA_BACCN      -------IEKWATETPDQTAFVWRDAKITYKQLKDDSDALAHWISSEYPDDSSPIMVYGHMQPDMIISFL
MENE_SALTY      --------------RSQAPALRLNDEVLSWRALCERIDVLAGGFAAQGVREGDGVLLRAGNQPRTLLAWL
ACSA_HUMAN      --------------------------------------QFSNVLRKQGIQKGDRVAIYMPMIPELVVAML
S27A5_MOUSE     -------------------------------------------------------------------VFL
ACSL5_RAT       ----------------------------------------------------------------------
MENE_ECOLI      ----------------------------------------------------------------------
S27A1_BOVIN     ------------QRQPERLALVDAGSGATFAQLDAYSNAVANLFRRLGFAPGDVVAIFMEGRPEFVGLWL
ACSA_BRUSU      ------------------------DKKITYRELYENVCRMANVLKKHGVKKGDRVTIYLPMIPEAAYAML
ACSA_BRUSI      ------------------------DKKITYRELYENVCRMANVLKKHGVKKGDRVTIYLPMIPEAAYAML
ACSA_BRUO2      ------------------------DKKITYRELYENVCRMANVLKKHGVKKGDRVTIYLPMIPEAAYAML
ACSA_BRUME      ------------------------DKKITYRELYENVCRMANVLKKHGVKKGDRVTIYLPMIPEAAYAML
ACSA_BRUC2      ------------------------DKKITYRELYENVCRMANVLKKHGVKKGDRVTIYLPMIPEAAYAML
ACSA_BRUAB      ------------------------DKKITYRELYENVCRMANVLKKHGVKKGDRVTIYLPMIPEAAYAML
ACSA_BRUA2      ------------------------DKKITYRELYENVCRMANVLKKHGVKKGDRVTIYLPMIPEAAYAML
ACSA_BRUA1      ------------------------DKKITYRELYENVCRMANVLKKHGVKKGDRVTIYLPMIPEAAYAML
S27A6_HUMAN     -----------AKRQPRKPFIIYEGDIYTYQDVDKRSSRVAHVFLNHSLKKGDTVALLMSNEPDFVHVWF
ACSA_BURTA      ----------------ERIAVIFEAARVTYADLLARVSRFANALKKRGIGRGDRVVIYIPMSVEGIVAMQ
S27A4_MACFA     -----ILFASTVRRHPDKTALIFEDTHWTFRQLDEYSSSVANFLQARGLASGDVAAIFMENRNEFVGLWL
ACSA_BURPS      ----------------ERVAVIFEATRVTYADLLARVSRFANALKKRGVGRGDRVVIYIPMSVEGIVAMQ
ACSA_BURP6      ----------------ERVAVIFEATRVTYADLLARVSRFANALKKRGVGRGDRVVIYIPMSVEGIVAMQ
ACSA_BURP1      ----------------ERVAVIFEATRVTYADLLARVSRFANALKKRGVGRGDRVVIYIPMSVEGIVAMQ
ACSA_BURP0      ----------------ERVAVIFEATRVTYADLLARVSRFANALKKRGVGRGDRVVIYIPMSVEGIVAMQ
ACSA_BURMS      ----------------ERVAVIFEATRVTYADLLARVSRFANALKKRGVGRGDRVVIYIPMSVEGIVAMQ
ACSA_BURMA      ----------------ERVAVIFEATRVTYADLLARVSRFANALKKRGVGRGDRVVIYIPMSVEGIVAMQ
ACSA_BURM9      ----------------ERVAVIFEATRVTYADLLARVSRFANALKKRGVGRGDRVVIYIPMSVEGIVAMQ
ACSA_BURM7      ----------------ERVAVIFEATRVTYADLLARVSRFANALKKRGVGRGDRVVIYIPMSVEGIVAMQ
DLTA_BACLD      -----------AQTQPDTLAFVNEEEKLTYGELWSQSERLAARIQSEALTDASPIIVYGHMKPVMAVSFL
S27A4_MOUSE     -----LLFASMVQRHPDKTALIFEDTHWTFRQLDEYSSSVANFLQARGLASGNVVALFMENRNEFVGLWL
ACSA_BRUMB      ------------------------DKKITYRELYENVCRMANVLKKHGVKKGDRVTIYLPMIPEAAYAML
S27A4_HUMAN     -----ILFASTVRRHPDKTALIFEDTHWTFRQLDEYSSSVANFLQARGLASGDVAAIFMENRNEFVGLWL
PKSJ_BACSU      ------LFEQQAKKTPDRAAVSYEGQTLTYRELDEKSTQLAIYLQAHGVGPDRLAGIYVDRSLDMLVGLL
VRAA_STAAR      ----------------------------------------------------------------------
DLTA_STRPC      ----------------------------------------------------------------------
DLTA_STRP6      ----------------------------------------------------------------------
DLTA_STRP3      ----------------------------------------------------------------------
DLTA_STRP1      ----------------------------------------------------------------------
DLTA_STRPZ      ----------------------------------------------------------------------
DLTA_STRPM      ----------------------------------------------------------------------
DLTA_STRPG      ----------------------------------------------------------------------
DLTA_STRPF      ----------------------------------------------------------------------
DLTA_STRPD      ----------------------------------------------------------------------
DLTA_STRP8      ----------------------------------------------------------------------
ACSA_MOUSE      --------------------------------------QFSNVLRKQGIQKGDRVAIYMPMILELVVAML
MBTB_MYCSS      -------LHDGAAHTPDATAVIGSTGTLTYAELRERVLAVTGALQVAGIKPGDTVAVMGPKCADQVTALL
ACBG1_BOVIN     ---------------------------ISYTQYYLLARKAAKGFLKLGLERAHSVAILAFNSPEWFFSAV
MYCB_BACSU      --------EQQAEDTPDRVAILFENQTWTYRQLNERSNQLARVLRNQGVGADRVAAILTERSANMMIGIL
ACBG2_CHICK     ----------------------------------------------------------------------
VRAA_STAAW      ----------------------------------------------------------------------
VRAA_STAAS      ----------------------------------------------------------------------
VRAA_STAAN      ----------------------------------------------------------------------
VRAA_STAAM      ----------------------------------------------------------------------
VRAA_STAAC      ----------------------------------------------------------------------
VRAA_STAA1      ----------------------------------------------------------------------
S27A3_HUMAN     ------------------------------------------------------VALLLPAGPEFLWLWF
FAD11_MYCTU     ----------------------------------------------------------------------
ACSA_HELPH      ------------KDKKNKVAIIFGDYNITYRKLHSEVNKTANLLKNENVKKGDRVIIYMPMIVESVYMML
VRAA_STAHJ      ----------------------------------------------------------------------
S27A4_PONAB     -----ILFASTVRRHPDKTALIFEDTLWTFRQLDEYSSSVANFLQARGLASGDVAAIFMENRNEFVGLWL
DLTA_LISMF      -----------AEKTPDFPCYEYAGTRLSYKELKRQSDAFGSFLLKNLNTDKEKPIIVYGHMPLMLVAFL
ACSA_HELPG      ------------KDKKNKVAIIFGDYNITYRKLHSEVNKTANLLKNENVKKGDRVIIYMPMIVESVYMML
ACSA_HELP2      ------------KDKKNKVAIIFGDYNITYRKLHSEVNKTANLLKNENVKKGDRVIIYMPMIVESVYMML
PKSN_BACSU      ------VFEEKAKQTPDAVAVMFEDRSLTYKEVDEKSTSVAVYLQHQGVRPEQPVGICAERSFDMXXXXX
ACSA_HELPY      ------------KDKKNKVAIIFGDYNITYRKLHSEVNKTANLLKNENVKKGDRVIIYMPMIVESVYMML
DLTA_LISMO      -----------AEKTPDFPCYEYAGTRLSYKELKRQSDAFGSFLLKNLITDKEKPIIVYGHMPLMLVAFL
DLTA_LISMC      -----------AEKTPDFPCYEYAGTRLSYKELKRQSDAFGSFLLKTLNTDKEKPIIVYGHMPLMLVAFL
DLTA_STRE4      ----------------------------------------------------------------------
ACBG2_XENLA     ----------------------------------------------------------------------
SID2_USTMA      ---------------------------MSYPELEQASNGVANLF--RHLPRNSVVGVCLERGLESYIVPL
DLTA_LISMH      -----------AEKTPDFPCYEYAGTRLSYKELKRQSDAFGSFLLNNLNTDKEKPIIVYGHMPLMLIAFL
DLTA_LISIN      -----------AEKTPDFPCYEYAGTRLSYKELKRQSDAFGSFLLNTLNSDKEKPIIVYGHMPLMLIAFL
ACSS3_PONAB     -------------------------------------SKLAGVLVKHGIKKGDTVVIYMPMIPQAMYTML
ACSS3_HUMAN     -------------------------------------SKLAGVLVKHGIKKGDTVVIYMPMIPQAMYTML
DLTA_BACA2      --------------------------------------------------------------------FL
BGML_DROME      ----------------------------------------------------------------------
ACSA_HELAH      ------------KDKKNKVAIIFGEMAITYRKLHSEVNKTANLLKNENIKKGDRVIIYMPMIAESVYMML
ACBG2_MOUSE     ----------------------------------------------------------------------
LCF1_SCHPO      ---------DGEKKEVPKSWSYFELSDYNYLSFNDIALRYAGALRKLGLNKGDKFELYAPTSAFWLLTAE
S27A5_HUMAN     ----------------------------------------------------------------------
DLTA_STRMU      ----------------------------------------------------------------------
S27A1_HUMAN     ------------QRQPERLALVDAGTGWTFAQLDAYSNAVANLFRQLGFAPGDVVAIFLEGRPEFVGLWL
LCF1_YEAST      -----------------------------------IMHEIGRGLVKIGLKPNDKLHLYAATSHKWMKMFL
ANGR_VIBAN      ---------------PNALAIIHGQESLDYITLASYAKSCAGALTEAGVKSGDRVAVTMNKGIGQIVAVL
ACSA_CHLTE      ---------------------------LTYGELHRQVSKFANVLKIAGIKPGDKVAIYMGMVPELVIAVL
ACSB_DICDI      ----------------------------------------------------------------------
MBTM_MYCSS      ----------------------------------------------------------------------
DLTA_LISW6      -----------AEKTPDFPCYEYAGTRLSYKELKRQSDALGSYLLKNLKTDKEKPIIVYGHMPLMIIAFL
VRAA_STAEQ      ----------------------------------------------------------------------
BGM_DROME       ----------------------------------------------------------------------
ACSS3_MOUSE     ---------------------------ISYKEVLEQVSKLAGVLVKQGVKKGDTVVIYMPMIPQAIYTML
DLTA_BACSU      --------------------------------------------------------------PHMIVSFL
DLTA_LACCB      ----------------------------------------------------------------------
DLTA_LACC3      ----------------------------------------------------------------------
ACBG2_RAT       ----------------------------------------------------------------------
FAD26_MYCTU     ------LLQERADQQPDSTAYTYIDYSLTWSQVYSRACIIAEELKLCGL-PGDRVAVLAPQGLEYVLAFL
ACSL3_PONAB     ----------------------------------------------------------------------
ACSL3_HUMAN     ----------------------------------------------------------------------
FCSB_DICDI      ----------------------------------------------------------------------
MBTB_MYCPA      ----------------------------------------------------------------------
DLTA_STRZP      ----------------------------------------------------------------------
DLTA_STRR6      ----------------------------------------------------------------------
DLTA_STRPN      ----------------------------------------------------------------------
DLTA_STRP2      ----------------------------------------------------------------------
DLTA_LACPL      ----------------------------------------------------------------------
DLTA_STRA3      ----------------------------------------------------------------------
ACSL3_RAT       ----------------------------------------------------------------------
DLTA_STRP7      ----------------------------------------------------------------------
DLTA_STRA5      ----------------------------------------------------------------------
DLTA_STRA1      ----------------------------------------------------------------------
ACSL4_HUMAN     --------------------LILGNYKMNYLEVNRRVNNFGSGLTALGLKPKNTIAIFCETRAEWMIAAQ
ACSA_STRAW      -----------------------GDSRITYAELKDEVSKAANALTELGVQKGDRVAVYLPMIPEAVVAML
Y3568_PSEAE     ---------------------------------------------------GDRVIIYMPMVPQAAMAML
ACSS3_BOVIN     ---------------------------ITYKEVLEQVSKLAGVLVKHGVKKGDTVVIYMPMIPQAMYAML
ACSA_WOLSU      --------------RKNKAAIIFGDSRITYRELFYEVKRTANLLKNKNVKKGDRVVIYMPMIPEAAFMML
VRAA_STAES      ----------------------------------------------------------------------
LCF4_YEAST      ----------------------------------------------------------------------
DLTA_STRZT      ----------------------------------------------------------------------
DLTA_STRPJ      ----------------------------------------------------------------------
S27A1_MOUSE     -----------ARRQPERLALVDASSGITFAQLDTYSNAVANLFRQLGFAPGDVVAVFLEGRPEFXXXXX
ACSL4_RAT       --------------------LILGNYKINYLEVNCRVNNFGSGLTALGLKPKNTIAIFCETRAEWMIAAQ
ACSA_CAMJ8      -LNVSYCLDRHMKTRRNKAALIFGDYEVTYRRLLHETCKAANLLKKFGVKKGDRVVIYMPMIPETAIVML
ACSA_CAMJJ      -LNVSYCLDRHMKTRRNKAALIFGDYEVTYRRLLHETCKAANLLKKFGVKKGDRVVIYMPMIPETAIVML
ACSA_CAMJE      -LNVSYCLDRHMKTRRNKAALIFGDYEVTYRRLLHETCKAANLLKKFGVKKGDRVVIYMPMIPETAIVML
ACSL4_MOUSE     --------------------LILGNYKINYLEVNCRVNNFGSGLTALGLKPKNTIAIFCETRAEWMIAAQ
DLTA_STAXY      MKDIIYSLIENEKMYPEQIAIKHNTDVLTYRELNQYANKLADLIKDT----------KSPLIVYSPFMIV
S27A1_RAT       -----------AQRQPERLALVDASSGITFAQLDTYSNAVANLFLQLGFAPGDVVAVFLEGRPEFXXXXX
ACSL3_MOUSE     ----------------------------------------------------------------------
SIB1_SCHPO      -------------------------IRLTYSELNERANKLAHNLKSYGFRVGSIIAVYFDKCIEAFISML
DLTA_LACRH      ----------------------------------------------------------------------
MBTB_MYCTU      ----------------------------------------------------------------------
MBTB_MYCBO      ----------------------------------------------------------------------
FAT1_YEAST      ------------------------------------------------VQAGDYVAIDCTNKPLFVFLWL
HMWP2_YERE8     -------------------ALAVTDMRYNYHELTDYARRCAGRLVECGVQPGDNVAITMSKXXXXXXXXX
DLTA_STAES      ----------------------------------------------------------------------
ACBG2_HUMAN     ----------------------------------------------------------------------
MENE_HAEIN      ----------------------------------------------------------------------
FAT1_COCHE      ----------------------------------------------------------------------
LCF2_YEAST      ----------------------------------------------------------------------
ACSM6_HUMAN     ----------------------------SFERMTQLSKKAASILSDTALSHGDRLMIILPPTPEAYWICL
DLTA_STAAB      ----------------------------------------------------------------------
PABL_STRGR      -LTLPRVFADAVHRGGDAVALVDGEYALTWSAWRTAVDALARGLQESGVVSGDVVALHLPNSWEYLTLHL
LCF3_YEAST      ----------------------------------------------------------------------
DLTA_STAAW      ----------------------------------------------------------------------
DLTA_STAAU      ----------------------------------------------------------------------
DLTA_STAAT      ----------------------------------------------------------------------
DLTA_STAAS      ----------------------------------------------------------------------
DLTA_STAAN      ----------------------------------------------------------------------
DLTA_STAAM      ----------------------------------------------------------------------
DLTA_STAAE      ----------------------------------------------------------------------
DLTA_STAAC      ----------------------------------------------------------------------
DLTA_STAA9      ----------------------------------------------------------------------
DLTA_STAA8      ----------------------------------------------------------------------
DLTA_STAA3      ----------------------------------------------------------------------
DLTA_STAA2      ----------------------------------------------------------------------
DLTA_STAA1      ----------------------------------------------------------------------
DLTA_LACLA      ----------------------------------------------------------------------
LYS2_CANGA      ------IFQDNAEKFPERTCVVTKTRTFTYKDINEASNIVAHYLINTGIKRGDVVMIYSSRGVDLMVCVM
MBTM_MYCPA      ----------------------------------------------------------------------
LYS2_YEAST      ------IFQDNAEAFPERTCVVETSRSFTYRDINRTSNIVAHYLIKTGIKRGDVVMIYSSRGVDLMVCVM
DLTA_STAAR      ----------------------------------------------------------------------
DLTA_STAEQ      ----------------------------------------------------------------------
FAD28_MYCBO     --SLPAALRACARLQPHDPAFTFMDYEQDWDGVSQLYRRTLNVALSRCGSTGDRVVISAPQGLEYVVAFL
DLTA_STAHJ      MTDIINLINDFGQSNPERVAVRHKDEELTYQQLMDESSKLAHLL-----QDNHKPLIVYGHMPYMLVGMI
ACSF4_MOUSE     ----------------------------------------------------------------------
ESYN_FUSEQ      ----------------------------------------------------------------------
ORA_PLAFN       ----------------------------------------------------------------------
HTS1_COCCA      -------------------AIDAWDGRMSYTELERVSSTWARQLQKQGISQGSWVLFCFEKSRLAVVSMI
ACSA_NOSLI      ------------------------DSKVTYRELHARVCQLANAMRGMGVQKGDRVCIYLPMIEEAAVAML
ACSF4_DANRE     ----------------------------------------------------------------------
FAD21_MYCLE     MQNSSVLLRERAGLQPDDEAFSFTDYEQDWAGVRKTLTNVAHELRRHGSIRDRAVILAPQGLDYI-IAFL
MBTM_MYCTU      ----------------------------------------------------------------------
MBTM_MYCBO      ----------------------------------------------------------------------
LYS2_PENCH      -----------------------------YRQINEASNILGHHLVRSGIQRGEVVMVYAYRGVDLVVAVM
LYS2_ASHGO      ------IFQHHAETRPDRLCVVVAARTFTYSAINCASNIVAHYLLARGIRRGDVVMIYSTRXXXXXXXXX
ESYN_GIBPU      ----------------------------------------------------------------------
LYS2_SCHPO      -----------------------------YRQIDESSNILAHHLVKNGIERGDVVMVYAYRGVDLVVAVM
FAD25_MYCTU     ---------------------------------------------------GDRALILAPQSLDYVVSFI
FAD21_MYCTU     --------------------------------------------VRRHCTTGDRAVILAPQGLAYIAAFL
FAD21_MYCBO     --------------------------------------------VRRHCTTGDRAVILAPQGLAYIAAFL
ACSF4_HUMAN     ----------------------------------------------------------------------
LYS2_CANAL      ---------DNANKHPDRTCVVSKTRNFSYHKLIKLLIVVGNYLKETGIKKGDIVMIYAYRGVDLMIAVM
PCL_HALHA       ----------------------------------------------------------------------
DIP2A_HUMAN     -------------------------LKLAYTLLNKLTSKNEPLL-----KPGDRVALVFPNSDMFMVAFY
PCL_RHOS4       ----------------------------------------------------------------------
PATJ_DROME      --------KDG-RLRSGDHILQIGDVNLH----EMVSEQVAAVLRQSGTHV--RLVVARPVEQSVPTPQY
DIP2A_MOUSE     -------------------------LKLAYTLLNKLTSKNEPLL-----NPGDRVALVFPNSDMFMVAFY
YAC2_METSO      --------------------------KITYAQLEKEVNKFANGLKSLGVVKGDRVMLYMPMIPQLPIAML
DIP2B_MOUSE     -------------------------LKLAYTLLNKLGTKNEPVL-----KPGDRVALVYPNPVMFMVAFY
DIP2C_HUMAN     -------------------------MKVAYSILHKLGTKQEPM-----VRPGDRVALVFPNPAAFMAAFY
DIP2B_HUMAN     -------------------------LKLAYTLLNKLGTKNEPVL-----KPGDRVALVYPNPVMFMVAFY
DIP2B_DANRE     -------------------------LKLAYTLLNKLGTKNEPVL-----KPGDRVALVYPNSDMFWVAFY


                         .         .         *         .         .         .         .:140
query           GALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGA
LCFB_BACSU      GALKAGIVVVPINPLYTPTEIGYMLTNGDVKAIVGVSQL--LPLYESMHESLPKV---ELVILCQTGEAE
LCFA_BACSU      GVLFAGGIVVQTNPLYTEHELEYQLRDAQVSVIITLDLLFPKAIKMKTLSIVDQILITSVYLPFPKKVHI
LCFA_ECO57      GILRAGMIVVNVNPLYTPRELEHQLNDSGASAIVIFAHTLEKVVDKTA---VQHVILTRMGDQLSTAKGT
LCFA_ECOLI      GILRAGMIVVNVNPLYTPRELEHQLNDSGASAIVIFAHTLEKVVDKTA---VQHVILTRMGDQLSTAKGT
LCFA_ECOL6      GILRAGMIVVNVNPLYTPRELEHQLNDSGASAIVIFAHTLEKVVDKTA---VQHVILTRMGDQLSTAKGT
LCFA_SALTY      GILRAGMIVVNVNPLYTPRELEHQLNDSGAAAIIIVSNFAHTLEKVVEKTSVQHVILTRMGDQLSTAKGT
LCFA_SALTI      GILRAGMIVVNVNPLYTPRELEHQLNDSGAAAIIIVSNFAHTLEKVVEKTSVQHVILTRMGDQLSTAKGT
LCFA_YERPE      GVLRAGMIVVNVNPLYTPRELEHQLSDSGAVAIVIVSNFAHTLEKVVFKTQVRHVILTRMGDQLSAAKGT
LCFA_HAEIN      GILRAGLIAVNVNPLYTPRELELQLQDSGAVAIVVVTNVKHVILTRMGDQLSFGKRTLVNFXXXXXXXXX
CAIC_SALAR      GLAKIGAIVVPINARLLREESAWILQNSRTSLLV--TSAPFYPMYRQIQQ------EGRTPLSHICLIGP
ACSF2_RAT       ATAQAGIILVSVNPAYQASELEYVLRKVGCKGIILKQVCPELEKAQPGALKSERLPDLTTVISVDAPLPG
CAIC_CITK8      GLAKIGAIMVPINARLLREESAWILQNSRAQLIV--TSAEFYPMYR------QILLEDDTLLNHICLIGE
CAIC_ECOSM      GLAKIGAIMVPINARLLREESAWILQNS--QACLLVTSAQFYPMYQQIQQATQLRHICLTDVALPADDGV
CAIC_ECO27      GLAKIGAIMVPINARLLREESTWILQNS--QACLLVTSAQFYPMYQQIQQATQLRHICLTDVSLPADDGV
CAIC_ECOUT      GLAKIGAIMVPINARLLREESTWILQNS--QACLLVTSAQFYPMYQQIQQASQLRHICLIDMALPADDGV
CAIC_ECOK1      GLAKIGAIMVPINARLLREESTWILQNS--QACLLVTSAQFYPMYQQIQQASQLRHICLIDMALPADDGV
CAIC_ECO81      GLAKIGAIMVPINARLLREESTWILQNS--QACLLVTSAQFYPM----YQQIQQEDASELHICL------
CAIC_ECO45      GLAKIGAIMVPINARLLREESTWILQNS--QACLLVTSAQFYPMYQQIQQASQLRHICLIDMALPADDGV
4CL2_SOLTU      GASYLGAISTMANPLFTPAEVVKQAKASSAKIVITFAG---------------KVKDYAIENDLKVIC--
ACSF2_MOUSE     ATAQAGIILVSVNPAYQSSELEYVLRKVGCKGIILKQVCPELEKAQPGALKSERLPDLTTVISVDAPLPG
CAIC_SHIFL      GLAKIGAIMVPINARLLREESEWILQNS--QACLLVTSAQFYPMYQQIQQATQLRHICLTDVALPADDGV
CAIC_ECO7I      GLAKIGAIMVPINARLLREESAWILQNS--QACLLVTSAQFYPMYQQIQQATQLRHICLTDVALPADDGV
CAIC_ECO5E      GLAKIGAIMVPINARLLREESAWILQNS--QACLLVTSAQFYPMYQQIQQATQLRHICLTDVALPADDGV
CAIC_ECO57      GLAKIGAIMVPINARLLREESAWILQNS--QACLLVTSAQFYPMYQQIQQATQLRHICLTDVALPADDGV
CAIC_ECOLC      GLAKIGAIMVPINARLLCEESAWILQNS--QACLLVTSAQFYPMYQQIQQATQLRHICLTDVALPADDGV
CAIC_ECOL6      GLAKIGAIMVPINARLLREESTWILQNS--QACLLVTSAQFYPMYQQIQQASQLRHICLTDMVLPADDGV
CAIC_ECOL5      GLAKIGAIMVPINARLLREESTWILQNS--QACLLVTSAQFYPMYQQIQQASQLRHICLTDMVLPADDGV
CAIC_ECO55      GLAKIGAIMVPINARLLREESAWILQNS--QACLLVTSAQFYPMYQQIQQATQLRHICLTDVALPADDGV
4CL1_SOLTU      GASYLGAISTMANPLFTPAEVVKQAKASSAKIVITFAG---------------KVKDYAIENDLKVIC--
CAIC_ECO8A      GLAKIGAIMVPINARLLREESAWILQNS--QACLLVTSAQFYPMYQQIQQATQLRHICLTDVALPADDGV
CAIC_ECOHS      GLAKIGAIMVPINARLLREESAWILQNS--QACLLVTSAQFYPMYQQIQQATQLRHICLTDVALPADDGV
CAIC_ESCF3      GLVKIGAIMVPINARLLREESAWILQNS--QACLLVTSAQFYPMYQQIQQATQLRHICLTDVELPADDGV
CAIC_ECO24      GLAKIGAIMVPINARLLREESAWILQNS--QACLLVTSAQFYPMYQQIQQATQLRHICLTDVALPADDGV
CAIC_ECOSE      GLAKIGAIMVPINARLLREESAWILQNS--QACLLVTSAQFYPMYQQIQQATQLRHICLTDVALPADDGV
CAIC_ECOLU      GLAKIGAIMVPINARLLREESAWILQNS--QACLLVTSAQFYPMYQQIQQASQLRHICLIDMALPADDGV
CAIC_SHISS      GLAKIGAIMVPINARLLREESAWILQNS--QACLLVTSAQFYPMYQQIQQATQLRHICLTDVALPADDGV
CAIC_ECOLI      GLAKIGAIMVPINARLLCEESAWILQNS--QACLLVTSAQFYPMYQQIQQATQLRHICLTDVALPADDGV
CAIC_ECODH      GLAKIGAIMVPINARLLCEESAWILQNS--QACLLVTSAQFYPMYQQIQQATQLRHICLTDVALPADDGV
CAIC_ECOBW      GLAKIGAIMVPINARLLCEESAWILQNS--QACLLVTSAQFYPMYQQIQQATQLRHICLTDVALPADDGV
CAIC_SALPK      GLAKIGAIMVPINARLLGEESAWILQNSQVSLLV--TSAQFYPMYREIRQGNSTPLNCLIGEQLPADDGV
CAIC_SALPA      GLAKIGAIMVPINARLLGEESAWILQNSQVSLLV--TSAQFYPMYREIRQGNSTPLNCLIGEQLPADDGV
ACSF2_MACFA     ATAQAGIILVSVNPAYQATELEYVLKKVGCKALV-------FPKQFKTQQYYNILKQICPEVENAQPGAL
CAIC_SALNS      GLAKIGAIMVPINARLLGEESAWILQNSQVSLLV--TSAQFYPMYREIRQDNSTPLNCLIGEQLPADDGV
CAIC_PROMH      GLAKIGAVMVPINARFMYEESAWIINH--CQAHFVVTSDNFSPI-------YQPMLH-DKHSPLTQLFLI
ACSF2_PONAB     ATAQAGIILVSVNPAYQAMELEYVLKKVGCKALV-------FPKQFKTQQYYNILKQICPEVDNAQPGGL
4CL1_TOBAC      GASYLGAISTMANPLFTPAEVVKQAKASSAKIII----TQSCFVGKVKDYASENDVKV-ICID-------
CAIC_SALSV      GLAKIGAIMVPINARLLGEESAWILQNSQVSLLV--TSAQFYPMYREIRQDNSTPLNCLIGEQLPADDGV
CAIC_SALDC      GLAKIGAIMVPINARLLGEESAWILQNSQVSLL--VTSAQFYPMYREIRQDNSTPLNCLIGEQLPADDGV
CAIC_SHIDS      GLAKIGAIMVPINARLLREESAWILQNS--QACLLVTSAQFYPMYQQIQQATQLRHICLTDVALPADDGV
CAIC_SALTI      GLAKIGAIMVPINARLLGEESAWILQNSQVSLLV--TSAQFYPMYREIRQDNSTPLNCLIGEQLPADDGV
CAIC_SALPC      GLAKIGAIMVPINARLLGEESAWILQNSQVSLLV--TSVQFYPMYREIHQDNSTPLNCLIGEQLPADDGV
CAIC_SALPB      GLAKIGAIMVPINARLLGEESAWILQNSQVSLLVT---------SAQFYPMYREIRQDNSTLNHICLIGE
CAIC_SALEP      GLAKIGAIMVPINARLLGEESAWILQNSQVSLLV--TSVQFYPMYREIRQDNSTPLNCLIGEQLPADDGV
CAIC_SALCH      GLAKIGAIMVPINARLLGEESAWILQNSQVSLLV--TSVQFYPMYREIRQDNSTPLNCLIGEQLPADDGV
CAIC_SALTY      GLAKIGAIMVPINARLLGEESAWILQNSQVSLLV--TSAQFYPMYREIRQDNSTPLNCLIGEQLPADDGV
CAIC_SALHS      GLAKIGAIMVPINARLLGEESAWILQNSQVSLLV--TSAQFYPMYREIRQDNSTPLNCLIGEQLPADDGV
CAIC_SALA4      GLAKIGAIMVPINARLLGEESAWILQNSQVSLLVT---------SAQFYPMYREIRQDNSTLNHICLIGE
ACSF2_HUMAN     ATAQAGIILVSVNPAYQAMELEYVLKKVGCKALV-------FPKQFKTQQYYNVLKQICPEVENAQPGAL
YDAB_BACSU      AALEIGAVVVPVSWQLKPYEMTGILKASEPKAMF---------YGAEFKEILDEVLPSSLCVTMETGTAY
CAIC_PROSL      GLAKIGAVMVPINARFMYEESAWIINH--CQAHFVVTSDNFSPI-------YQPMLH-DKHSPLTQLFLI
MENE_BACLD      ACFLLGVRIVLLNTKLSMAERSYQIEHSEAKLLLTEKPFIEEHRGGQPARA----------VDIEDVQNA
ACSF2_BOVIN     ATAQAGIILVSVNPAYQAMELEYALKKVGCKALV-------FPKQFKTQQYYNILKQICPEVEKAQPGAL
4CLL6_ARATH     SLISLGAIVTTMNPSSSLGEIKKQVSECSVG--LAFTSTENV---EKLXXXXXXXXXXXXXYDFDSIRIE
4CL2_TOBAC      GASYLGAISTMANPLFTPAEVVKQAKASSAKIIV----TQACHVNKVKDYAFENDVKI-ICID-------
MENE_BACP2      ACFSLGFKIVLLNNKLTKAERRFQLEDVKAAALFT-----------EPVYASDHKGELPVY---------
MENE_GEOSW      ALHYIGAIVLLQNTRLTSHELAWQLKDSGAVYVIA-----DDELADRIEGNIRVITMSEL----------
4CLL5_ARATH     SVMSLGAIITTTNPLNTSNEIAKQIKDSNP--VLAFTTSQLLPKISAAAKKLPIVLMDEERVD-------
4CL_VANPL       GASFIGSISTMANPFFTSTEVIKQAKASNAKLIIT----------QGCYVDKVKDYACENGVKIISIXXX
FADK_ECOLI      ACLKIGAVSVPLLPSWREAELVWVLNKCQAKMFFAPTLFKQTRPVDXXXXXXXXXXXXXXXVGVDKLAPA
4CL2_PETCR      GASYRGAISTMANPFFTSAEVIKQLKASLAKLIIT------------------QACYVDKVKDYAAEKNI
4CL1_PETCR      GASYRGAISTMANPFFTSAEVIKQLKASQAKLIIT------------------QACYVDKVKDYAAEKNI
4CLL1_ORYSJ     AVTALGAVGTTVNPDYTPREIAKQVSDARAKLVITISALVPKIAGLRLPVIXXXXXXXXXXXXXXXXXTV
ACSF2_DANRE     ATAKAGIILVAVNPAYQLQEVEFALRKVQCNAVVCPTKFKSQHYCDMLKQLCPEM-------ETASPGGI
MENE_GEOKA      ALFFLGARVLLQNVRLTSYELGWQLDDSGARLAIA-----------------DEELAGSLDGDGRVLTVG
CAIC_SHIF8      GLAKIGAIMVPINARLLREESEWILQNS--QACLLVTSAQFYPMYQQIQQATQLRHICLTDVALPADDGV
4CLL2_ARATH     SVMSLGAIITTANPINTSDEISKQIGDS--RPVLAFTTCKLVSKLAAASNFNLPVVLMDDYHVPSQSYGD
4CLL3_ARATH     SVMSLGAVVTTANTLNTSGEISKQIAQSNPTLVF--TTSQLAPKLAAAISVVLTDEEDEKRVELTSGVRV
4CL2_DICDI      GTLLMGGITSLVNPDYTIEELSHTLATVSPRYLAVTLAVYEKIKNDRVFPSVEKVILVDIAGQTLKEIGQ
4CLL8_ARATH     SVMSLGAVLTTANPLNTASEILRQIADSNPKLAFT---TPELAIASSGISIVLERVEDTLRVPRGLKVVG
4CLL7_ARATH     AVTAIGGVFTTANPLYTVNEVSKQIKDSNPKIIISVN------------QLFDKIKGFDLPVVLLGSKD-
4CL1_DICDI      GTLLMGGITSLVNPDYTIEELSHTLATVSPRYLAV-----TLAVYEKIKNDLKRVFPSVEKVILVDIAGQ
MENE_BACC7      ALSYVGAVAVLLNTRLSREELLWQMDDAEVICLVTD-------------QDFDAK-------DIPVYS--
4CLL4_ORYSJ     AAMSLGAVLTTANPLNTPAEIAKQVAD--ARPVLAFTTRELLPKLPRAHDLRVVLLES---ARLP--GDS
4CLL4_ARATH     SVMSLGAVFTTANTLNTSGEISKQIADSNPTLVFTTRQAPKLPVAISV-----VLTDDEVYQEL------
FAT2_SCHPO      AVSWQRAICGPLNSNYKQSEFEFYIDDLKSKLVIVPEGTPAVRAAKKLSVAVAELAWC------PKSRLV
3HBCL_THAAR     GTLRIGAVAVALNVRLAPRDVLYVIQDSACRLLY---------IDAEFLHLYQQIAG-ELEQPPQVVVRG
4CL2_ARATH      AASFIGAITTSANPFFTPAEISKQAKASAAKLIVT--------------QSRYVDKIKNLQNDGVLIVTT
MENE_BACSU      ACFLLGVKAVLLNTKLSTHERLFQLEDSGSGFLLT-----DSSFEKKEYEHIVQTIDVDELMKXXXXXXX
ALKK_PSEOL      AVSGAGMVCHTINPRLFIEQITYVINHAEDKVVLL--DDTFLPIIAEIHGSLPKVKAFVLMAHNNSNASA
MENE_BACC0      ALSYAGAVAVLLNTRLSREELLWQMDDAEVICLVTD-------------QDFEAK-------DIPVYS--
4CL3_DICDI      GTLLMGGITSLVNPDYTIEELSHTLATVSPRYLAV-----TLAVYEKIKNDLKRVFPSVEKVILVDIAGQ
4CL2_ORYSJ      XXXXLGAVTTAANPFCTPQEIHKQFKASGVKLIL----TQSVYVDKRQHEAFPRIDACXXXXXXXXXXXX
MENE_BACCZ      ALSYVGAVAVLLNTRLSREELLWQMDDAEVICLVTD-------------QDFEAK-------DIPVYS--
MENE_BACHK      ALSYVGAVAVLLNTRLSREELLWQMDDAEVICLVTD-------------QDFEAK-------DIPVYS--
MENE_BACAN      ALSYVGAVAVLLNTRLSREELLWQMDDAEVICLVTD-------------QDFEAK-------DIPVYS--
MENE_BACAH      ALSYVGAVAVLLNTRLSREELLWQMDDAEVICLVTD-------------QDFEAK-------DIPVYS--
MENE_BACAC      ALSYVGAVAVLLNTRLSREELLWQMDDAEVICLVTD-------------QDFEAK-------DIPVYS--
MENE_BACAA      ALSYVGAVAVLLNTRLSREELLWQMDDAEVICLVTD-------------QDFEAK-------DIPVYS--
MENE_BACCQ      ALSYVGAVAVLLNTRLSREELLWQMDDAEVICLVTD-------------QDFEAK-------DIPVYSFA
MENE_BACC1      ALSYVGAVAVLLNTRLSREELLWQMDDAEVICLVTD-------------QDFDAK-------DIPVYS--
ACSM2_MOUSE     GCMRTGLVFMPGTIQMRSSDILYRLQASKARAIVA---------GDEVAQEVDAVADCSF---LKIKLLV
4CL1_ARATH      AASFRGXXXXXXXXXXXXXEIAKQAKASNTKLIIT-----EARYVDKIKPLQNDDGVVIVCIDDNESVPI
MENE_BACWK      ALSYIGAVAVLLNTRLSREELLWQMDDAEVVCLVT-----------------DQEFETE---NVPVCSFA
4CLL9_ARATH     ----------------------------------------------------------------------
MENE_BACCR      ALSYVGAVAVLLNTRLSREELLWQMDDAEVVCLVTD-------------QDFDAK-------DVPVYSLA
MENE_LISMO      ALQQLGAVTLFLNNRLTKKEIAYQLANAEVKQVIV-ADTFEDKVG--AGISYSELAE-------------
4CL3_ARATH      GASMIGAVSTTANPFYTSQELYKQLKSSGAKLIITHS------------QYVDKLKNLGENLTLITTDEP
ACSM3_MOUSE     ACLRTGTVLIPGTTQLTQKDILYRLQSSKAKCII--TDDTLAPAVDAV------AAKCE---NLHSKLIV
BCLA_THAAR      GAIKGGVVPIAINTLLTESDYEYMLTDSAARV--AVVSQELLPLFAPM------LGKVPTLEHLVVAGGA
MENE_OCEIH      ACSYLGAVAVLLNTKLTINELNQQLLDSDAKVIIT----------SESFKASEFVLQRMDYNELESVTED
MENE_BACCN      ALSYIGAIAVLLNTRLSREELLWQMEDAEVICLLTD-------------QIF-EPEQVPVYTFEEVENGP
MENE_LISMF      ALQQLGAVTLFLNNRLTKKEISFQLANAEVK----------------------HVIVADSLVD-KVATGI
ACSM3_RAT       ACLRTGTVLIPGTTQLTQKDILYRLQSSKSKCIITDTLAPAVDI---------VAAKCE---NLHSKLIV
LUCI_LUCMI      AGLYIGVAVAPTNEIYTLRELNHSLGIAQPTIVFSSRGLPKVLEVQKTVTCIKKIVILDSKVNFGGHDCM
ACSM2_RAT       GCMRSGLVFMPGTTQMKSTDILYRLQSSKARAIVA---------GDEVVQEVDAVAPDCSFLKIKLLVSE
4CLL6_ORYSJ     ALMSIGVVVSPANPASTADEYAHQVRLSRPAIAFV---APEV------------AARLPRHV--------
ACSM5_MOUSE     ACMRTGVVMIPGVSQLTAKDLKYRLQAARAKSIVTSDAL--------APQVDAISADCP---SLQTKLLV
4CLL9_ORYSJ     GIMSAGAVFSGVNPRALAAEIKKQVEDSEAKLVVANAGVPVIGVGDR-----ERMPGAISWDGLLAAADR
FAT2_YEAST      GATMDAKIGAPLNPNYKEKEFNFYLNDLKSKAICVPKGTTKLQIVELAFDATRFRVEYDIYSPEDNYKRV
ACSF3_MOUSE     ASWMSGGVAVPLYWKHPEAQLEYFIQDS--RSSLVVVGQEYL---ERLSPLAQRLGVPLLPLTPAVYHGA
LUCI_PHOPY      GALFIGVAVAPANDIYNERELLNSMNISQPTVVF---------VSKKGLQKILNVXXXXXXXXXXXXMDS
4CL1_ORYSJ      AASRVGAAVTTANPMSTPHEIESQLAAAGATVV---------------------ITESMAADKLPSHSGA
ACSM4_RAT       ACMRTGLVFMPGTIQLTRKDILYRLQASKAKCIVA---------SEEVAPAVDSIAECP---NLKTKLLV
4CL2_SOYBN      AISMIGAVATTANPFYTAPEIFKQFTVSKAKLIITYVDKLRNHDGAKLGEDFKVVT-----VDDPPENCL
ACSF3_BOVIN     AAWMSGGVAVPLYRKHPRAQLEYFIQDSRSSVVLA---GPE-------------------HVELPVAQKL
4CL4_ORYSJ      ----------------------------------------------------------------------
4CL5_ORYSJ      ASSRLGAVTTTANPLHTPPEIAKQVAASGATVVVAFVAKVSGLXXXXXXXXXXXXERCASFAGLAAADG-
MENE_LISIN      ALQQLGAITLFLNNRLTKKEITFQLANAEVKQVIVADAFVDKVTSGISYEELQQ----------------
ACSM5_RAT       ACMRTGVVMIPGISQLTQKDLKYRLQAARVKSIITSDAL--------APHVDAISADCP---SLQSRLLV
4CL4_ARATH      AVAYLGAVSTTANPFYTQPEIAKQAKASAAKMIIT-----KKCLVDKLTNLKND-GVLIVCLXXXXXXXX
LUCI_LUCCR      ----------------------------------------------------------------------
LUCI_LUCLA      AGLFIGVGVAPTNEIYTLRELVHSLGISKPTIVFSSKGLDKVITVQKTVTAIKTIVILDSKVDY------
ACSM3_HUMAN     ACLRTGTVLIPGTTQLTQKDILYRLQSSKANCII--TNDVLAPAVDAV------ASKCE---NLHSKLIV
ACSM5_HUMAN     ACMRTGTVMIPGVTQLTEKDLKYRLQASRAKSIITSDSL--------APRVDAISAECP---SLQTKLLV
4HBCL_RHOPA     GAIRAGIVPVLLNTRLTADQYRYLLEDSRSRVVFA--SSEFLPVIEEAAADLPHLRTIIAVGDAPAPTLQ
4CL_PINTA       GASVRGAIVTTANPFYKPGEIAKQAKAAGARIIVTLAAYVE------------KLADLQSHDVLVITIDD
MENE_STAAW      ----ANIEIAMINTRLTPNEMKNQMRSIDVQLIFC-----TLPLELRGFQSLDDIEFAGTDITMNGLLDN
MENE_STAAS      ----ANIEIAMINTRLTPNEMKNQMRSIDVQLIFC-----TLPLELRGFQSLDDIEFAGTDITMNGLLDN
LUCI_PHOPE      ASLYLGIIAAPVSDKYIERELIHSLGIVKPRIIFCSKNTFQKVLNVKSKLKYVEIIILDLNEDLGGYQCL
4CL3_ORYSJ      XXXXXXXXXXXXNPFYTPHEVHRQAEAAGARVIVT------------------EACAVEKVREFAAERGV
ACSM3_PONAB     ACLRTGTVLIPGTTQLTQKDILYRLQSSKANCI--------ITNXXXXXXXXXXXXKCE---NLHSKLIV
ACS2B_HUMAN     GCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVA---------GDEVIQEVDTVAECP---SLRIKLLV
MENE_STAAB      ----ANIEIAMINTRLTPNEMKNQMRSIDVQLIFC-----TLPLELRGFQILDDIEFAGRDITMNGLLDN
MENE_BACA2      ACFLLGAEAVLLNTKLSKQERLFQLEDSQAKLLLMEDGFCREEYESAVATADVDELQAEEAGDIEPEAYV
MENE_STAAN      ----ANIEIAMINTRLTPNEMTNQMRSIDVQLIFC-----TLPLELRGFQSLDDIEFAGRDITTNGLLDN
MENE_STAAM      ----ANIEIAMINTRLTPNEMTNQMRSIDVQLIFC-----TLPLELRGFQSLDDIEFAGRDITTNGLLDN
MENE_STAA9      ----ANIEIAMINTRLTPNEMTNQMRSIDVQLIFC-----TLPLELRGFQSLDDIEFAGRDITTNGLLDN
MENE_STAA2      ----ANIEIAMINTRLTPNEMTNQMRSIDVQLIFC-----TLPLELRGFQSLDDIEFAGRDITTNGLLDN
MENE_STAA1      ----ANIEIAMINTRLTPNEMTNQMRSIDVQLIFC-----TLPLELRGFQSLDDIEFAGRDITTNGLLDN
ACS2A_HUMAN     GCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVA---------GDEVIQEVDTVAECP---SLRIKLLV
DHBE_BACSU      ALFRLGALPVFALPSHRSSEITYFCEFAEAAAYIAYSGFDYRSLARQVQSKLPTLKNI-------IVAGE
ACSM4_MOUSE     ACMRTGLVFMPGTIQLTRKDILYRLQASKAKCIVASE--------EVAPAVDSIVSECP---SLKTKLLV
ACSM4_HUMAN     ACIRTGIIFMPGTIQLTAKDILYRLRASKAKCIVA---------SEEVAPAVESIVECP---DLKTKLLV
MENE_STAAR      ----ANIEIAMINTRLTPNEMTNQMRSIDVQLIFC-----TLPLELRGFQSLDDIEFAGTDITTNGLLDN
ACSM1_BOVIN     GCIRTGIIFMPGTTQMKAKDILYRLQVSGAKAIVTTTLAPEV----------ESVAECP---SLKTKLLV
ACSF3_HUMAN     ASWMSGGVAVPLYRKHPAAQLEYVICDSQSSVVLASQEYLELPVVRKLGVPL-----------LPLTPAI
ACSA_XANP2      ACARLGAIHSIVFGGFSPDSLAGRVADCGSKCIITLRGGRKVPLKANVDAAIAQINGGVDHVIVVRRTGG
MENE_STAAU      ----ANIEIAMINTRLTPNEMTNQMKSIDVQLIFC-----TLPLELRGFQSLDDIEFAGRDITTNSLLDN
MENE_STAAT      ----ANIEIAMINTRLTPNEMTNQMKSIDVQLIFC-----TLPLELRGFQSLDDIEFAGRDITTNSLLDN
MENE_STAAE      ----ANIEIAMINTRLTPNEMTNQMKSIDVQLIFC-----TLPLELRGFQSLDDIEFAGRDITTNSLLDN
MENE_STAAC      ----ANIEIAMINTRLTPNEMTNQMKSIDVQLIFC-----TLPLELRGFQSLDDIEFAGRDITTNSLLDN
MENE_STAA8      ----ANIEIAMINTRLTPNEMTNQMKSIDVQLIFC-----TLPLELRGFQSLDDIEFAGRDITTNSLLDN
MENE_STAA3      ----ANIEIAMINTRLTPNEMTNQMKSIDVQLIFC-----TLPLELRGFQSLDDIEFAGRDITTNSLLDN
MENE_ENTFA      ALWELGKELLFLNTHLTLAELTFQLKDAQVKTII---GAPET----------QALLEEISFVDVQPMIKK
ACSA_NOVAD      ACARIGAIHSIVFAGFSPDALAGRITDCDSRIVLTLRGGRKVPLKANVDEALKQCPGVDTVIML-RRTGA
4CLL3_ORYSJ     XXXXXXXXXXXMNPSSSPAEIAAQARATGACLVLASRGXXXXXXXXXXXXXXXEI------LXXXXXXXX
ACSM1_MOUSE     GCMRTGIIFMPGTTQLKAKDILYRIQISRAKAIVTTASVPEVE---------SVASECP---DLKTKLVV
ACSA_BACSU      GAIKIGAIAGPLFEAFMEGAVKDRLENSEAKVVVT---TPELL--ERI--PVDKLPHLQHVFVVGGEAES
ACSM1_HUMAN     GCMRTGIIFIPATILLKAKDILYRLQLSKAKGI--------VTIDALASEVDSIASQCP---SLKTKLLV
4CL1_SOYBN      ----------------------------------------------------------------------
ACSA_PSYIN      ACTRIGAVHSIVFGGFSPDAIAGRIVDSSAKIVITADGGRVVPLKANVDEALKDGTDCVKSVIVFKNTGG
ACSA_SHEFN      ACARIGAVHSVVFGGFSPDSIAARVIDGKSKVLITIRGGRKIPLKRSIDEAISNPVTCVEKVIVFKRTGG
ACSA_METPB      ACARLGAIHAIVFGGFSPDSLASRIKGCGSKLVITLRGGRKVPLKANVDEAIKRLADLVDHVIVVKRTGG
ACSA_DESAA      ACARIGAIHSIVFAGFSPDALANRITDAECTILITLRGPKAIGLKEAADEAMDKAGMVKKCI-VVKHTGA
ACSA_SYNFM      ACARIGVVHSIVFAGFSPESLAGRILDCGGKVVITLRGGKPIPLKENTEEALKKCPDVQKVI-VVKHTGG
ACSA_METRJ      ACARLGAIHAIVFGGFSPDSLASRIQGCGSKVVITLRGGRKVPLKANVDEAIKRLADLVDHVIVVRRTGG
ACSA_SHEAM      ACARIGAVHSVVFGGFSPDSIASRVIDGKSKLLITVRGGRKIPLKGNIDEALNDVTTVETVIVLKRTGGA
ACSA_METC4      ACARLGAIHAIVFGGFSPDSLASRIKGCGSKLVITLRGGRKVPLKANVDEAIKRLDKDLVHVIVVKRTGG
ACSA_METEP      ACARLGAIHAIVFGGFSPDSLASRIKGCGSKLVITLRGGRKVPLKANVDEAIKRLDKDLVHVIVVKRTGG
MENE_LACLA      ----------------------------------------------------------------------
ACSA_XANAC      ACARIGAVHSVVFGGFAANSIADRVIDCQSKLIITLRGGKKIPLKANVDAALKGTNTVETVLVVRHTGGA
ACSA_RHOP5      ACARIGAIHSVVFGGFSPDSLAQRITDCASKVVITLRGGRTVPLKANVDAALRKSSAVD-WVVVVKRTGA
ACSA_PARL1      ACARIGAVHSVVFGGFSPDSLAGRIVDCASSCVITVRGGRKIPLKANTDEALKKCPGVKSVIVVKHTGGA
ACSF3_XENLA     AVWMSGAIAVPLCKSHPPSELKYVLQDSQSALVVA------------------EESYTNVLSPLAEQLGI
ACSA2_PSEAE     ACARIGAVHSVVFGGFSPDSLRDRILDADCRTVITVRGGKYIPLKQNVEKALKDCPDVSTVVVVERTQGD
ACSA_SHESA      ACARIGAVHSVVFGGFSPDSIASRVIDGKSKVVITMRGGRAIPLKRNIDDALKDVTSVEKVIVLKRTGGK
ACSA_SHESM      ACARIGAVHSVVFGGFSPDSIASRVIDGKSKVVITMRGGRAIPLKRNIDDALKDVTSVEKVIVLKRTGGK
ACSA_BRAJA      ACARIGAIHSVVFAGFSPDSLAQRINDCQSKVIITLRGGKKVPLKANVDAALAKADGVD-WVVVVKRTGG
ACSA_SHESR      ACARIGAVHSVVFGGFSPDSIASRVIDGKSKVVITMRGGRAIPLKRNIDDALKDVTSVEKVIVLKRTGGK
ACSA_BRASO      ACARIGAIHSVVFAGFSPDSLAQRIKDCDSKVVITLRGGRKVPLKANVDAALXXXXXXXXXXXXXRTGGK
ACSA_XANOM      ACARIGAVHSVVFGGFAANSIADRVIDCQSKLIITLRGGKKIPLKANVDAALKGTNTIETVLVVRHTGGA
4CLL5_ORYSJ     ALMSIGAVVSPANPVSTPEEYAHQV---------------------------------------------
ACSA_SODGM      ACARIGAVHSVIFAGFSPEAIAGRIIDSSAKLVVTLRAGRKIPLKKNIDDALNEVKSVNRVIVFRRTGNA
ACSA_SHEON      ACARIGAVHSVVFGGFSPDSIASRVIDGKSKIVITMRGGRAIPLKRNIDDALKDVTSVEKVIVLKRTGGK
ACSA_HALHL      ACARIGAVHSIVFGGFSPEALRDRIQDADAEVVITVRGGRSIPLKANTDKALEGCPNVKTVFVVRRTGGD
ACSA_XANCP      ACARIGAVHSVVFGGFAANSIADRVIDCQSKLIITLRGGKKIPLKANVDAALKGTNTVETVLVVRHTGGA
ACSA_XANC8      ACARIGAVHSVVFGGFAANSIADRVIDCQSKLIITLRGGKKIPLKANVDAALKGTNTVETVLVVRHTGGA
4CLL1_ARATH     GIMSAGGVFSGANPTALVSEIKKQVEASGARGIITDAGLPVIVLGE------EKIEGAVNWKDLLEAGDK
LGRC_BREPA      GVMKAGAAYVPLDPAHPQERIAYMIEDSQASVLLTQASTDRLPASSRQ----------VICLDSDELAN-
4CLL7_ORYSJ     ALLSIGAVVSPANPALTPAEVSRLXXXXXXXXXXXXXXTAKLPAGLTTVVLLDSPHFRSLLMDCGQAQGQ
ACSA_XYLFA      ACARIGAIHSVVFGGFAPNSIADRINDCGSKLIITLRGGRKIPLKANVDAALKGTQSVETVLVVRHTGGT
ACSA_XYLFT      ACARIGAIHSVVFGGFAANSIADRVNDCGSKLIITLRGGRKIPLKANVDAALKGTQSVETVLVVRHTGST
ACSA_BEII9      ACARIGAIHSVIFGGFSPDSLAGRIEGCRSKVLITLRGGRKVPLKANADLAIAKTGDIVQTMIVVTRTGG
ACSA_VIBCH      ACTRIGAVHTIVFGGFSPEALAGRIIDSNAKLVITVRGGRAVPLKKNVDEALPEVKNISKVMVLKRTGG-
PPSB_BACSU      SILKAGGAYLPIDPEYPKERISFMLNDSGAKLL----------LTERGLNKPADYTGHILYID-----EC
ACSA_YERPS      ACARIGAVHSVIFGGFSPDAVAGRIIDSHSKLVITIRAGRAIPLKKNVDEALKNPAITSIKVVVFQRTGN
ACSA_YERP3      ACARIGAVHSVIFGGFSPDAVAGRIIDSHSKLVITIRAGRAIPLKKNVDEALKNPAITSIKVVVFQRTGN
ACSA_RHILO      ACTRIGAIHSIVFGGFSPDALAGRIVD--CESTFVITGGKSIPLKENTDKAIDIAAKNFVMVKVVRRTGG
ACSA_PSEA6      ACARIGAVHTVIFGGFSPNAIADRVNNCQAKVLITLRAGKHIPLKDNVDTALAEH-------DCPSMEQV
ACSA_ALCBS      ACARIGAIHSVVFGGFSPEALKDRILNAEACALITVRGGKTIPLKVNADKALDGIDCVHTCLTVKRTGGD
ACSA_YERPP      ACARIGAVHSVIFGGFSPDAVAGRIIDSHSKLVITIRAGRAIPLKKNVDEALKNPAITSIKVVVFQRTGN
ACSA_YERPN      ACARIGAVHSVIFGGFSPDAVAGRIIDSHSKLVITIRAGRAIPLKKNVDEALKNPAITSIKVVVFQRTGN
ACSA_YERPE      ACARIGAVHSVIFGGFSPDAVAGRIIDSHSKLVITIRAGRAIPLKKNVDEALKNPAITSIKVVVFQRTGN
ACSA_YERPA      ACARIGAVHSVIFGGFSPDAVAGRIIDSHSKLVITIRAGRAIPLKKNVDEALKNPAITSIKVVVFQRTGN
4CLL2_ORYSJ     ----------------------------------------------------------------------
ACSA_YERE8      ACARIGAVHSVIFGGFSPDAVAGRIIDSNSKLVITIRAGRAIPLKKNVDEALKNPAITSIKVVVFQRTGN
ACSA_AERS4      ACTRIGAVHSIVFGGFSPEALAGRIIDSGSSIVITLRGGRPVPLKKNVDEALTNPDTRVSKVIVLKRTGG
ACSA_NEUCR      ACTRIGAIHSVVFAGFSSDSLRDRVVDAQSKVVITLIGTKKIV--DEALQQCPDVRNVLVY----KRTGA
ACSA_AGRRK      ACARIGAVHSVVFGGFSPEALGGRIVD--CQSTFVITGGKPIPLKENTDTAIHIAAKQFVTVEVVRRTGG
ACSA_AGRT5      ACARIGAVHSVVFGGFSPEALAGRIVD--CESTFVITGGKPIPLKENTDKAIDIAAKQYVIVNVVRRTGG
ACSA_AERHH      ACTRIGAVHSIVFGGFSPEALAGRIIDSGSSIVITLRGGRPVPLKKNVDEALTNPETKVNNVIVLKRTGG
ACSA_METSO      ACAKLGVSHIVVFSGFSSKGLMDRAAHCGSRAIITVDGFKPVPLKPNADEAAGGAPSVEKII-VYKRAGV
ACSA_RHOCA      ACARIGAIHSIVFAGFSPDALANRINDCGAKLVITADTAPRTPLKANTDAALLHCSD-KVRCLVVKHTGD
ACSA_EMENI      ACSRIGAVHSVVFAGFSSDSLRDRVLDAGSKVVITVIGTKRIV--DEGLKQCPDVSTVLVY----KRTGA
ACSA_MAGSM      ACTRIGAVHSIVFGGFSPDALRDRIIDAECRVVITMRGSKKIPLRKNVETALAQVHTCFVVQDTQLEIEW
ACSA_RHOBA      ACARIGAIHSVIFAGFSAESIAERNNDASAKLVITSDGLYRLPLKATVDEALEKSPTVEKCLVL-RRTGD
ACSA_METSB      ACARIGAIHSIVFGGFSADSLGGRIEGCKSKLIITYRGGRKVPLKVNADAAIKKVDGIVETMIVVRRTGG
ACSA_LEPIN      ACTRIGAIHSVVFGGFSPEALQSRIDDCKPKLVVTFRGGKPIELKKNVDLALEKSKEKVKTVIVVRRTGN
ACSA_LEPIC      ACTRIGAIHSVVFGGFSPEALQSRIDDCKPKLVVTFRGGKPIELKKNVDLALEKSKEKVKTVIVVRRTGN
ACSA_ECOLI      ACARIGAVHSVIFGGFSPEAVAGRIIDSNSRLVITVRAGRSIPLKKNVDDALKNVTSVEHVVVLKRTGGK
ACSA_ECOL6      ACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITVRAGRSIPLKKNVDDALKNVTSVEHVVVLKRTGGK
MENE_STAEQ      ----------------------------------------------------------------------
ACSA_ENTS8      ACARIGAVHSVIFGGFSPEAVAGRIIDSSARLVITVRAGRAIPLKKNVDDALKNPGVTSVHVVVFKRTGG
ACSA_BARHE      ACARIGAIHSVIFAGFSPEAIAGRIVDCESTFIITLRGGKQINLKDSVDHAIEIAARQNVHVDQVMVIRR
ENTE_ECOLI      ALLKLG--VAPVLALFSHQRSELNA--------YASQIEPALLIADRQHALFSGDDFLNTFVTEHSSIRV
ACSA_VIBVY      ACTRIGAVHTIVFGGFSPEALAGRIIDSDAKVVIGVRGGRAVPLKKNVDEALPEVKTISKVV-VFKRTGG
ACSA_VIBVU      ACTRIGAVHTIVFGGFSPEALAGRIIDSDAKVVIGVRGGRAVPLKKNVDEALPEVKTISKVV-VFKRTGG
ACSA_CITK8      ACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITVRAGRGIPLKKNVDDALKNVNSVEHVVVLKRTGGK
ACSA_CHRVO      GGFSAGAV-------------RDRIQDAGATVVVSVRGGKNVPLKATVDEALAEGAESVRHVVVYQRTNG
ACSA_GEMAT      ACARIGAIHTVVFGGFAPESLRDRINDCGCKLLITADGGSRVPLKRNADVALKECPSIEVVMRRRSGVGD
ENTE_ECO57      ALLKLG--VAPVLALFSHQRSELNA--------YASQIEPALLIADRQHALFSG----DDFLNTFVAEHS
MENE_STAES      ----------------------------------------------------------------------
ACSA_PHOLL      ACARIGAIHSVIFAGFSPDAVSGRIIDSNTKLVITLRAGRTIPLKKXXXXXXXXXXXXXXXXXIVKRTGN
DHBF_BACSU      GVLKTGAAYLPLDPEFPADRISYMLEDAKPSCI--------ITTEEIAASLPDDLAVPELVLD-----QA
ACSA_LEPBJ      ACTRIGAIHSVVFGGFSPEALQSRIDDCKPKLIVTFRGGKPIELKRNVDIALEKSKEDVKTVIVVRRTGN
ACSA_BDEBA      ACARIGAVHSVVFAGFSPDSISDRILDGQCRFVITFRGSKVVALKENIDKALVKTPDVQKVL-VVKYAGT
ACSA_ALHEH      ACARIGAIHSIVFGGFSPDALKDRIQNADCETVITVRGGRNVALKSNADKALESCPDVKNVFVVKRTGGD
TYCB_BREPA      XXXXXXXXYVPIDPDYPNERIAYMLEDCRRLVL------TQQQLAEK----MTANVEC-LYLDEEGSYSP
ACSA_ECO57      ACARIGAVHSVIFGGFSPEAVAGRIIDSNSRLVITVRAGRSIPLKKNVDDALKNVTSVEHVVVLKRTGGK
ACSA_BART1      ACARIGAVHSVIFAGFSAEAIAGRIVDCESTFIITLRGGKRINLKDNVDHAIEIAARQNVRVDQVMVIRR
GRSB_BREBE      SILKAGGAYVPIDPAYPQERIQYLLEDSGATLLLT-----------------QSHVLNKLPVDIE-----
BACA_BACLI      GVLKAGGAYLPIDPEYPPERMRYMAFDSEVKVIIS-----DVPLAEELTAESIEL----IHMDDERIAGQ
ACSA_LARHH      ACARIGAIHSVVFGGFSAGALRDRIQDAAAKVVISVRGGKLVPLKATVDEALA-MDGCDSIEKVVVLQRT
ACSA_SHESW      ACARIGAVHSVVFGGFSPDSIASRVIDGKSKVVITMRGGRAIPLKRNIDDALNDVTSVEKVIVLKRTGGK
ACSA_SHEPC      ACARIGAVHSVVFGGFSPDSIASRVIDGKSKVVITMRGGRAIPLKRNIDDALNDVTSVEKVIVLKRTGGK
ACSA_PHOPR      ACTRIGAVHTIVFGGFSPEALAGRIVDSNAKLVITVRAGRAVPLKKNVDDALKNVTSIEKVIVLKRTGGN
VIBE_VIBCH      ALLRQG--IRPILALPAHREIRYFCQHSQAKA-YLIDGA-QRPFDYQALA--QELLACCPTLQTVIVRGQ
ACSA_SHEB8      ACARIGAVHSVVFGGFSPDSIASRVIDGKSKVIITMRGGRAIPLKRNIDDALKDVTTVEKVIVLKRTGGK
ACSA_SHEB5      ACARIGAVHSVVFGGFSPDSIASRVIDGKSKVIITMRGGRAIPLKRNIDDALKDVTTVEKVIVLKRTGGK
ACSA_BARBK      ACARIGAIHSVIFAGFSSEAIAGRLIDGQSTFIIALRGDKTIPLKDNVDRAIH-IAACQNVNVTQVMVIR
4CLL8_ORYSJ     ----------------------------------------------------------------------
ACVS_NOCLA      AVWKAGAAYMPIDPSYPDDRIAFMLSDTGAKLVLA---------GEAHGSRVR---------------GL
ACSA_VIBPA      ACTRIGAVHTVVFGGFSPEALSGRIIDSDAKVVITVRGGRAVPLKKNVDEALTEVKTISKVVVLKRTGG-
ACSA_SHEHH      ACARIGAIHSVVFGGFSPDSIASRVIDGNSKVVIADEGVRAIPLKANIDEALSHPVNCVEKVIVMKRTGG
GRSB_ANEMI      SILKAGGAYVPIDPAYPQERIQYLLEDSGAALLLT-----------------QSHVLNKLPVDIE-----
ACSA_METFK      ACARIGAIHSVVFGGFSAKSLHERIVDVGAKLVITIRGGKQVALKASVDEAL-ELGGCESVVIVYQRTGV
ACSA_MARMS      ACARIGAIHSVIFGGFSAHAIADRLNDCEVKLVITADE------GRRAGNTIPLKHNVDMALDNNACPTV
ACSA_LEPBL      ACTRIGAIHSVVFGGFSPEALQSRIDDCKPKLIVTFRGGKPIELKRNVDIALEKSKEDVKTVIVVRRTGN
AAS_SALTI       GAVSRRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRVYLDLKAD---
ACSA_SALTY      ACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITVRAGRSIPLKKNVDDALKNVTSVEHVIVLKRT-GS
ACSA_PRB01      ACTRIGAVHSVVFGGFSPESLKDRILDADCKIVITLRGGKKVPLKSNVDEALLGCPDVKNTLVIKRTGGE
AAS_SALSV       GAVSRRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRVYLDLKAD---
AAS_SALPB       GAVSRRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRVYLDLKAD---
AAS_SALHS       GAVSRRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRVYLDLKAD---
AAS_SALG2       GAVSRRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRVYLDLKAD---
AAS_SALEP       GAVSRRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRVYLDLKAD---
AAS_SALA4       GAVSRRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRVYLDLKAD---
ACSA_PASMU      ACARIGAVHSVVFGGFSASALRDRIEDAEAKLVITLRGGKIIPLKETVDEALEMGCKTIENVIVFHRVNI
AAS_SALPC       GAVSRRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRVYLDLKAD---
AAS_SALCH       GAVSRRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRVYLDLKAD---
ACSA_SHEDO      ACARIGAVHSVIFGGFSPDSIASRVIDGKSKVIITIRAGRTIPLKHNVDEALARPSTCVNNVIVLKRTGA
ACSA_SALTI      ACARIGAVHSVIFGGFSPEAIAGRIIDSSSRLVITVRAGRSIPLKKNVDDALKNVTSVEHVIVLKRT-GN
ACSA_SACD2      ACARIGAVHSIVFGGFSPEALKDRIVDSDCKVLIT---ADEGLRGGRAVNADKAVAHC------PQVHSV
ACSA_RHISN      ACARIGAIHSVVFGGFSPEALAGRIVD--CESTFVITGGKPVPLKENTEKAIDIAARQHVMVNKVLVVRR
AAS_SALTY       GAVSRRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRVYLDLKAD---
AAS_SALPK       GAVSRRRIPAMMNYTAGVKGLTSAIAAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
AAS_SALPA       GAVSRRRIPAMMNYTAGVKGLTSAIAAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
AAS_SALNS       GAVSRRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRVYLDLKAD---
AAS_ENT38       GAVSRGRIPAMMNYTAGVKGLTSAITAAEIKTVF--TSRQFLDKG-KLWHLPEQLKQVRWVFLEDLKAEV
LGRB_BREPA      GILKAGGAYVPLDPDYPEERLAYMMGDAGITVLLTQEQLPGLPSGER-----------------------
ACSA_RHIE6      ACARIGAVHSVVFGGFSPEALAGRIVD--CESTFVITGGKPVPLKDNTDTAIHIAARQHVHVSVVRRTGG
ACSA_SHEB9      ACARIGAVHSVVFGGFSPDSIASRVIDGKSKVIITMRGGRAIPLKRNIDDALKDVTTVEKVIVLKRTGGI
ACSA_PSEHT      GCARIGAIHSVIFGGFSPSAIADRIKDSGAKVVITSDEGRRVPLKANVDEALQESVTSIEHVIVHQLTGG
ACSA_BARQU      ACARIGAIHSVIFAGFSSEAIADRIVD--CKSTFIITGGKLIKLKNNIDHAIDIAARRGVHVNQVLVIRR
ACSA_AGRVS      ACSRIGAVHSVVFGGFSPEALAGRIVD--CESTFVITGGKPVALKENTDVAIDIAAKQYVIVNVVRRTGG
ACSA2_PSEPK     ACTRIGAIHSVVFGGFSPDALRDRILDADCRTVITVRGGKRIPLKQNVDKA---LASC------PAVSSV
ACSA_RHIEC      ACARIGAVHSVVFGGFSPEALAGRIVD--CESTFVITGGKPVPLKDNTDTAIHIAARQHVNVSVVRRTGG
ACSA_PYRAE      AAWRIGAITSVVFSGFSADALAERINDSQSRIVITADGFWRVRLKEVVDAALEKATGVESVIVLPRLGLK
LGRD_BREPA      GVMKAGAAYVPIDPAHPQERIAYMVXXXXXXXXXXXXXXXEI---------------------LPVTAAH
AAS_SALDC       GAVSRRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
AAS_ENTS8       GAVMRGRIPAMMNYTAGVQGLTSAITAAQIKTIF--TSRQFLDKG-KLWHLSEQITSVR-WVFLEDLKGE
ACSA_MARAV      ACARIGAIHSVVFGGFSPEALA--ARIVNGKSRFVITGGRAIPLKKNVDSALKH--EDDAKVDKVIVVSR
ACSA_LEPBP      ACTRIGAVHSVVFGGFSPEALLGRIEDCKPTLVITADGPIELKKNVDAALAETKFKVNDVIVVKRTGDEG
ACSA_LEPBA      ACTRIGAVHSVVFGGFSPEALLGRIEDCKPTLVITADGPIELKKNVDAALAETKFKVNDVIVVKRTGDEG
TYCC_BREPA      XXXXXXXXYVPVDPGYPQERIQYLLEDSNXXXXXXXXXXXXXXX-----QVSSELPEC-LDLNAELDAGL
SRFAA_BACSU     GILKAGGAYVPIDPGFPAERIQYILEDCGADFILTESAAPE--------------ADAEL-IDLDQAIEE
ACSA_SYNAS      ACTRIGVVHSIVFAGFSPESLRERIRDCQGRVVITLRGGKPLPLKENADEA---VGKCP-FVEKVIVVRR
AAS_KLEP3       GAIARGRIPAMMNYTAGVKGLSSAI--AAAEINTIFTSRTFLDKG-KLWHLPEQLTQVR-WVFLEDLKGD
ACSA_SHEPA      ACARIGAIHSVVFGGFSPDSIASRVIDGNSKVVIADEGVRAIPLKANIDEALSHPVNCVEKVIVMKRTGG
ACSA_RHILW      ACARIGAVHSVVFGGFSPEALAGRIVD--CESTFVITGGKPVPLKDNTDTAIHIAARQHVHVSVVRRTGG
AAS_SHISS       GAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
AAS_SHIFL       GAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
AAS_SHIF8       GAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
AAS_SHIB3       GAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
AAS_ECOSE       GAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
AAS_ECOLC       GAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
AAS_ECOHS       GAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
AAS_ECO5E       GAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
AAS_ECO57       GAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
AAS_ECO55       GAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
AAS_ECO24       GAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
ACSA_THEEB      ACARIGAPHSVVFGGFSAEALRDRLIDAQAKLVVTADGDAIVPLKDQVDKALQGVPSVENVLVVQRTQQP
AAS_ECOLU       GAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
AAS_ECOLI       GAIARRRMPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
AAS_ECODH       GAIARRRMPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
AAS_ECOBW       GAIARRRMPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
AAS_ECO7I       GAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
PPSD_BACSU      GVWKAGGCYVPIDPEYPKERKRYILSDSGTKLLMTIN---EADLGVLA------DFEGEI-LTIESVEED
BACC_BACLI      GILKAGGAYLPIDPDYPEERIKYMLEDSGAAIILA---DHKQDLGT----LHQEAVE-------------
ACSA_SHESH      ACARIGAVHSVVFGGFSPDSIASRVIDGKSKVIITVRGGRIIPLKANIDEALSHPVDCVEKVIVLERTGG
ACSA_SCHPO      AIVRLGAIHSVIFAGFSAESVADRVNDSECKVIISHRGGKRIPLKGVVNKALTECPTIKKVLVFQRSAEP
ACSA1_PSEAE     ACTRIGAIHSVVFGGFSPEALAGRIIDCKSKVVITVRGGKRTPLKANVDDALTNPETSSVQIIVCKRTGA
AAS_ECOSM       GAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
AAS_ECOL6       GAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
AAS_ECO27       GAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
ACVS_CEPAC      GIWKSGAAHVPIDPGYPDERVKFVLNDTKAQVVIASQRHVDRLRAE--------------------AVGG
AAS_KLEP7       GAIARGRIPAMMNYTAGVKGLSSAI--AAAELNTIFTSRTFLDKG-KLWHLPEQLTQVR-WVFLEDLKGD
AAS_ESCF3       GAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRIYLDLKADVTL
AAS_ECOUT       GAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
AAS_ECOK1       GAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
AAS_ECO45       GAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
ACSA_NITEU      ACARIGAIHSVVFGGFSAKSVYERIIDAGASAVITIRGGRYHPLKATVDEALAMGDTATVHVIVFRHTGT
ACS1_CANAL      AIVRIGAMHSVVFAGFSSASLRDRILDADSRIVITADGGKTIETKKIVDDALKECPKVRNVIVFKRTGNS
ACSA_PENCH      ACSRIGAVHSVVFAGFSSDSLRDRVLDASSKVIITXXXXXXXXXVDEAMKQCPDVHTVLVY----KRTGA
ACSA_AGRRH      ACARIGAIHSVVFGGFSPEALGGRIVD--CQSTFVITGGKPVPLKANVDKAIDIAARGHVMVKVIRRTGS
ACVS2_PENCH     GVWKSGAAYVPIDPTYPDERVRFVLDDTKARAIIASN---------------QHVERLQREV-----IGD
ACVS1_PENCH     GVWKSGAAYVPIDPTYPDERVRFVLDDTKARAIIASN---------------QHVERLQREV-----IGD
ACSA_SERP5      ACARIGAVHSVIFGGFSPEAVAGRIIDSNSKLVITADE------GLRAGRAVPLKKNVDDALKNPGVKSI
AAS_ECOL5       GAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQFLDKG-KLWHLPEQLTQVRWVYLEDLKADV
ACSA2_RHIME     ACARIGAIHSVVFGGFSPEALAGRIVD--CESTFVITCDE----GVRGGKPVALKENTDTAIDIAARQHV
ACSA_SINMW      ACTRIGAVHSVVFGGFSPEALAGRIVD--CESTFVITCDE----GVRGGKPVALKENTDTAVGIAAKQNV
ACSA_RUBXD      ACARIGAPHSVVFGAFSAQSLRDRINDCEAKVLVTADSGPRTPLKANADEALEDTPSIEKVV-VVRRTGD
ACS2L_MOUSE     ACARIGAIHTVVFAGFSAESLAGRINDAKCKAVITFNGLRGGRVVELKKIVDEAVKSCPTVQHVLVAHRT
ACSA_PSESM      ----------------------------------------------------------------------
ACSA_NITEC      GGFSA-------------KSVYERIIDAGASAVI--TADEQTRGGKRH--------ALKATVDEALAMGD
ACSA_CAUCR      ACARIGAVHSVVFGGFSPDSIAGRIQDCASHFVITARGGRRVPLKANIDEALKHCPWVGKVL-MIRWTGA
AAS_PECCP       ----------------------------------------------------------------------
FCSA_DICDI      AAMNHSLVPVALYATLGANAIEYVVNHSEISVLLCEGKNVEKILSMPGTTIKTIVS----YDPLPQATLD
ACSA_PSE14      ----------------------------------------------------------------------
ACSA1_PSEPK     ----------------------------------------------------------------------
AAS_ERWT9       GASMRGRVPAMLNYTAGVKGLTSALTAGEIKTVF--TSRQFLDKG-KLWHLPQGITQVK-WIYLEDLKDT
ACSA_PSEU2      ----------------------------------------------------------------------
AAS_ERWCT       ----------------------------------------------------------------------
AAS_CITK8       GAVSRGRIPAMMNYTAGVKGLTSAITAAEIKTVF--TSRQFLEKG-KLWHLPEQLTQVRIYLDLKAD---
ACSA_SHELP      ACARIGAIHSVVFGGFSPDSIASRVIDGKSKVVITVRGGRTIPLKANIDEALSHPVTCVEKVIVLERTGN
AAS_YERE8       GATLRGRIPALLNYTSGAKGLKSAITAASLKTII--TSRQFLEKGKLTHLPEQVTEANWVYLE------D
ACS2_CANAL      AIARLGAAHSVIFAGFSAGSIKDRVNDASCKALITCDGGRTTNIKKLCDEALVDCPTVEKVLVYKRTNNP
ACSL1_MOUSE     GCFSYSMVVVPLYDTLGADAITYIVNKAELSVIFADKPEKAKLLLEGVENKLTPCLKIIVIMDSYGSDLV
ACSA_DROME      ACARIGAVHSIVFAGFSPDSLAERMFDCKAKLLITADGAGEKPLYEKVEEMGHSVEKCIVVSHLPCQPDH
ACS2L_HUMAN     ACARIGAVHTVIFAGFSAESLAGRINDAKCKVVITFNQGLR---GGRVVELKKIVDEAVKHC--PTVQHV
PPSA_BACSU      AVLKAGGAYLPLDPAYPKERLSYMLKDSGASLLLTQPGC-----------------------SAPNFSGE
AAS_YERPY       GASLRGRIPALLNYTSGAKGLQSAIIAASLKTIVTLTHLPE-QVNEVNWVYLEDLKDTVTLTD-------
AAS_YERPS       GASLRGRIPALLNYTSGAKGLQSAIIAASLKTIVTLTHLPE-QVNEVNWVYLEDLKDTVTLTD-------
AAS_YERPP       GASLRGRIPALLNYTSGAKGLQSAIIAASLKTIVTLTHLPE-QVNEVNWVYLEDLKDTVTLTD-------
AAS_YERPG       GASLRGRIPALLNYTSGAKGLQSAIIAASLKTIVTLTHLPE-QVNEVNWVYLEDLKDTVTLTD-------
AAS_YERPB       GASLRGRIPALLNYTSGAKGLQSAIIAASLKTIVTLTHLPE-QVNEVNWVYLEDLKDTVTLTD-------
AAS_YERP3       GASLRGRIPALLNYTSGAKGLQSAIIAASLKTIVTLTHLPE-QVNEVNWVYLEDLKDTVTLTD-------
ACS2_DEBHA      AVARLGAIHSVIFAGFSSGSIKDRVNDASCKALITCDGGKTINIKKLCDEALLNCPSIEKVLVYERTGNK
ACSA_MYCTU      ACARLGIMHSVVFGGFTAAALQARIVDAQAKLLITADGQKPSPLKXXXXXXXXXIPDCSVHVLVVRRTGI
ACSA_MYCBO      ACARLGIMHSVVFGGFTAAALQARIVDAQAKLLITADGQKPSPLKXXXXXXXXXIPDCSVHVLVVRRTGI
PPSC_BACSU      AVLKAGGAYLPLDPAYPKERLSYMLKDSGASLLLTQPGCSAPNFSGETLEVDMTSLECE-----------
ACSL1_CAVPO     ACFAYSMVVVPLYDTLGADAITYIVNKAELSVIFADKPEKARILLESVENKLTPGLKIIVVMDSYGSELV
ACSA_PSYCK      ACTRIGAVHSVVFGGFSAESLGNRIIDSQSKLVITIRGNKRTPLKANVDRALDMDGTDSVSNVIVVHRTG
LGRA_BREPA      AVMKAGGAYVPIDPDYPGERIAYMLADSSAAILLTNALHEEKANGA-----------CDI-IDVPDSYSE
ACVS_EMENI      GIWKSGAAYVPIDPTYPDERVRFVLEDTQAKVIIASN-----HLAERLQS--EVISDREL----------
AAS_YERPE       GASLRGRIPALLNYTSGAKGLQSAIIAASLKTIVTLTHLPE-QVNEVNWVYLEDLKDTVTLTD-------
AAS_YERPA       GASLRGRIPALLNYTSGAKGLQSAIIAASLKTIVTLTHLPE-QVNEVNWVYLEDLKDTVTLTD-------
ACSA_SYNY3      ACSRIGAPHSVVFGGFSAEALRDRLVDAEAKLVITADGDKAIALKQEVDKALEHGAPSVENVIVVQRTKA
ACSA_COPCI      ACARIGAIHSVVFAGFSAEALRDRMQDCKSRVLITSDGRRGGXXXXXXXXXXXXLKECPA-VEKVLVLKR
ACS1_DEBHA      AIVRIGAVHSVVFAGFSSSSLKDRILDASSKIVIT---TDESKRGGKTIETKKIVDDCPDVTNVLLFKRT
S27A2_RAT       GLLKLGCPMACLNYNIRAKSLLHCFQCCGAKVLLA---SPEL------HEAVEEVLPTLKKEGVSVFYVS
ACSL6_RAT       ----------------------------------------------------------------------
ACSL6_HUMAN     ----------------------------------------------------------------------
ACSL1_RAT       GCFTYSMVVVPLYDTLGTDAITYIVNKAELSVIFADKPEKAKLLLEKLTPCLKIIVIMDSYVERGQKCGV
ACSA_STRCO      ACARIGAAHSVVFGGFSSDALATRIQDADARVVITADGGYRRGKPSALKPAVDEAVERAGIVEVVRRTGQ
ACVS_STRCL      GIWKAGAAYVPIDPAYPAERVRFAVGDTGLRGIVTHAGRLREILG--AEHADVTVVEIESVLDEQAAADT
ACSL1_HUMAN     GCFAYSMVIVPLYDTLGNEAITYIVNK--AELSLVFVDKPEKAVENKLIPGLKIIVVMDAYVERGQRCGV
TYCA_BREPA      AVLKAGGAYVPIDIEYPRDRIQYILQDSQTKIVLTQKSVSQLV--HDVGYSGEVVVLDEEQLDARETANL
ACSA_DEIRA      ACARIGAVHSIVFGGFSVSALADRINNAQSKLLITADGKP-VTLKINADEA-AKLAPCLEHVLVVKRAGI
MYCA_BACSU      AVLKAGGAYVPIDPEYPEDRIQYMLKDSEAKIVLAQLDLHKLTFDADVVLLDEESSYHEDRSNLEPTCGA
ACSA_RALEJ      ACARLGATHSVVFGGFSAKSLQERLVDVGAVALITMRGGKALPLKAIADDALA-LGGCEAVVIVYRRTGG
BACB_BACLI      AVLKAGGAYMPIDPGLPKERIQYLITDSGADLLLT------------QHQLIGSISFAGEIIQIDQADAY
ACSA_COPC7      ACARIGAIHSVVFAGFSAEALRDRMQDCKSRVLITSDGRRGGXXXXXXXXXXXXLKECPA-VEKVLVLKR
MYCC_BACSU      GILKAGGAYVPIDPTYPEERIRYILEDSDTKLL---------------------LVQHHLREKVPFTGKV
ACSL6_MOUSE     ----------------------------------------------------------------------
ACSA_PSYA2      ACTRIGAVHSVVFGGFSTQSLGNRIIDSQSKLVITIRGNKRTPLKANVDRALDMDGTDSVSNVIVVHRTG
ACSA_DICDI      ACARIGAIHSVIFAGFGYESIVSRVHDAKCRVIITLRGGRYIPLKEKIDQVVQH---CKLHVLVFKNTGR
S27A3_MOUSE     GLAKAGLRTAFVPTALRRGPLLHCLRSCGASALVLATEEPDLPMGLHLWATGPETNVAGISNLLSEAADQ
SRFAB_BACSU     GVMKAGAAFLPIDPDTPEERIRYSLEDSGAK--FAV-------VNERNMTAIGQYEGIIVSLD-------
GRSA_BREBE      AVLKAGGAYVPIDIEYPKERIQYILDDSQARMLLTQKHLVHLI------HNIQFNGQVEIFEE-------
ACSA_THIDA      ACARIGAIHSVVFGGFSAKSLFERIEDAQAKLIVSLRGGKAVPLKRAADEALADTSCVERVVVYRRSGGE
ACS2_CANGA      AVVRLGAIHSVVFAGFSAGSLKDRVVDAGSKVVITCDGGKTVHLKKIVDEGLNGVDQVSRILVFKRTG--
S27A2_MOUSE     GLLKLGCPMACLNYNIRAKSLLHCFQCCGAKVLLA---SPDLQEAEEALPTLKKDAVSVFYV-------S
ACSA_THET2      ACTRIGAVHSVVFGGFSAGALADRIKDAEAKVLITADGGFRVPLKQNADEALKDATSVE-HVVVVRRTGE
SRFAC_BACSU     GVLKAGAAYLPVDPKLPEDRISYMLADSAAACLLTH-------------QEMKEQAA-----ELPYTG--
PRPE_SALTY      GGFASHSVAARID---DARPALIVSADAGAR------GGKILPYKKLLDDAIAQAQHQPKHVLLVDRGLA
GRSA_ANEMI      AVLKAGGAYVPIDIEYPKERIQYILDDSQARMLLTQKHLVHLI------HNIQFNGQVEIFEE-------
ACSA_THET8      ACTRIGAVHSVVFGGFSAGALADRIKDAEAKVLITADGGFRVPLKQNADEALKDATSVE-HVVVVRRTGE
ACSA_RALEH      ACARLGATHSVVFGGFSAKSLQERLVDVGAVALITMRGGKALPLKAIADDALA-LGGCEAVVIVYRRTGG
ACS1_KLULA      AITRIGAIHSVVFAGFSSNSLRDRINDAYSKTVITTDGGKTIETKRIVDEALKDTPQVTNVLVFKRTHNE
BAIB_EUBSP      AIWKAGACYMPMSYKAAESEIREACDTIHPNAAFA---------------------ECK-----------
ACSA_PSEU5      ACARIGAIHSVVFGGFSPEALAGRIIDGSSKVVITIRGGKTIALKENVDEALTNPTRCVQKIIVVRRTGA
ACSA_RALSO      ACARIGATHSVVFGGFSAKSLQERIVDVGAVAVITMRGGKALPLKAIADEALMEGSEAVRHVIVYRRTGA
ACSA_PHYBL      ACARIGAIHSVVFAGFSAEILRDRVVDCATRVVLTSDGGKNIATKCIVDEALRDYENHSVHVLVFRRTGS
ACS1_CANGA      AISRIGAIHSVVFAGFSSNSLRDRINDAGSRVVITADGGKIIETKRIVDDALRETPQVEHVLVYRRTNNP
ACSA_RALME      ACARIGATHSVVFGGFSAKSLQERLVDVGAVALITMRGGKALPLKAIADEALT-LGGCEAVVIVYRRTGG
ACS2_ZYGBA      AIARLGAIHSVVFAGFSAGSLKDRVVDAGCKVVIT---CDEGKRGGKTVHTKKIVDEISLVSHILVFQRT
PRPE_ECOLI      GGFASHSVAARID---DAKPVLIVSADAGAR------GGKIIPYKKLLDDAISQAQHQPRHVLLVDRGLA
ACSA_BURS3      ACARIGATHSVVFGGFSAKSLNERLVDVGATALITADGGKTLPLKSIADEAIA-LGGCE------AVKSV
DLTA_BACC2      GCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLS--------------------AAAVTVTDLPVRIVS
ACS2_KLULA      XXXRLGAIHSVIFAGFSAGSLKERVVDAGCKVVIT---CDEGKRGGKTVHTKKIVDEGLAGVDILVFQRT
DLTA_BACCR      GCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSATAVTVTDLPVRI------VSEDNL----------
DLTA_BACC4      GCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSATAVTVTDLPVRI------VSEDNL----------
ACSA_OCHA4      ACARIGAVHSVVFAGFSPEALAGRIVD--CESTFVITGGKPVPLKENTDTAIDIAAKQYVMVNKVLTVRR
ACS1_ASHGO      AISRIGAIHSVVFAGFSSNSLRDRINDARSEVVVT---TDESKRGGKIIEAIKETPQLRKVLVYKRTCNP
LCFH_HAEIN      ATLQIRAITVPIYATNTAQQAEFILNHADVKILFVGDQ-------EQYDQTLEIAHHCPKLQKIVAMKST
ACS2_YEAST      AVARIGAIHSVVFAGFSAGSLKDRVVDANSKVVIT---CDEGKRGGKTINTKKIVDEGLNGVDLVSRIRT
ACS1_YEAST      AISRIGAIHSVVFAGFSSNSLRDRINDGDSKVVIT---TDESNRGGKVIEALRETPGVRHVLVYRKTNNP
ACSL5_HUMAN     ACYTYSMVAVPLYDTLGPEAIVHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPDLKQRG
ACSA_CUPTR      ACARLGATHSVVFGGFSAKSLQERLVDVGAVALITMRGGKALPLKAIADDALA-LGGCEAVVIVYRRTGG
ACBG1_HUMAN     GTVFAGGIVTGIYTTSSPEACQYIAYDCCANVIMVDT-QKQLEKILKIWKQLPHLKAVVIYKEPPPNKMA
S27A2_HUMAN     GLVKLGCAMACLNYNIRAKSLLHCFQCCGAKVLLV---SPELQ------AAVEEILPSLKKDDVSIYYVS
DLTA_BACWK      GCVKAGHAYIPVDLSIPADRVQRIAESSGAKLLLSGA----------------EVTVTDLPVRI------
DLTA_BACC1      GCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSGTEVTVTDLPVRI------VSEDNL----------
DLTA_BACHK      GCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLS--------------------AAAVTVTDLPVRIVS
DLTA_BACC3      GCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLS--------------------AAAVTVTDLPVRIVS
DLTA_BACC0      GCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLS--------------------AAAVTVTDLPVRIVS
DLTA_BACAH      GCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLS--------------------AAAVTVTDLPVRIVS
ACSA_PYRAR      AAWRIGAITNVVFSGFSADALAERINDSQSRIVITADGGKVVRLKEVVDSALEKAPGVENVIVLPRLGLK
ENTF_ECO57      AIVEAGAAWLPLDTGYPDDRLKMMLED--ARPSLLITTDDQLPR----------------FADVPDLTNL
DLTA_BACCZ      GCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLS--------------------AATVTVTDLPVRIVS
DLTA_BACCQ      GCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSGTEVTVTDLPVRI------VSEDNL----------
DLTA_BACAN      GCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSAAVT---------------------VTDLPVRIVS
DLTA_BACAC      GCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSAAVT---------------------VTDLPVRIVS
DLTA_BACAA      GCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSAAVT---------------------VTDLPVRIVS
ACSA_CRYPV      ACARIGAVHMVVFAGFAAQNLLERLVNARCKIVVTADGKKIINLKDKALEKIPEIKTCIVFRHLNGPIEF
ACS2_ASHGO      AVARLGAVHSVIFAGFSSGSLRDRIVDAESKVVIT---CDEGRRGGKTVHTKKIVDEVVSHILVFQRTGS
ACBG1_RAT       GTVFAGGIVTGIYTTSSPEACQYIAHDCRANVIVVDT-QKQLEKILKIWKDLPHLKAVVIYQEPPPKKMA
PPSE_BACSU      AVLKAGGAYLPLDAELPPERVSFMLEETQAKMLIVQKGLEQ------------------------NAAFS
DLTA_BACC7      GCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSGTEVTVTDLPVRI------VSEDNL----------
ACBG1_MACFA     GTVFAGGIVTGIYTTSSPEACQYIAYDCCANVIMVDT-QKQLEKILKVWKQLPHLKAVVIYKEPPPNKMA
ACSA_BURP8      ACARIGATHSVVFGGFSSKSLNERLVDVGAVALVTMRGGKALPLKNIADEALA-MGGCEAVVIVYQRTGG
ACBG1_MOUSE     GTVFAGGIVTGIYTTSSPEACQYISHDCRANVIVVDT-QKQLEKILKIWKDLPHLKAVVIYQEPPPKKMA
S27A5_RAT       GLAKLGCPVAWINPHSRGMPLLHSVQSSGASVLIV---DPDLQ------ENLEEVLPKLLAENIRCFYLG
ACSA_RALPJ      ACARIGATHSVVFGGFSAKSLQERIVDVGAVALITMRGGKALPLKAIADEALMEGTDAVKHVIVYRRTNG
ACSA_HERAR      ----------------------------------------------------------------------
AAS_PHOLL       GASLRGRIPALLNYTTDSHGLKNALAVASIKTIVT---SRQFLKKERLTHLSEQVTEVNVYLE------D
LCF2_SCHPO      ----------------------------------------------------------------------
ACSL5_MOUSE     ----------------------------------------------------------------------
ENTF_SHIFL      AIVEAGAAWLPLDTGYPDDRLKMMLED--ARPSLLITTDDQLPR----------------FSDVPNLTNL
ENTF_ECOLI      AIVEAGAAWLPLDTGYPDDRLKMMLED--ARPSLLITTDDQLPR----------------FSDVPNLTSL
DLTA_BACCN      GCVKAGHAYIPVDLSIPADRVLRIAESSGAKLL---------------------LSAAELTVDLPVR---
MENE_SALTY      ALMQCGARVLPVNPQLPQTLLEALV----PKLTLRFALTLE---GENAFSGLTA-----LQIQKSTAAYA
ACSA_HUMAN      ACARIGALHSIVFAGFSSESLCERILDSSCSLLITYRGEKLVNLKELADEALQKCQECIVVKHLGRAEGD
S27A5_MOUSE     GLAKLGCPVAWINPHSRGMPLLHSVRSSGASVLIV---DPDLQ------ENLEEVLPKLLAENIHCFYLG
ACSL5_RAT       ----------------------------------------------------------------------
MENE_ECOLI      ----------------------------------------------------------------------
S27A1_BOVIN     GLAKAGVEAALLNVNLRREPLAFCLGTSGAKAL-VFGGELAAAVAEMSGELGKSLVKCSGDVGPDGVFPD
ACSA_BRUSU      ACARIGAVHSVVFAGFSPEALAGRIVD--CESTFVITADE----GVRGGKPVALKENTDTAIDIAAKQYV
ACSA_BRUSI      ACARIGAVHSVVFAGFSPEALAGRIVD--CESTFVITADE----GVRGGKPVALKENTDTAIDIAAKQYV
ACSA_BRUO2      ACARIGAVHSVVFAGFSPEALAGRIVD--CESTFVITADE----GVRGGKPVALKENTDTAIDIAAKQYV
ACSA_BRUME      ACARIGAVHSVVFAGFSPEALAGRIVD--CESTFVITADE----GVRGGKPVALKENTDTAIDIAAKQYV
ACSA_BRUC2      ACARIGAVHSVVFAGFSPEALAGRIVD--CESTFVITADE----GVRGGKPVALKENTDTAIDIAAKQYV
ACSA_BRUAB      ACARIGAVHSVVFAGFSPEALAGRIVD--CESTFVITADE----GVRGGKPVALKENTDTAIDIAAKQYV
ACSA_BRUA2      ACARIGAVHSVVFAGFSPEALAGRIVD--CESTFVITADE----GVRGGKPVALKENTDTAIDIAAKQYV
ACSA_BRUA1      ACARIGAVHSVVFAGFSPEALAGRIVD--CESTFVITADE----GVRGGKPVALKENTDTAIDIAAKQYV
S27A6_HUMAN     GLAKLGCVVAFLNTNIRSNSLLNCIRACGPRALVV--GADLLGTVEEILPSLSENI---------SVWGM
ACSA_BURTA      ACARIGATHSVVFGGFSSKSLHERIVDVGATALVTMRGGKTLPLKSIADEAL-AMGGCDAVVVVYRRTGG
S27A4_MACFA     GMAKLGVEAALINTNLRRDALLHCLTTSRARALV---------FGSEMASAICEIASLDPSLSLFCSGSW
ACSA_BURPS      ACARIGATHSVVFGGFSSKSLHERIVDVGATALVTMRGGKTLPLKSIADEALA-MGGCDAVVVVYRRTGG
ACSA_BURP6      ACARIGATHSVVFGGFSSKSLHERIVDVGATALVTMRGGKTLPLKSIADEALA-MGGCDAVVVVYRRTGG
ACSA_BURP1      ACARIGATHSVVFGGFSSKSLHERIVDVGATALVTMRGGKTLPLKSIADEALA-MGGCDAVVVVYRRTGG
ACSA_BURP0      ACARIGATHSVVFGGFSSKSLHERIVDVGATALVTMRGGKTLPLKSIADEALA-MGGCDAVVVVYRRTGG
ACSA_BURMS      ACARIGATHSVVFGGFSSKSLHERIVDVGATALVTMRGGKTLPLKSIADEALA-MGGCDAVVVVYRRTGG
ACSA_BURMA      ACARIGATHSVVFGGFSSKSLHERIVDVGATALVTMRGGKTLPLKSIADEALA-MGGCDAVVVVYRRTGG
ACSA_BURM9      ACARIGATHSVVFGGFSSKSLHERIVDVGATALVTMRGGKTLPLKSIADEALA-MGGCDAVVVVYRRTGG
ACSA_BURM7      ACARIGATHSVVFGGFSSKSLHERIVDVGATALVTMRGGKTLPLKSIADEALA-MGGCDAVVVVYRRTGG
DLTA_BACLD      ACVKAGHPYIPVDVSIPADRILKIINSSKAELLLNNSGT-SVDTGD----ALISVVE-------------
S27A4_MOUSE     GMAKLGVEAALINTNLRRDALRHCLDTSKARALI---------FGSEMASAICEIASLEPTLSLFCSGSW
ACSA_BRUMB      ACARIGAVHSVVFAGFSPEALAGRIVD--CESTFVITADE----GVRGGKPVALKENTDTAIDIAAKQYV
S27A4_HUMAN     GMAKLGVEAALINTNLRRDALLHCLTTSRARALV---------FGSEMASAICEVASLDPSLSLFCSGSW
PKSJ_BACSU      AILKAGGAYVPLDPSYPAERLEYMLEDS---EVFITLTTSEL-VNTLSWN------------------GV
VRAA_STAAR      ----------------------------------------------------------------------
DLTA_STRPC      ----------------------------------------------------------------------
DLTA_STRP6      ----------------------------------------------------------------------
DLTA_STRP3      ----------------------------------------------------------------------
DLTA_STRP1      ----------------------------------------------------------------------
DLTA_STRPZ      ----------------------------------------------------------------------
DLTA_STRPM      ----------------------------------------------------------------------
DLTA_STRPG      ----------------------------------------------------------------------
DLTA_STRPF      ----------------------------------------------------------------------
DLTA_STRPD      ----------------------------------------------------------------------
DLTA_STRP8      ----------------------------------------------------------------------
ACSA_MOUSE      ACARLGALHSIVFAGFSAESLCERILDSSCCLLITYRGEKLVNLKELADESLEKCRECCIVVDSPSQSPP
MBTB_MYCSS      AIHAAGAVYVPIGADQPADRADSILQTAGVRMALACGDEPPTFLPA-------------LTIAEAVRVGS
ACBG1_BOVIN     GAVFXXXXXXXXXXXSSPEACQYIAYDCRANIIVVDT-QKQLEKILKIWKHLPHLKAVVIYREAPPMRMP
MYCB_BACSU      AILKAGGAFLPIDPELPDERRAYLMEDSGADVLVTCVEHTVPPSFEGS----------VVLLDDPLVYQG
ACBG2_CHICK     ----------------------------------------------------------------------
VRAA_STAAW      ----------------------------------------------------------------------
VRAA_STAAS      ----------------------------------------------------------------------
VRAA_STAAN      ----------------------------------------------------------------------
VRAA_STAAM      ----------------------------------------------------------------------
VRAA_STAAC      ----------------------------------------------------------------------
VRAA_STAA1      ----------------------------------------------------------------------
S27A3_HUMAN     GLAKAGLRTAFVPTALRRGPLLHCLRSCGARALFLESLEPDLPMGLHLWAAGPGTHPAGISDLLAEVSAE
FAD11_MYCTU     ----------------------------------------------------------------------
ACSA_HELPH      ACARIGAIHSIVFAGFSPEALRDRINDAQAKLVITADGTFRKGKPYMLKPALDKALENNACPSVEKALIV
VRAA_STAHJ      ----------------------------------------------------------------------
S27A4_PONAB     GMAKLGVEAALINTNLR-RDAQLHLTTSRARALV---------FGSEMASAICEIASLDPSLSLFCSGSW
DLTA_LISMF      GSIKSGRAYVPVDVSMPVERIE-QIKKAADPSLFICTE------------------------ELPSNLTI
ACSA_HELPG      ACTRIGAIHSIVFAGFSPEALRDRINDAQAKLVITADGTFRKGKPYMLKPALDKALENNACPSVEKALIV
ACSA_HELP2      ACARIGAIHSIVFAGFSPEALRDRINDAQAKLVITADGTFRKGKPYMLKPALDKALENNACPSVEKALIV
PKSN_BACSU      XXXXXXXXYVPLDPSFPQERLKYMLKDSQASIVLTQPNVHD------------------------RISGL
ACSA_HELPY      ACTRIGAIHSIVFAGFSPEALRDRINDAQAKLVITADGTFRKGKPYMLKPALDKALENNACPSVEKALIV
DLTA_LISMO      GSIKSGRAYVPVDVSMPVERIE-QIKKAADPSMFICTE------------------------ELPNNLTI
DLTA_LISMC      GSIKSGRAYVPVDVSMPVERIE-QIKKAADPSLFICTE------------------------ELPSNLTI
DLTA_STRE4      ----------------------------------------------------------------------
ACBG2_XENLA     ----------------------------------------------------------------------
SID2_USTMA      AILKAGHAYLPLDATLPLDRKKELVKDSGAALIVASSK----------------------FTDFDSLTGV
DLTA_LISMH      GSIKSGRAYVPVDVSMPVERIE-QIKKAADPSMFICTE------------------------ELPSNLTI
DLTA_LISIN      GTIKSGRAYVPVDVSMPVERIE-QIKKAADPALFICTE------------------------ELPSNLTI
ACSS3_PONAB     ACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEVPLVEEALKIGQHKPDKILIYNRPNMEAV
ACSS3_HUMAN     ACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEVPLVEEALKIGQHKPDKILIYNRPNMEAV
DLTA_BACA2      GSVKAGRPYIPVDVSIPAERIVKIIESSGAELLISVSGDAV----DTGSNLIKTVTPEELAADGDADL-S
BGML_DROME      ----------------------------------------------------------------------
ACSA_HELAH      ACTRIGAIHSIVFAGFSPEALRDRINDAQAKLVITADGT----FRKGKPYMLKPALDKALANNTCPSVEK
ACBG2_MOUSE     ----------------------------------------------------------------------
LCF1_SCHPO      ACLSQSMTIVTAYDTLGEEGLLHSLRESGVRGMYT-----EGHLLKTLVNPLKEIESLEVIIYRNDAKEE
S27A5_HUMAN     ----------------------------------------------------------------------
DLTA_STRMU      ----------------------------------------------------------------------
S27A1_HUMAN     GLAKAGMEAALLNVNLRREPLAFCLGTSGAKALI-FGGEMVAAVAEVSGHLGKSL------IKFCSGDLG
LCF1_YEAST      GAQSQGIPVVTAYDTLGEKGLIHSLVQTGSKAIF--TDNSLLPSLIKPVQAAQDVKYIKIYQSAHDAINR
ANGR_VIBAN      GILYAGAIYVPVSL-----------------------DQPQ----ERRESIYQGAGINVILINESDSKNS
ACSA_CHLTE      ACARVGAVHNVIFAGFAAHAITERVNDSRAKIVICADGTRR-----RGSTINLKNIVDEAIINTPSVKNV
ACSB_DICDI      ----------------------------------------------------------------------
MBTM_MYCSS      ----------------------------------------------------------------------
DLTA_LISW6      GAIKSGRAYVPVDFSMPVERIE-QIKKAADPALFICTE------------------------ELPENLTI
VRAA_STAEQ      ----------------------------------------------------------------------
BGM_DROME       ----------------------------------------------------------------------
ACSS3_MOUSE     ACARIGAIHSLIFGGFASKELSTRIDHAKPKVVVTASFGIEIPLLEEALRIGQHRPDRVLIYSRPNME--
DLTA_BACSU      GSVKAGHPYIPVDLSIPSERIAKIIESSGAELLIHAAGLSIDAVG----QQIQTVSAEEL-LENEGGSVS
DLTA_LACCB      ----------------------------------------------------------------------
DLTA_LACC3      ----------------------------------------------------------------------
ACBG2_RAT       ----------------------------------------------------------------------
FAD26_MYCTU     GALQAGFIAVPLS---TP---QYGIHDDRVSAVLQ---------------------------DSKPVAIL
ACSL3_PONAB     ----------------------------------------------------------------------
ACSL3_HUMAN     ----------------------------------------------------------------------
FCSB_DICDI      ----------------------------------------------------------------------
MBTB_MYCPA      ----------------------------------------------------------------------
DLTA_STRZP      --------------------------------------------------AILEVAEPSLIIAISALEQV
DLTA_STRR6      --------------------------------------------------AILEVAEPSLIIAISALEQV
DLTA_STRPN      --------------------------------------------------AILEVAEPSLIIAISALEQV
DLTA_STRP2      --------------------------------------------------AILEVAEPSLIIAISALEQV
DLTA_LACPL      ----------------------------------------------------------------------
DLTA_STRA3      ----------------------------------------------------------------------
ACSL3_RAT       ----------------------------------------------------------------------
DLTA_STRP7      --------------------------------------------------AILEVAEPSLIIAISALEQV
DLTA_STRA5      ----------------------------------------------------------------------
DLTA_STRA1      ----------------------------------------------------------------------
ACSL4_HUMAN     TCFKYNFPLVTLYATLGKEAVVHGLNESEASYLIT---SVEL-LESKLKTALLDISCVKIYVDNKAIEGF
ACSA_STRAW      ACARIGAAHSVVFGGFSXXXXXXXXXXXXXXLVITADGGYRRGKPSALKPAVDDAVSRGDGVEVVRRTGQ
Y3568_PSEAE     ACARLGAVHSVVFGGFAPYELALRIDDA----------TPKLVLTASCGLEFDRVIELELAIHQPAHVQA
ACSS3_BOVIN     ACARIGAIHSLIFGGFASKELSTRIDHAKPKLVITASFGIEVPLVEEALRIGQHKPDKVLIYNRPHTDMV
ACSA_WOLSU      ACARIGAIHSVVFGGFSAEALRDRIIDAEAKLVITADGAVDDALAEGACPSIEKVL-------IVIRNKE
VRAA_STAES      ----------------------------------------------------------------------
LCF4_YEAST      ----------------------------------------------------------------------
DLTA_STRZT      --------------------------------------------------AILEVAEPSLIIAISALEQV
DLTA_STRPJ      --------------------------------------------------AILEVAEPSLIIAISALEQV
S27A1_MOUSE     XXXXXXXXXXXXXXXXRREPLAFCLGTSAAKALI-YGGEMAAAVAEVSEQLGKSLLKCSGDLGPESILPD
ACSL4_RAT       TCFKYNFPLVTLYATLGKEAVVHGLNES--EASYLITSVXXXXXXXXXXXXDINCVKHIIYVDNKTIEGL
ACSA_CAMJ8      ACARIGAIHSVVFGGFSPEALRDRIIDAGAKLVVAFRRGKPYMLKPAVDKALSEGCESVEKVLIVIRNNE
ACSA_CAMJJ      ACARIGAIHSVVFGGFSPEALRDRIIDAGAKLVVAFRRGKPYMLKPAVDKALSEGCESVEKVLIVIRNNE
ACSA_CAMJE      ACARIGAIHSVVFGGFSPEALRDRIIDAGAKLVVAFRRGKPYMLKPAVDKALSEGCESVEKVLIVIRNNE
ACSL4_MOUSE     TCFKYNFPLVTLYATLGREAVVHGLNESEASYLITSVELLESKL--KAALVDINCVKHIIYVDNKTIEGL
DLTA_STAXY      GSMKAGCGYVPLDISMPEERINTIIEKINPDFIF---NTSEHSLDSNG----REIVNTETLLT-------
S27A1_RAT       XXXXXXXXXXXXXXXXRREPLAFCLGTSAAKALI-YGGEMAAAVAEVSEQLGKSLLKCSGDLGPESVLPD
ACSL3_MOUSE     ----------------------------------------------------------------------
SIB1_SCHPO      AILKAGCCFLALDVSAPTERIRYIVTDSTA-VLVMSTG--------------------ELYTKLLNASIN
DLTA_LACRH      ----------------------------------------------------------------------
MBTB_MYCTU      ----------------------------------------------------------------------
MBTB_MYCBO      ----------------------------------------------------------------------
FAT1_YEAST      SLWNIGAIPAFLNYNTKGTPLVHSLKISNITQVFIDPDASN-PIRE---------SEEEIKNALP---DV
HMWP2_YERE8     XXXXXXXXYVPVSLDQPAARREKIYADASVRLVLASAGSDDIPV-----LAWQQAIEAEPIVN-PVVRAP
DLTA_STAES      ----------------------------------------------------------------------
ACBG2_HUMAN     ----------------------------------------------------------------------
MENE_HAEIN      ----------------------------------------------------------------------
FAT1_COCHE      ----------------------------------------------------------------------
LCF2_YEAST      ----------------------------------------------------------------------
ACSM6_HUMAN     ACVRLGITFVPGSPQLTAKKIRYQLRMSKAQCIVA--NEAMAPVVNSA------VSDCP---TLKTKLLV
DLTA_STAAB      ----------------------------------------------------------------------
PABL_STRGR      AAASVGAVTMPVHQGNAPSDVR-ALLERVRPAAVVLTARTQEGGGPLTGPALREVPELRAVLVTGDAAGE
LCF3_YEAST      ----------------------------------------------------------------------
DLTA_STAAW      ----------------------------------------------------------------------
DLTA_STAAU      ----------------------------------------------------------------------
DLTA_STAAT      ----------------------------------------------------------------------
DLTA_STAAS      ----------------------------------------------------------------------
DLTA_STAAN      ----------------------------------------------------------------------
DLTA_STAAM      ----------------------------------------------------------------------
DLTA_STAAE      ----------------------------------------------------------------------
DLTA_STAAC      ----------------------------------------------------------------------
DLTA_STAA9      ----------------------------------------------------------------------
DLTA_STAA8      ----------------------------------------------------------------------
DLTA_STAA3      ----------------------------------------------------------------------
DLTA_STAA2      ----------------------------------------------------------------------
DLTA_STAA1      ----------------------------------------------------------------------
DLTA_LACLA      ----------------------------------------------------------------------
LYS2_CANGA      GVLKAGATFSVIDPAYPPARQTIYLGVAKPKGLIVIRAAGQLD------QLVEDTKELDLVSRIPSIAIQ
MBTM_MYCPA      ----------------------------------------------------------------------
LYS2_YEAST      GVLKAGATFSVIDPAYPPARQTIYLGVAKPRGLIVIRAAGQLD------QLVEDYINDELEIRINSIAIQ
DLTA_STAAR      ----------------------------------------------------------------------
DLTA_STAEQ      ----------------------------------------------------------------------
FAD28_MYCBO     GALQAGRIAVPLSVPVTDERSDSVLSDSSPVAILTTSSAVDQHVARRPGESPPSIIEVDL-LDLDAPNGY
DLTA_STAHJ      GAIKAGCGYVPIDTSVPSERVNMIINKVQPDIIFNTSDTQHSNIQELTIQSIQDSDNPTLF---DSQMGL
ACSF4_MOUSE     ----------------------------------------------------------------------
ESYN_FUSEQ      ----------------------------------------------------------------------
ORA_PLAFN       ----------------------------------------------------------------------
HTS1_COCCA      AILKAGGVCVPIDPRYPVERIRDIIRTTNATIALVGAG--------KTAALFKSADTAVQTIDI------
ACSA_NOSLI      ACARIGAVHSIVFGGFSPDSLSSRIQDSDCVLLITADGGRKVPLKVNADEALKTCPSIR-HVIVAKNTGG
ACSF4_DANRE     ----------------------------------------------------------------------
FAD21_MYCLE     GAMQAGFIAVPLSV---PQAGSH---DERVGAVLADT-SPSVVLTTSA------VADAAKYVD-----HS
MBTM_MYCTU      ----------------------------------------------------------------------
MBTM_MYCBO      ----------------------------------------------------------------------
LYS2_PENCH      GILKAGATFSVIDPAYPPERQNIYLDVARPRALVNIAKATK-DAGELSDIVRTFIDELELRTEIPXXXXX
LYS2_ASHGO      XXXXXXAVFSVIDPAYPPARQNVYLGVAKPAGLIVIQAAGQL---DEAVEAFIR-DNLSLKARLPALALQ
ESYN_GIBPU      ----------------------------------------------------------------------
LYS2_SCHPO      GVLKAGATFSVIDPAYPPARQIIYLSVAKPRALVVLEDAGVL--SPTVVEYVEKSLELKTYVPALKLAGS
FAD25_MYCTU     ASLQAGIVAVPLSIP------QGGAHDERTVSVFADTA-PAIVL--TASSVVDNVVE---YVQ--PQPGQ
FAD21_MYCTU     GSMQAGAIAVPLSV----PQIGSH--DERVSAVLA-DASPSVILTTSA--VAEAVAE---HIHRPN----
FAD21_MYCBO     GSMQAGAIAVPLSV----PQIGSH--DERVSAVLA-DASPSVILTTSA--VAEAVAE---HIHRPN----
ACSF4_HUMAN     ----------------------------------------------------------------------
LYS2_CANAL      GVLKAGATFSVIDPAYPPARQNIYLSVAKPKGLIGLAGTLDQLVVDNELDVVSTIPQLKVQDDGTLVGGK
PCL_HALHA       ----------------------------------------------------------------------
DIP2A_HUMAN     GCLLAELVPVPIEVPLT-------RKDAGSQQVGFLLG---------SCGVFLALTTDACQKGLPKAQTG
PCL_RHOS4       ----------------------------------------------------------------------
PATJ_DROME      -ALEPGTAVVPTRVLVDPAELERYLISTGYPEIFGESSTASTPQTTTEDDRFVYRGETSMLID-------
DIP2A_MOUSE     GCLLAELVPVPIEVPLTSQQVGFLLGSCGVTLALTTKGLPKAPTGEVA----------------------
YAC2_METSO      AIAKIGAIHCIVFSGFSSGGLNSRIMDAEAKVVITVDG--------------------------------
DIP2B_MOUSE     GCLLAEVIPVPIEVPLTRKQIGFLLGSCGALALICLKGLPKTQNGEKGWPRLKWVVTDSKYLSKP-----
DIP2C_HUMAN     GCLLAEVVPVPIEVPLTSQQIGFLLGSCGVTVALCHKGLPKSPTGE------------------------
DIP2B_HUMAN     GCLLAEVIPVPIEVPLTRKD--------------------------------------------------
DIP2B_DANRE     GCLLAEVIPVPIEVPLSSQQIGFLLGSCGVTSEVCLKGLPKTPNGEKGWPRLKWVVTDTKYLTKPS----


                         +         .         .         .         .         *         .:210
query           TTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAP
LCFB_BACSU      PEAADPEVRTFAKILRPTSAAKQNQEPVPDDTAVILYTSGTTGKPKGAMLTHQNLYSNANDVAGYLGM--
LCFA_BACSU      DFDKTANIHTFASCMKQEKTELLTIPKPEHDIAVLQYTGGTTGAPKGVMLTHQNILANTEMCAAWMYDVK
LCFA_ECO57      LVNFVPDAISFRSALNGYRMQYVKPELVPEDLAFLQYTGGTTGVAKGAMLTHRNMLANLEQVNATY--GP
LCFA_ECOLI      VVNFVPDAISFRSALNGYRMQYVKPELVPEDLAFLQYTGGTTGVAKGAMLTHRNMLANLEQVNATY--GP
LCFA_ECOL6      VVNFVPDAISFRSALNGYRMQYVKPELVPEDLAFLQYTGGTTGVAKGAMLTHRNMLANLEQVNATY--GP
LCFA_SALTY      VVNFVPDAISFRSALHGYRMQYVKPEVVAEDLAFLQYTGGTTGVAKGAMLTHRNMLANLEQVKATY--GP
LCFA_SALTI      VVNFVPDAISFRSALHGYRMQYVKPEVVAEDLAFLQYTGGTTGVAKGAMLTHRNMLANLEQVKATY--GP
LCFA_YERPE      LVNFVPDAISFRTVLKGRRMQYVKPDVINTDTAFLQYTGGTTGVAKGAILTHRNMQSNLEQAKAAY--AP
LCFA_HAEIN      XXXXXXHAVTFREVLSGKYRQYVRPEISREDLAFLQYTGGTTGVAKGAMLTHGNIITNVFQAKWIAEPFI
CAIC_SALAR      TLPAEEGVSHFYTLKAQQPDVLYTPPLTPDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSS--WQCAL
ACSF2_RAT       TVVAAGGKEQNLAQLRYHQGFLSCY-----DPINIQFTSGTTGNPKGATLSHHNIVNNSNLIGQRLKMPA
CAIC_CITK8      NAPVEDNVSHFSQLKDQQPATLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSS--WQCAL
CAIC_ECOSM      SS--------FTQLKNQQPATLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
CAIC_ECO27      SS--------FTQLKNQQPATLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
CAIC_ECOUT      SS--------FTQLKNQQPATLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
CAIC_ECOK1      SS--------FTQLKNQQPATLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
CAIC_ECO81      TDMALPGVSSFTQLKNQQPATLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
CAIC_ECO45      SS--------FTQLKNQQPATLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
4CL2_SOLTU      VDSAPEGCVHFSELIQSDEHEIPDVKIQPDDVVALPYSSGTTGLPKGVMLTHKGLV-TSVAQQVDGENAN
ACSF2_MOUSE     TLLAAGGKEQNLAQLR-----YNQRFLSCYDPINIQFTSGTTGNPKGATLSHHNIVNNSMLIGQRLKMPT
CAIC_SHIFL      SS--------FTQLKNQQPATLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
CAIC_ECO7I      SS--------FTQLKNQQPATLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
CAIC_ECO5E      SS--------FTQLKNQQPATLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
CAIC_ECO57      SS--------FTQLKNQQPATLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
CAIC_ECOLC      SS--------FTQLKNQQPATLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
CAIC_ECOL6      SS--------FTQLKNQQPATLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
CAIC_ECOL5      SS--------FTQLKNQQPATLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
CAIC_ECO55      SS--------FTQLKNQQPATLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
4CL1_SOLTU      VDSVPEGCVHFSELIQSDEHEIPDVKIQPDDVVALPYSSGTTGLPKGVMLTHKGLV-TSVAQQVDGENAN
CAIC_ECO8A      SS--------FTQLKNQQPATLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
CAIC_ECOHS      SS--------FTQLKNQQPATLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
CAIC_ESCF3      SS--------FTQLKNQQPVTLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
CAIC_ECO24      SS--------FTQLKNQQPATLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
CAIC_ECOSE      SS--------FTQLKNQQPATLYAPPLLTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
CAIC_ECOLU      SS--------FTQLKNQQPATLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
CAIC_SHISS      SS--------FTQLKNQQPATLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
CAIC_ECOLI      SS--------FTQLKNQQPATLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
CAIC_ECODH      SS--------FTQLKNQQPATLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
CAIC_ECOBW      SS--------FTQLKNQQPATLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
CAIC_SALPK      SLSQLQARQS--ATLCYTPA------LSTDDAAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIAL
CAIC_SALPA      SLSQLQARQS--ATLCYTPA------LSTDDAAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIAL
ACSF2_MACFA     KSQRLPDLTTVISVDAPLPGTLDEVLAAGSDPINIQFTSGTTGSPKGATLSHYNIVNNSSILGELHEKTP
CAIC_SALNS      SHSQLQARQS--ATLCYTPA------LSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIAL
CAIC_PROMH      TENCLPGVVDFLSEKAKHPVTLNHTPLSVDDTAEILFTSGTTSQPKGVVITHYNLRFAGYYSS--WQNAL
ACSF2_PONAB     KSQRLPDLTTVISVDAPLPGTLGSTRQHLDDPINIQFTSGTTGSPKGATLSHYNIVNNSNMLGELHEKTP
4CL1_TOBAC      --SAPEGCLHFSELTQSDEHEIPEVKIQPDDVVALPYSSGTTGLPKGVMLTHKGLV-TSVAQQVDGENAN
CAIC_SALSV      SHSQLQARQS--ATLCYTPA------LSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIAL
CAIC_SALDC      SFSQLQARQS--ATLCYTP------VLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIAL
CAIC_SHIDS      SS--------FTQLKNQQPATLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
CAIC_SALTI      SHSQLQARQS--ATLCYTPA------LSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIAL
CAIC_SALPC      SHSQLQARQS--ATLCYTPA------LSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIAL
CAIC_SALPB      QLPADDGVSHFTQRQSRQSTTLYTPALSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIAL
CAIC_SALEP      SHSQLQARQS--ATLCYTPA------LSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIAL
CAIC_SALCH      SHSQLQARQS--ATLCYTPA------LSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIAL
CAIC_SALTY      SHFTQLQARQS-ATLCYTPV------LSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIAL
CAIC_SALHS      SHFTQLQARQS-ATLCYTPV------LSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIAL
CAIC_SALA4      QLPADDGVSHFTQLQSRQSTTLYTPALSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIAL
ACSF2_HUMAN     KSQRLPDLTTVISVDAPLPGTLGSTRQHLDDPINIQFTSGTTGSPKGATLSHYNIVNNSNILGELHEKTP
YDAB_BACSU      ETSA-----EFEALFAGPDHLPETEMVSPDDTALLMFTSGTTGNPKRCMITHGGIYRYVKKSNSSIARMK
CAIC_PROSL      TENCLPGVVDFLSEKAKHPVTLNHTPLSVDDTAEILFTSGTTSQPKGVVITHYNLRIAGYYSS--WQNAL
MENE_BACLD      ACPPVT--------------EIESIHL--DDAATIMYTSGTTGRPKGVMQTFANHYFSAVSSA--LNLGL
ACSF2_BOVIN     KSQRLPDLTTVISVDAHLPGTLDEVVAAGSDPINIQFTSGTTGSPKGATLSHYNIVNNANMIGQLHQKTP
4CLL6_ARATH     NPK-------FYSIMKESFGFVPKPLIKQDDVAAIMYSSGTTGASKGVLLTHRNLIASMVRFEASQYEYP
4CL2_TOBAC      --SAPEGCLHFSVLTQANEHDIPEVEIQPDDVVALPYSSGTTGLPKGVMLTHKGLVTSV--AQQVDGENP
MENE_BACP2      TMETLPEA-----------GQENVKKIENDQTATIMYTSGTTGRPKGVEQTFGNHFHSAVSSALNMGLRE
MENE_GEOSW      --SALPEENV----------EFQQYY-HFDDIATIMYTSGTTGKPKGVLQTYENHWWSAIGSA--LNLGL
4CLL5_ARATH     ---SVGDVRRLVEMMKKEPGNRVKERVDQDDTATLLYSSGTTGMSKGVISSHRNLIAMVQTIVNRFG-SD
4CL_VANPL       XXXXXXXNILHFSELTGDENEMPKVEISPDGVVALPYSSGTTGLPKGVMLTHKGLVTSV--AQQVDGENP
FADK_ECOLI      TSSL-----SLSQIIADNTSLTTAITTHGDELAAVLFTSGTEGLPKGVMLTHNNILASERAYCARLNLT-
4CL2_PETCR      QIICIDDAPQFSKLMEADESEMPEVVIDSDDVVALPYSSGTTGLPKGVMLTHKGLV-TSVAQQVDGDNPN
4CL1_PETCR      QIICIDDAPQFSKLMEADESEMPEVVINSDDVVALPYSSGTTGLPKGVMLTHKGLV-TSVAQQVDGDNPN
4CLL1_ORYSJ     TTNLVAGVKE---------ADYRRPPIKQSDTAALLYSSGTTGDSKGVILTHRNFIAAARMVTSDQDERR
ACSF2_DANRE     KSSRLPDLHTVIVTDSQQPGSFKDLMQAGDDPINIQFTSGTTGKPKGATLSHHNIVNNAYFTGMRIGYNW
MENE_GEOKA      AVAALPEVDV-------------SLKETCDEVATIMYTSGTTGTPKGVLQTYGNHWWSAVGSA--LNLGL
CAIC_SHIF8      SS--------FTQLKNQQPATLYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQCAL
4CLL2_ARATH     RVKLVGRLETM---IETEPSESRKQRVNQDDTAALLYSSGTTGTSKGVMLSHRNLIALVQAYRARFGLEQ
4CLL3_ARATH     VLSEMMKKET--------SGQRVRDRVNQDDTAMMLYSSGTTGTSKGVISSHRNL---TAYVAKYIDDKW
4CL2_DICDI      LTLSSDGVMSFNQLINNNGKDYPIVRIDKKDTAIIPFSSGTTGLFKGVCLSHHNLVSNTHQTQTVETTNY
4CLL8_ARATH     NLTEMMKKEPSGQAVRNQ--------VHKDDTAMLLYSSGTTGRSKGVNSSHGNLIAHVARYIAEPFEQP
4CLL7_ARATH     TVEIPPGSNSKILSLSEPVSEYPFVEIKQSDTAALLYSSGTTGTSKGVELTHGNFIAASLMVTMDQDLMG
4CL1_DICDI      TLKEIDQLTSFNQLINNNGKDYPIVRIDPKDTAIIPFSSGTTGLFKGVCLSHHNIVSNTYQTQTIETSTY
MENE_BACC7      ----------FAEVMNG-PKEEASIQEEFEEAMTIIYTSGTTGKPKGVILTYGNHWASAVGSSLNLGLRD
4CLL4_ORYSJ     SDPRIVATIEEISATTPDPARRKD-RVTQDDPATLLYSSGTTGPSKGVVATHRSLISMVQIIMTRFREGS
4CLL4_ARATH     -TSAIRVVGILSEMVKKEPGQRVRDRVNQDDTAMMLYSSGTTGPSKGVISSHRNLTAHV---ARFISDNL
FAT2_SCHPO      RIVHFEGAKINAPQPLGLP--------QPDDVMLVLHTSGTTGRPKVVPLTHKNLIHNITTSYRL-----
3HBCL_THAAR     DEAPAPAIIAFKHFLDGQAATLESVQVAPDDVAYWLYSSGTTGRPKAVMHAHRSVLIADRLEREYFGIKP
4CL2_ARATH      DSDAIPNCLRFSELTQSEEPRVDSIKISPEDVVALPFSSGTTGLPKGVMLTHKGLVTSV--AQQVDGENP
MENE_BACSU      XXXYM----------------------QMDATATLMYTSGTTGKPKGVQQTFGNHYFSAVSSA--LNLGI
ALKK_PSEOL      Q---MPGLIAYEDLIGQGDDNYIWPDVDENEASSLCYTSGTTGNPKGVLYSHRSTVLHSMTTAMPDTLNL
MENE_BACC0      ----------FAEVMNG-PKEEASIQEEFSEAMTIIYTSGTTGKPKGVILTYGNHWASAVGSSLNLGLRD
4CL3_DICDI      TLKEIDQLTSFNQLTNNNGKDYPIVRIDTKDTAIIPFSSGTTGLFKGVCLSHYNLVSNTYQTQTIETSTY
4CL2_ORYSJ      XXEATPGCLPFWDLIDADEGSVPEVAISPDDPVALPFSSGTTGLPKGVVLTHRSVVSGV--AQQVDGENP
MENE_BACCZ      ----------FAEVMNG-PKEEASIQEEFSEAMTIIYTSGTTGKPKGVILTYGNHWASAVGSS--FNLGL
MENE_BACHK      ----------FAEVMNG-PKEEASIQEEFSEAMTIIYTSGTTGKPKGVILTYGNHWASAVGSSLNLGLRD
MENE_BACAN      ----------FAEVMNG-PKEEASIQEEFSEAMTIIYTSGTTGKPKGVILTYGNHWASAVGSSLNLGLRD
MENE_BACAH      ----------FAEVMNG-PKEEASIQEEFSEAMTIIYTSGTTGKPKGVILTYGNHWASAVGSSLNLGLRD
MENE_BACAC      ----------FAEVMNG-PKEEASIQEEFSEAMTIIYTSGTTGKPKGVILTYGNHWASAVGSSLNLGLRD
MENE_BACAA      ----------FAEVMNG-PKEEASIQEEFSEAMTIIYTSGTTGKPKGVILTYGNHWASAVGSSLNLGLRD
MENE_BACCQ      EVMNGPKEEAFIQE------EFSL-----EEAMTIIYTSGTTGKPKGVILTYGNHWASAVGSSLNLGLRD
MENE_BACC1      ----------FAEVMNG-PKEEASIQEEFEEAMTIIYTSGTTGKPKGVILTYGNHWASAVGSSLNLGLRD
ACSM2_MOUSE     SENSREGWLNFKALLKEASTIHQCVETESRESAAIYFTSGTSGPPKMAEHSHCSLGIKAKMDAASWTGLS
4CL1_ARATH      PEGCLRFTELTQSTTEASE-VIDSVEISPDDVVALPYSSGTTGLPKGVMLTHKGLVTSV--AQQVDGENP
MENE_BACWK      EVMQGPKAEAFIQE------EFSL-----EEAMTIIYTSGTTGKPKGVILTYGNHWASAVGSSLNLGLRD
4CLL9_ARATH     ------------------------VQVNQSDPAAILFSSGTTGRVKGVLLTHRNLIASTAVSHQRTLQDP
MENE_BACCR      EV------------MNG-PKEEASIQEEFEEAMTIIYTSGTTGKPKGVILTYGNHWASAVGSSLNLGLRD
MENE_LISMO      TDYKEPELLETW----------DLSRT-----ASIMYTSGTTGKPKGVIQTYENHWWSAVAS--VLNLGL
4CL3_ARATH      TPENCLPFSTLITDDETNPFQ-ETVDIGGDDAAALPFSSGTTGLPKGVVLTHKSLI-TSVAQQVDGDNPN
ACSM3_MOUSE     SQHSREGWGNLKEMMKYASDSHTCVDTKHDEMMAIYFTSGTTGPPKMIGHTHSSFGLGLSVNGRFWDVMW
BCLA_THAAR      ------GEDSLAALLATGSEQFEAAPTRPDDHCFWLYSSGSTGAPKGTVHIHSDLIHTAELYARPILGIR
MENE_OCEIH      TSIITLKSEIYF-----------------DDIFTMMYTSGTTGFPKAVQQTFGNHWWSATSSA--LNLGL
MENE_BACCN      KQSVVIQEEFSLA-----------------EAMTIIYTSGTTGKPKGVILTYGNHWASAVGSSLNLGLRD
MENE_LISMF      SYATL--AETDYEA----PALLET--WDLSRAASVMYTSGTTGKPKGVVQTYENHWWSAVAS--VLNLGL
ACSM3_RAT       SQHSREGWGNLKEMMKYASDSHTCVDTKHNELMAIYFTSGTTGPPKMIGHTHSSFGLGLSVNGRFWDVMW
LUCI_LUCMI      ETFIKKHVE-----LGFQPSSFVDVKNRKQHVALLMNSSGSTGLPKGVRITHEGAVTRSHAKDPIYGNQV
ACSM2_RAT       KNRE--GWLNFKALLKDASPIHQCVETVSQESAAIYFTSGTSGPPKMAEHSHCSLGLKAKMDAGWTGLGP
4CLL6_ORYSJ     -SRVVIGSEVFXXXXXXXXXXXXXXXMKQPSTAALLYSSGTTGRVKAVAITHRNLIYNAIRETVAREAAT
ACSM5_MOUSE     SDTSRPGWINFRELLRAASPEHNCVRTRSGDSVAIYFTSGTTGAPKMVEHSQSSYGLGFVASGRRWMALT
4CLL9_ORYSJ     TGAGVVPVDA----------------AQQSDLCALPYSSGTTGVSKGVMLSHRNLVSNLCSS--MFAVAP
FAT2_YEAST      IYRSLNNAKF----VNTNPVKFPGF-ARSSDVALILHTSGTTSTPKTVPLLHLNIVRSTLNIANTYKLTP
ACSF3_MOUSE     TEKPTE-----------QPVEESGWRDRG---AMIFYTSGTTGRPKGALSTHRNLA--AVVTGLVHSWAW
LUCI_PHOPY      KTD-YQGFQSMYTFVTSHPGEYDFVPESFDTIALIMNSSGSTGLPKGVALPHTACVRFSHARDPIFGNQI
4CL1_ORYSJ      LTVVLDGCLHFWDDLMSEDXXXXXXXXXXXXXXALPYSSGTTGLPKGVMLTHRSL--STSVAQQVDGENP
ACSM4_RAT       SPHRWDGWLSFQELLQSASEEHNCVQTGSQEPMAIYFTSGTTGSPKMAQHSQSSLYWLDLTSSDIMWNMS
4CL2_SOYBN      HFSVLSEANE---------SDVPEVEIHPDDAVAMPFSSGTTGLPKGVILTHKSLTTSV--AQQVDGENP
ACSF3_BOVIN     GVXXXXXXXTVYHGVAEDPEELVLERNWRDRGAMIIYTSGTTGRPKGVLSTHDNI--RAVVTGLVHKWAW
4CL4_ORYSJ      -----------------------------DDVVALPYSSGTTGLPKGVMLTHRSLVTSV--AQQVDGENP
4CL5_ORYSJ      --SALP----------------EVAIDVANDAVALPYSSGTTGLPKGVMLSHRGLVTSV--AQLVDGENP
MENE_LISIN      TTYVEPDLCKTW----------DLSRT-----ASVMYTSGTTGKPKGVMQTYENHWWSAVSS--VLNLGL
ACSM5_RAT       SDTSRPGWINFRELLRVASPEHNCLRTRSGDSMAIYFTSGTTGTPKMVEHSQCSYGLGFVASGRRLMALT
4CL4_ARATH      XXXXXXXXXXFTELTQADETELLKPKISPEDTVAMPYSSGTTGLPKGVMITHKGLVTSI--AQKVDGENP
LUCI_LUCCR      -----------------QASSFKTVEVDREQVALIMNSSGSTGLPKGVQLTHENTVTRSHARDPIYGNQV
LUCI_LUCLA      --RGYQSMDNFIKKNTPQGFKGSSFKTRKEQVALIMNSSGSTGLPKGVQLTHENAVTRSHARDPIYGNQV
ACSM3_HUMAN     SENSREGWGNLKELMKHASDSHTCVKTKHNEIMAIFFTSGTSGYPKMTAHTHSSFLGLSVNGRFWLDLTP
ACSM5_HUMAN     SDSSRPGWLNFRELLREASTEHNCMRTKSRDPLAIYFTSGTTGAPKMVEHSQSSYGLGFVASGRRWVALT
4HBCL_RHOPA     LANLLATEQE-----GGAPAA-----TCADDIAYWQYSSGTTGMPKGVMHVHSSPRVMAENAGRRIGYRE
4CL_PINTA       APKE--GCQHISVLTEADETQCPAVKIHPDDVVALPYSSGTTGLPKGVMLTHKGLVSSV--AQQVDGENP
MENE_STAAW      TMDIQYDTSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESLGFDR
MENE_STAAS      TMDIQYDTSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESLGFDR
LUCI_PHOPE      NNFISQNSDINLDVKKFKPNSFN----RDDQVALVMFSSGTTGVSKGVMLTHKNIVARSHCKDPTFGNAI
4CL3_ORYSJ      PVVTVDGAFVEFRXXXXXXXXXXXXXXXXXXXXXLPYSSGTTGLPKGVMLTHRSLITSV--AQQVDGENP
ACSM3_PONAB     SENSREGWGNLKEMMKHASDSHTCVKTKHNEIMAIFFTSGTSGYPKMTAHTHSSFLGLSVNGRFWLDLTP
ACS2B_HUMAN     SEKSCDGWLNFKKLLNEASTTHHCVETGSQEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGW--TGL
MENE_STAAB      TMDIQYDTSNETVVPKDSPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESLGFDR
MENE_BACA2      TL---------------------------DDTATLMYTSGTTGRPKGVQQTFGNHYSSAVSSA--LNLGV
MENE_STAAN      TMGIQYDTSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESLGFDR
MENE_STAAM      TMGIQYDTSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESLGFDR
MENE_STAA9      TMGIQYDTSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESLGFDR
MENE_STAA2      TMGIQYDTSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESLGFDR
MENE_STAA1      TMGIQYDTSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESLGFDR
ACS2A_HUMAN     SEKSCDGWLNFKKLLNEASTTHHCVETGSQEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGW--TGL
DHBE_BACSU      AEEFLPLED-----LHAEPVKLPEVKSS--DVAFLQLSGGSTGLSKLIPRTHDDYIYSLKRSVEVCWL--
ACSM4_MOUSE     SPHHWDGWLNFQELLQSASEEHNCVETGSQEPMAIYFTSGTTGSPKMAQHSQGSLYWLDLTSSDIMWNMS
ACSM4_HUMAN     SPQSWNGWLSFQELFQFASEEHSCVETGSQEPMTIYFTSGTTGFPKMAQHSQSSLYWLDLKSSDIIWNMS
MENE_STAAR      TMGIQYDTSNETVVPKDSPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESLGFDR
ACSM1_BOVIN     SDHSREGWLDFRSLVKSASPDHICIKSKTLDPMAIFFTSGTTGFPKMAKHSH---------GFALRSYFP
ACSF3_HUMAN     YTGXXXXXXXXXXXXQGW-------RNKG---AMIIYTSGTTGRPKGVLSTHQNI--RAVVTGLVHKWAW
ACSA_XANP2      KVDMLPGRDVYYDEATAMTDECPAEHVNAEDPLFILYTSGSTGKPKGVHTTGGYLVYASMTHQYIFDYHP
MENE_STAAU      TMGIQYETSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESLGFDR
MENE_STAAT      TMGIQYETSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESLGFDR
MENE_STAAE      TMGIQYETSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESLGFDR
MENE_STAAC      TMGIQYETSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESLGFDR
MENE_STAA8      TMGIQYETSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESLGFDR
MENE_STAA3      TMGIQYETSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESLGFDR
MENE_ENTFA      QHSL--SHQEFQ-----QPSDLESV-------ASIMYTSGTTGQPKGVLQRFKNHLASARGTQE--NMGI
ACSA_NOVAD      DVDFVEGRDIDWAAVAEQSADCQPEEMNAEDPLFILYTSGSTGKPKG--VLHTTGGYSVWASMTVFDYRP
4CLL3_ORYSJ     XXXXXXXXXXFRAMLDGGGGDGTETAVPQDDAVAILYSSGTSGRSKGVVLTHRNLI--AMTELFVRFEAS
ACSM1_MOUSE     SDHSHEGWLDFCSLIKSASPDHTCIKSKMKDPMAIFFTSGTTGYPKMAK-HNQGLAFRSYIPSCRKLLKL
ACSA_BACSU      GTNIINYDE----AAKQESTRLDIEWMDKKDGFLLHYTSGSTGTPKGVLHVHEAMIQQYQTGKWVLDLKE
ACSM1_HUMAN     SDHSREGWLDFRSLVKSASPEHTCVKSKTLDPMVIFFTSGTTGFPKMAKHSHGLALQPSFPGSRKLRSLK
4CL1_SOYBN      ----------------------------------------------------------------------
ACSA_PSYIN      EVNWVVGRDLDWESVCAESSECEPEAMNAEDPLFILYTSGSTGTPKGVHTTGGYLVYAAMTFKYVFDY--
ACSA_SHEFN      DIDWVEGRDVWWHSLMEVASEFQPAEMNAEDPLFLLYTSGSTGNPKGVHTTGGYMVYASMTHEYVFDYKA
ACSA_METPB      NVAMEPGRDVYYEAAEQVTDECPAEAVEAEHPLFILYTSGSTGQPKG--VVHTTLVYASMTHQYVFDY--
ACSA_DESAA      DVPMKAGRDLWWHELTAKESECPPESMDSEDPLFILYTSGSTGTPKGVHTTGGYIVYTSLTHQYVFDY--
ACSA_SYNFM      KVPVVPGRDVDWTAIKAASPDCPPEVMDAEDPLFILYTSGSTGKPKGVHTTGGYLVYTALSHQYVFDY--
ACSA_METRJ      SVAMEAGRDVYYEAAEQVTDECPAVAVDAEHPLFILYTSGSTGQPKG--VVHTTLVYASMTHEYVFDYRE
ACSA_SHEAM      V-NWVEGRDKWWHQVDGAATECAVEEMGAEDPLFLLYTSGSTGNPKGVHTTGGYLVYASMTHEYVFDYKP
ACSA_METC4      NVAMEPGRDVYYEAAEQVTDECPAEAVEAEHPLFILYTSGSTGQPKG--VVHTTLVYASMTHQYVFDY--
ACSA_METEP      NVAMEPGRDVYYEAAEQVTDECPAEAVEAEHPLFILYTSGSTGQPKG--VVHTTLVYASMTHQYVFDY--
MENE_LACLA      -----------------------------EKIAVIMNTSATTGKFKSVPITW-GMISNHVKASKETLGAY
ACSA_XANAC      VEMQAPRDRWFHDVVDGQPAACEPERMNAEDPLFILYTSGSTGKPKGVLHTTAGLLFASYTHEVVFDLRE
ACSA_RHOP5      DVF-MDDVRDFWEAAEMVTTECPVEPMHAEDPLFILYTSGSTGQPKGVHTTGGYLVFASMTHQYVFDY--
ACSA_PARL1      V--AMEKGRDVWYAEEAAKVSATCAPEEAEDPLFILYTSGSTGKPKGVHTTGGYMVYASMTHQYVFDY--
ACSF3_XENLA     PVLTMSGSQNLHPSELLQEIKISQLDLDWKDGAMIIYTSGTTGRPKGVLSTHYNLY--SMVTALVNEWGW
ACSA2_PSEAE     ----IPWVEGYHEALHAASADCPAEAMDAEDPLFILYTSGSTGKPKGVHTTGGYLLGAAMTHKYVFDY--
ACSA_SHESA      V-DWVEGRDVWWHSLVETASEHCAIEEMGEDPLFLLYTSGSTGNPKGVHTTGGYMVYASMTHEYVFDYKP
ACSA_SHESM      V-DWIEGRDVWWHSLVETASEHCAVEEMGEDPLFLLYTSGSTGNPKGVHTTGGYMVYASMTHEYVFDYKP
ACSA_BRAJA      KIDMNPTRDLWYAAMVTTECPVEHMHAE--DPLFILYTSGSTGQPKGVLHTSAGLVYAAMTHQYVFDY--
ACSA_SHESR      V-DWVEGRDVWWHSLVETASEHCAIEEMGEDPLFLLYTSGSTGNPKGVHTTGGYMVYASMTHEYVFDYKP
ACSA_BRASO      IEMNPTRDLWYHEAAEMVTTECPVEHMNAEDALFILYTSGSTGQPKGVHTTGGYLVYASMTHQYVFDY--
ACSA_XANOM      VEMQAPRDRWFHDVVDGQPAECEPERMNAEDPLFILYTSGSTGKPKGVLHTTAGLLFASYTHEVVFDLRE
4CLL5_ORYSJ     ------------------------------DTAAVLYSSGTTGRVKAVAITHRNLI-------ALMSLHA
ACSA_SODGM      IDWQ-PERDVWWHAIDGADDTCPPEAMGAEDPLFILYTSGSTGTPKGVHTTGGYLVYAATTFKYVFDYHP
ACSA_SHEON      I-DWVEGRDVWWHSLVETASEHCAVEEMGEDPLFLLYTSGSTGNPKGVHTTGGYMVYASMTHEYVFDYKP
ACSA_HALHL      IAWNDGRDVWFHEACAEASPDCPPEHMDAEDPLFILYTSGSTGKPKGVQSTAGYLLGTAMTHKYIFDY--
ACSA_XANCP      VDMQAPRDRWFHDVVDGQPAECEPERMNAEDPLFILYTSGSTGKPKGVLHTTAGLLFASYTHEVVFDLRE
ACSA_XANC8      VDMQAPRDRWFHDVVDGQPAECEPERMNAEDPLFILYTSGSTGKPKGVLHTTAGLLFASYTHEVVFDLRE
4CLL1_ARATH     C------------------GDTDNEEILQTDLCALPFSSGTTGLQKGVMLTHRNLIANLCSTLFGVRSEM
LGRC_BREPA      --EPVTNAET-------SVGEH--------NLAYVIYTSGSTGLPKGVMIEHRSVIFQIDATSRVLQFIS
4CLL7_ORYSJ     EPLPV-------------------VVVRQSETAAIQYSSGTTGRVKAAALPHRSFIAMVAGFHALRAKAR
ACSA_XYLFA      INMHTPRDRWFHHVVDIQATECAPERMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYTSYTHETVFDLR-
ACSA_XYLFT      INMHTPRDRWFHDLVDIQATECAPERMNAEDSLFILYTSGSTGKPKGVHTTGGYLVYTSYTHETVFDLR-
ACSA_BEII9      AVDWVEGRDVYEEAIAAASPECPLTEVEAEHPLFILYTSGSTGAPKGVHCTGGYLVYASMTHQYVFDY--
ACSA_VIBCH      NVAWHEHRDIWWASDNCPPEEMKA-----EDPLFILYTSGSTGKPKGVHTTGGYLVYATMTFKYVFDYQP
PPSB_BACSU      ENNSIPADVNIEEIVTDQP-------------AYVIYTSGTTGQPKGVIVEHRNVISLLKHQNLPFE---
ACSA_YERPS      ASYWEDGRDVWWHDLIKEASDCPPEEMNAEDPLFILYTSGSTGKPKG--VVHTTLVYAALTFKYVFDYHP
ACSA_YERP3      ASYWEDGRDVWWHDLIKEASDCPPEEMNAEDPLFILYTSGSTGKPKG--VVHTTLVYAALTFKYVFDYHP
ACSA_RHILO      KVGWAPGRDLWYHEVATVKAECKPEKMKAEDPLFILYTSGSTGKPKGVLHTTAGLVYASMTHQYVFDY--
ACSA_PSEA6      IVFKHTGSHVSWGKTDGCSTDCPPEVMNAEDPLFILYTSGSTGQPKG--VVHTTLLWASITHKYVFDYKP
ACSA_ALCBS      VDWQAPRDVWYHEAMADASSDCEPEWVEAEDPLFTLYTSGSTGKPKGVVHTTAGYLLNALTHKYVFDY--
ACSA_YERPP      ASYWEDGRDVWWHDLIKEASDCPPEEMNAEDPLFILYTSGSTGKPKG--VVHTTLVYAALTFKYVFDYHP
ACSA_YERPN      ASYWEDGRDVWWHDLIKEASDCPPEEMNAEDPLFILYTSGSTGKPKG--VVHTTLVYAALTFKYVFDYHP
ACSA_YERPE      ASYWEDGRDVWWHDLIKEASDCPPEEMNAEDPLFILYTSGSTGKPKG--VVHTTLVYAALTFKYVFDYHP
ACSA_YERPA      ASYWEDGRDVWWHDLIKEASDCPPEEMNAEDPLFILYTSGSTGKPKG--VVHTTLVYAALTFKYVFDYHP
4CLL2_ORYSJ     -----------------------------DDAAAVLYSSGTSGRSKGVVVTHRNLIAMVVRFEASQYTRP
ACSA_YERE8      ASYWKDGRDVWWASVDCPPEEMNA-----EDPLFILYTSGSTGKPKGVHTTGGYLVYAALTFKYVFDYHP
ACSA_AERS4      NVAWHNHRDIWWAASSDCPPE----AMNAEDPLFVLYTSGSTGKPKGVHTTGGYLVYATLTFKYVFDYHE
ACSA_NEUCR      DISMTPGRDLWWEEVEKYPAYYTPVAMASEDPLFLLYTSGSTGKPKGAHSTGGYLLGAAMTGKYVFDI--
ACSA_AGRRK      KTGWAPGRDLWYHEETAKKADCPPVKMKAEDPLFILYTSGSTGKPKGVHTTGGYLVYAAMTHEYTFDYHP
ACSA_AGRT5      KTGWAPGRDIWYQEIATVKPDCPPVKMRAEDPLFILYTSGSTGKPKGVHTTGGYLVYTSMTHEYVFDYKD
ACSA_AERHH      NIAWHNHRDIWWHAVATVSADCPPEAMGAEDPLFILYTSGSTGKPKGVHTTGGYLVYATLTFKYIFDYHE
ACSA_METSO      DVSMKEGRDVWWHDLKGQSEECEPVWVDPEHRLYILYTSGTTGKPKGIEATGGNAVGPAQTLHWVFDLKD
ACSA_RHOCA      QISWVHGRDVDLLYLMEHVSECPPRPMNAEDPLFILYTSGSTGKPKG--VVHTTLVYAAMTHQYTFDYKD
ACSA_EMENI      EVPWTEGRDIWWEEVEKYPAYIAPDSVNSEDPLFLLYTSGSTGKPKGVMHTTAGYLLGAAMTGKVFDIHD
ACSA_MAGSM      TE----GRDVWYEAIAAASADCPPEEMDAEDPLFVLYTSGSTGKPKGVHTTGGYLLYASITHQYIFDYHE
ACSA_RHOBA      DAPMQEGRDVWWHVVENQPGEMAAKPLDSETPLFILYTSGSTGKPKG--ILHTTAGYNLWAKRTVFDHRE
ACSA_METSB      KVAWTEGRDVWYEALAKASPDCPAAEMNAEDPLFILFTSGSTGAPKGVHSTGGYLVWASMTHQYVFDYRP
ACSA_LEPIN      ESGLTDGQDYWYHFLMNDPELSAYCKPEAEDPLFILYTSGSTGKPKGVLHTTGGYLLGALTFHYVFDIKP
ACSA_LEPIC      ESGLTDGQDYWYHFLMNDPELSAYCKPEAEDPLFILYTSGSTGKPKGVLHTTGGYLLGALTFHYVFDIKP
ACSA_ECOLI      IDWQ-EGRDLWWHDLVEQASDHQAEEMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYAALTFKYVFDYHP
ACSA_ECOL6      IDWQ-EGRDLWWHDLVEQASQHQAEEMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYAALTFKYVFDYHP
MENE_STAEQ      -----------------------------ESIASIMFTSGTTGPQKAVPQTFNNHLASAKGQSLGFEQ--
ACSA_ENTS8      NIEWHEGRDLWWSELKKASAHHQPVEMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYAATTFLYAFDYHP
ACSA_BARHE      TCGPIHWVEDFWEEVSHTKTDCPAEKMNAEDPLFILYTSGSTGKPKGVLHTTAGLVYASMTHKYVFDY--
ENTE_ECOLI      VQLLNDSGENLQDAINHPAEDFTATPSPADEVAYFQLSGGTTGTPKLIPRTHNDYYYSVRRSVEICQFTQ
ACSA_VIBVY      NIDWHEHRDVWWHEATAKVSDVPPEEMKAEDPLFILYTSGSTGKPKGVHTTGGYLVYATMTFKYVFDYQP
ACSA_VIBVU      NIDWHEHRDVWWHEATAKVSDVPPEEMKAEDPLFILYTSGSTGKPKGVHTTGGYLVYATMTFKYVFDYQP
ACSA_CITK8      VDWH-EGRDLWWSVIEKSSADHQPEEMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYAATTFKYVFDYHP
ACSA_CHRVO      GADWTDGRDVWWHKLEGQSEACEPEWMGAEDPLFILYTSGSTGKPKGIQHSTAGYLLGALNSFRVFDYKP
ACSA_GEMAT      ETFAEEGRDHWWHRLKRQPRYCEPEAMDAEDVLFVLYTSGTTGKPKGIVHT-TGGFLTGVATTTKYTFDL
ENTE_ECO57      SIRVVQGEHNLQDAINHPADGFTATPSPADEVVYFQLSGGTTGTPKLIPRTHNDYYYSVRRSVEICQFTQ
MENE_STAES      -----------------------------ESIASIMFTSGTTGPQKAVPQTFNNHLASAKGQSLGFEQ--
ACSA_PHOLL      IGHWQSGRDLWWHELVADASADCPVEENAEDPLFILYTSGSTGKPKGVHTTGGYLVYASLTFKYVFDYQP
DHBF_BACSU      VTQEI---------IKRYSPENQDVSVSLDHPAYIIYTSGSTGRPKGVVVTQKSLSNFLLSMQEAFSLGE
ACSA_LEPBJ      ESGLVDGRDYWYHFLIGDPDLSPYCKPESEDPLFILYTSGSTGKPKGVYLLGVNLTFHYV-----FDIKP
ACSA_BDEBA      TVDMKPGRDLWYEEVKTVSDQCEPEPMDAEDPLFILYTSGSTGKPKGVMHTTGGLVYASMTHQYVFDYHE
ACSA_ALHEH      IDWKEGRDIWYHEAVADVSADCPAEELDAEDPLFILYTSGSTGKPKGVQHCSAGYLLGAAMTHKVFDY--
TYCB_BREPA      QTENI-----------------EPIHTAAD-LAYIIYTSGTTGRPKGVMVEHRGIVNSVTWNRDEFASVR
ACSA_ECO57      IDWQ-EGRDLWWHDQVEQASDHQAEEMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYAALTFKYVFDYHP
ACSA_BART1      TCGPIDWIEDFWYAKTNCPAE----PMNAEDPLFILYTSGSTGKPKGVHSTGGYLVYAAITHKYVFDYHP
GRSB_BREBE      -----------WLDLTDEQNYVEDFMNQSTDLAYIIYTSGTTGKPKGVMIEHQSIINCLQWRKEEYEFGP
BACA_BACLI      DRS-----------------DIDNVNQSG-DLAYVIYTSGSTGKPKGVMIEHQSLINLCSWHQSCFEVGQ
ACSA_LARHH      YTPCSMGARDIWDALTGQPLECEPEWMSAEDPLFILYTSGSTGKPKGIQHSSAGYLLGAANSFRAFDYKP
ACSA_SHESW      I-DWVEGRDVWWHSLLETASEHCQPEEMGEDPLFLLYTSGSTGNPKGVHTTGGYMVYASMTHEYVFDYK-
ACSA_SHEPC      I-DWVEGRDVWWHSLLETASEHCQPEEMGEDPLFLLYTSGSTGNPKGVHTTGGYMVYASMTHEYVFDYK-
ACSA_PHOPR      VEWHSERDVWWHEATAVASSHCEPEEMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYATMTFKYVFDY--
VIBE_VIBCH      TRVTDP---KFIELASCYSASSCQANADPNQIAFFQLSGGTTGTPKLIPRTHNDYAYSVTASVEIFDQ--
ACSA_SHEB8      V-DWVEGRDVWWHSLMETASEYQPEEMDAEAPLFLLYTSGSTGNPKGVHTTGGYMVYASMTHEYVFDYK-
ACSA_SHEB5      V-DWVEGRDVWWHSLMETASEYQPEEMDAEAPLFLLYTSGSTGNPKGVHTTGGYMVYASMTHEYVFDYK-
ACSA_BARBK      RTSKIVNGRDFWEEMPHATPDCPPEHMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYASMTHQYVFDYHP
4CLL8_ORYSJ     -----------------------------DDAALLFYSSGTTGRSKGVVSTHGNAIAMAASLERAWXQQY
ACVS_NOCLA      TSGDVLDLEQL--DLTGEPAENPVTETTSTELAYAIYTSGTTGKPKAVLVSHGSVSFRAQLSGRYFGSPD
ACSA_VIBPA      NVDWHGHRDVWWHEATAKVSDVEEMKAE--DPLFILYTSGSTGKPKGVHTTGGYLVYAAMTFKYVFDYQP
ACSA_SHEHH      DINWVEGRDIWWDSLMDTASEHCIAEEMGEDPLFLLYTSGSTGNPKGVHTTGGYMVYAAMTHEYVFDYK-
GRSB_ANEMI      -----------WLDLTDEQNYVEDFMNQSTDLAYIIYTSGTTGKPKGVMIEHQSIINCLQWRKEEYEFGP
ACSA_METFK      DIAWNPHRDAWWHEVEAAENDCEPVWVDAEHPLFILYTSGSTGTPKGVQHSTGGYLLGAIMSMKVFDHK-
ACSA_MARMS      TEKDVPGRDLDWAVVENESTECPAERMNAEDPLFILYTSGSTGKPKG--VVHTTLVYASLTHELVFDLKP
ACSA_LEPBL      ESGLVDGRDYWYHFLISDPDLSPYCKPESEDPLFILYTSGSTGKPKGVYLLGVNLTFHYV-----FDIKP
AAS_SALTI       ----VTPADKLWIFAHLLAPRLAQVKQQPEDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
ACSA_SALTY      DIDWQEGRDLWWRDLIEKASEHQPEAMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYAATTFKYVFDYHP
ACSA_PRB01      INWDDKKDVWYEDLVKDVSNKCAPEPMDSEDPLFILYTSGSTGKPKGVLHTTAGYLLGAISFKYLFGIRP
AAS_SALSV       ----VTPADKLWIFAHLLAPRLAQVKQQPEDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_SALPB       ----VTPADKLWIFAHLLAPRLAQVKQQPEDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_SALHS       ----VTPADKLWIFAHLLAPRLAQVKQQPEDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_SALG2       ----VTPADKLWIFAHLLAPRLAQVKQQPEDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_SALEP       ----VTPADKLWIFAHLLAPRLAQVKQQPEDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_SALA4       ----VTPADKLWIFAHLLAPRLAQVKQQPEDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
ACSA_PASMU      DTPWKKGRDLWWNELTAQPAFCEPEWMNAEDPLFILYTSGSTGKPKGIVHSTGGYLLGALNSFRVFDNKP
AAS_SALPC       ----VTPADKLWIFAHLLAPRLAQVKQQPEDEAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_SALCH       ----VTPADKLWIFAHLLAPRLAQVKQQPEDEAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
ACSA_SHEDO      NVDWQQGRDLDWDELMGVSSDCPAEEMNAEDPLFLLYTSGSTGNPKGVHTTGGYLVYAAMTHEYVFDYK-
ACSA_SALTI      DIDWQEGRDLWWRDLIEKASEHQPEAMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYAATTFKYVFDYHP
ACSA_SACD2      IVVKRTGADVAWEAQQSVDTVCEPESMDSEDPLFILYTSGSTGKPKGVHTTGGYLLQAAMTHKYVFDYQP
ACSA_RHISN      TGGKVPWAPGRDVWYHQEIATVEPEKMRAEDPLFILYTSGSTGKPKGVHTTGGYLVYASMTHQYVFDY--
AAS_SALTY       ----VTPADKLWIFAHLLAPRLAQVKQQPEDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_SALPK       TL-----ADKLWIFAHLLAPRLAQVKQQPEDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_SALPA       TL-----ADKLWIFAHLLAPRLAQVKQQPEDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_SALNS       ----VTPADKLWIFAHLLAPRLAQVKQQPEDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_ENT38       TT-----ADKLWIFAHLLVPHLAQVKQQPEDAAMILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
LGRB_BREPA      TTIAL---DRDWPLIAKESEQAPDVDTTAESLAYVIYTSGSTGLPKGTLVVHRGIVRLVKETDYV---TI
ACSA_RHIE6      KTGWAPGRDLWYQEVATVKAECPPVKMKAEDPLFILYTSGSTGKPKGVHTTGGYLVYASMTHEYVFDY--
ACSA_SHEB9      V-DWVEDRDVWWHSLMETASEYQPEEMDAEAPLFLLYTSGSTGNPKGVHTTGGYMVYASMTHEYVFDYK-
ACSA_PSEHT      XXXXXXXXXXXXXLVADEEPVCEPEVMNAEDPLFILYTSGSTGQPKG--VVHTTLVYASMTHEYIFDVKE
ACSA_BARQU      TSGTIDWVKDFWEEISHAKTDCPAEMMNAEDPLFILYTSGSTGKPKGVLHTTAGLVYVSMTHQYVFDYHP
ACSA_AGRVS      KVGWAPGRDLWYQEIAKVKPDCPPVKMKAEDPLFILYTSGSTGKPKGVHTTGGYLVYAAMTHEYVFDYKD
ACSA2_PSEPK     LVVRRTGGDVAWTATKDAGDDCPPEPMEAEDPLFILYTSGSTGKPKGVLHTTGGYLLQATMTFKVVFDYR
ACSA_RHIEC      KTGWAPGRDLWYQEVATVKAECPPVKMKAEDPLFILYTSGSTGKPKGVHTTGGYLVYASMTHEYVFDY--
ACSA_PYRAE      DVPMTEGRDYWWNKLQGIPPNIEPEPVESEHPSFILYTSGTTGKPKGIVHDTGGWAVHVYATMKVFDIRD
LGRD_BREPA      VICLDSDL------LADEPVDNASSEVTEQNLAYVIYTSGSTGLPKGVMIEHHSAINLAYALIDAFDIQP
AAS_SALDC       TL-----ADKMWIFAHLLAPRLAQVKQQPEDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_ENTS8       VTAK----DKAWIFAHLLMPRLAQVEQQPEDAALILFTSGSEGNPKGVVHSHKSLLANVEQIRTIADFTA
ACSA_MARAV      TNDQVPWTERYEDLMKNASAECQPEPMNAEDPLFMLYTSGSTGAPKGVHTTGGYMVYASMTHQYVFDY--
ACSA_LEPBP      NLNWKEGRDHWYHYLMKDPEECPAVPMESEDPLFILYTSGSTGKPKGVLHTTAGYLLGANLTFATIFDYK
ACSA_LEPBA      NLNWKEGRDHWYHYLMKDPEECPAVPMESEDPLFILYTSGSTGKPKGVLHTTAGYLLGANLTFATIFDYK
TYCC_BREPA      SGSNLPAVN--------QP----------TDLAYVIYTSGTTGKPKGVMIPHQGIVNCLQWRRDEYGFGP
SRFAA_BACSU     ------GAEE---SLNAD--------VNARNLAYIIYTSGTTGRPKGVMIEHRQV-HHLVESLQQTIYQS
ACSA_SYNAS      TGSQIPGRDFDWEGLMQEASDCPPEEMDAEDPLFILYTSGSTGKPKGVHTTGGYLLFTAMSHQHIFDY--
AAS_KLEP3       ITLA----DKLWIFGHLLAPRLAQVKQQPEDAAMILFTSGSEGNPKGVVHSHKSLLANVEQIKTIADFT-
ACSA_SHEPA      DINWVEGRDIWWGSLMETASEHCIPEEMGEDPLFLLYTSGSTGNPKGVHTTGGYMVYAAMTHEYVFDYK-
ACSA_RHILW      KTGWAPGRDLWHQEIATVKPECPPVKMKAEDPLFILYTSGSTGKPKGVHTTGGYLVYAAMTHEYVFDY--
AAS_SHISS       TT-----ADKVWIFAHLLMPRLAQVKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_SHIFL       TT-----ADKVWIFAHLLMPRLAQVKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_SHIF8       TT-----ADKVWIFAHLLMPRLAQVKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_SHIB3       TT-----ADKVWIFAHLLMPRLAQVKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_ECOSE       TT-----ADKVWIFAHLLMPRLAQVKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_ECOLC       TT-----ADKVWIFAHLLMPRLAQVKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_ECOHS       TT-----ADKVWIFAHLLMPRLAQVKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_ECO5E       TT-----ADKVWIFAHLLMPRLAQVKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_ECO57       TT-----ADKVWIFAHLLMPRLAQVKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_ECO55       TT-----ADKVWIFAHLLMPRLAQVKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_ECO24       TT-----ADKVWIFAHLLMPRLAQVKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
ACSA_THEEB      VTM-VPGRDHWWHDLQGVSADCPAEPMDSEDLLFILYTSGSTGKPKG--VVHTTALYTHITTQWVFDL--
AAS_ECOLU       TT-----ADKVWIFSHLLMPRLAQVKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_ECOLI       TT-----ADKVWIFAHLLMPRLAQVKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_ECODH       TT-----ADKVWIFAHLLMPRLAQVKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_ECOBW       TT-----ADKVWIFAHLLMPRLAQVKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_ECO7I       TT-----ADKVWIFAHLLMPRLAQVKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
PPSD_BACSU      DKSPLPQMSS------------------AHHLAYIIYTSGTTGRPKGVMVEH-----KGIANTLQWRRNA
BACC_BACLI      ----LTGDFSSYPADNLEPAG------NADSLAYIIYTSGSTGKPKGVMIRQRGLVNYITWADRVYVQGE
ACSA_SHESH      DVNWVEGRDIKWESLMDTASEHCIPEEMGEDPLFLLYTSGSTGNPKGVHTTGGYMVYAAMTHEYVFDYKD
ACSA_SCHPO      TASMVEGRDVWWHDIIPKPRYCPPAVVNPEHPLFLLYTSGSTGKPKGVHCTGGYLLGAAATCKYVFDLHP
ACSA1_PSEAE     EIKWNQHRDVWYDDLMKVAGSTCAPKEMGEDPLFILYTSGSTGKPKGVHTTGGYLVYASLTHERVFDYRP
AAS_ECOSM       TT-----ADKVWIFAHLLMPRLAQVKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_ECOL6       TT-----ADKVWIFAHLLMPRLAQLKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_ECO27       TT-----ADKVWIFAHLLMPRLAQLKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
ACVS_CEPAC      QHLRIIGLESLFDNLAQQTGNLTHLPLNSKQLAYVTYTSGTTGFPKGIYKEHTSVVNSITDLSARYGVAG
AAS_KLEP7       ITLA----DKLWIFAHLLAPRLAQVKQQPEDAAMILFTSGSEGNPKGVVHSHKSLLSNVEQIKTIADFT-
AAS_ESCF3       T-------DKVWIFAHLLMPHLAQVKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_ECOUT       TT-----ADKVWIFAHLLMPRLAQVKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_ECOK1       TT-----ADKVWIFAHLLMPRLAQVKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
AAS_ECO45       TT-----ADKVWIFAHLLMPRLAQVKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
ACSA_NITEU      GITWQPERDHWWHDLAGQPDECEPAWINAEHPLFTLYTSGSTGKPKGVQHSSAGYLLGAVTSMQVFDYHA
ACS1_CANAL      HVPFSPGRDLWWHDEMAKYGPFPPVPVNSEDPLFLLYTSGSTGKPKGVQHNTAGYLLGAVLTTKYFDVHE
ACSA_PENCH      EVPWTAGRDIWWEEVEKYPNYLAPESVSSEDPLFLLYTSGSTGKPKGVMHTTAGLLGAAMTGKYVFDIHD
ACSA_AGRRH      PLSWAPGRDLWHAATVSADCPPEPMKAE--DPLFILYTSGSTGKPKGVHTTGGYLVYASMTHEYVFDY--
ACVS2_PENCH     RNLCIIRLEPLLASLAQDSSKFDDLPLTSQQLAYVTYTSGTTGFPKGIFKQHTNVVNSITDLSARYGVAG
ACVS1_PENCH     RNLCIIRLEPLLASLAQDSSKFDDLPLTSQQLAYVTYTSGTTGFPKGIFKQHTNVVNSITDLSARYGVAG
ACSA_SERP5      TNVVVEGRDLWWHELTGVSADCPPEEMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYAAMTFKYVFDY--
AAS_ECOL5       TT-----ADKVWIFAHLLMPRLAQVKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT-
ACSA2_RHIME     TVSKVTGGKVGWAPGRDLWYHQETAAAEAEDPLFILYTSGSTGKPKGVHTTGGYLVYASMTHQYVFDY--
ACSA_SINMW      TVGKVTGGKVGWAPERDLWYHQETAAVEAEDPLFILYTSGSTGKPKGVHTTGGYLVYASMTHQYVFDY--
ACSA_RUBXD      EVNMVEGRDLWWHELEAEP-ECPAEEMDSEDILYILYSSGSTGKPKGGYLTHVN-----TTTDWVFDLKE
ACS2L_MOUSE     DTKVPMGSLDI--PLEQEMAKEAPVCTSSEDMLFMLYTSGSTGTPKG--LVHTQLLYAAMTHKLVFDYQP
ACSA_PSESM      ----------------------------------ILYTSGSTGKPKGVLHTTAGLLYAALTHERVFDYKP
ACSA_NITEC      TTSVHPERDRWWHNLTAQSDECEPIWVNAEHPLFTLYTSGSTGKPKGVQHSSAGYLLGAIVSMQVFDY--
ACSA_CAUCR      DVPLKAGRDIVWQDVRDTSADCPPEPMNAEDPLFILYTSGSTGKPKG--VLHTTGGYLAWASWAVFDYKP
AAS_PECCP       -----------------------------DDAAIVLFTSGSEGNPKGVVHSHDSLLANVEQIRTVADFTP
FCSA_DICDI      KFKDNENVKLYLLSDFEKLGEQNPAQHEPEDLCTLLYTSGSTGNPKGVMLTHTNMV-SEVAGANFSPAGV
ACSA_PSE14      ----------------------------------ILYTSGSTGKPKGVLHTTAGLLYAALTHERVFDYKP
ACSA1_PSEPK     -----------------------------EEALFILYTSGSTGKPKGVHTTGGYLVYAALTHERVFDYRP
AAS_ERWT9       LTTQ----DKLWILGHLLLPRRAMVAQQPEDAAMVLFTSGSEGHPKGVVHSHKSLLANVEQIRTVADFTP
ACSA_PSEU2      ----------------------------------ILYTSGSTGKPKGVLHTTAGLLYAALTHERVFDYRP
AAS_ERWCT       -----------------------------DDAAIVLFTSGSEGNPKGVVHSHDSLLANVEQIRTVADFTP
AAS_CITK8       ----VTLADKLWIFAHLLMPRLAQVKQRPEEAAMILFTSGSEGHPKGVVHSHKSLLANVEQIKTIADFT-
ACSA_SHELP      PVNWVEGRDIKWASLMETASEHCVAEEMGEDPLFLLYTSGSTGNPKGVHTTGGYLVYASMTHEYVFDYKE
AAS_YERE8       LKDTVTLADKLWILFHLCCPRRAMVPQQADDSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIADFTP
ACS2_CANAL      EIHLTEGRDYYWDVETAKPGYLPPVSVNSEDPLFLLYTSGSTGTPKGVHSTAGYLLGAALSTKYIFDIHP
ACSL1_MOUSE     ERGKKCGVEIISLKALEDLGRVNRVKPEPEDLAIICFTSGTTGNPKGAMITHQNIINDCSATESAFIAST
ACSA_DROME      VEEEIPWTDDYWEEMEDKEPACYPEWMDAEDPLFMLYTSGSTGKPKGVHXXXXXXXXXXXXFKIVFDYKP
ACS2L_HUMAN     LVAHRTDNKVHMGDLD-VPLEQEMAKEDSEDMLFMLYTSGSTGMPKG--IVHTQLLYAALTHKLVFDHQP
PPSA_BACSU      TL------EVDMTSLASEKAEHEFTPADGGSLAYVIYTSGSTGQPKGVAVEHRQAV---SFLTGMQHQFP
AAS_YERPY       ---------KLWILFHLCFPRRAMLPQQADDSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIADFTP
AAS_YERPS       ---------KLWILFHLCFPRRAMLPQQADDSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIADFTP
AAS_YERPP       ---------KLWILFHLCFPRRAMLPQQADDSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIADFTP
AAS_YERPG       ---------KLWILFHLCFPRRAMLPQQADDSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIADFTP
AAS_YERPB       ---------KLWILFHLCFPRRAMLPQQADDSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIADFTP
AAS_YERP3       ---------KLWILFHLCFPRRAMLPQQADDSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIADFTP
ACS2_DEBHA      EVTLKEGRDYWWSEETQKAGYLPPVPVNSEDPLFLLYTSGSTGTPKGVHSTAGYLLGAALTTKYVFDIHP
ACSA_MYCTU      EMAWSEGRDLWWHHVVGSASPAHTPEPDSEHPLFLLYTSGTTGKPKGIMHTSGGYLTQCCYTMTIFDVKP
ACSA_MYCBO      EMAWSEGRDLWWHHVVGSASPAHTPEPDSEHPLFLLYTSGTTGKPKGIMHTSGGYLTQCCYTMTIFDVKP
PPSC_BACSU      -----------------EVKRHVSASVSDGSLAYVIYTSGSTGQPKGVAVEHRQAVSFLTGMQHQFRLSE
ACSL1_CAVPO     EQGKKCGVEVI--SLKAMEGLGRANRREPDDLAVICFTSGTTGNPKGAMITHKNVVSDCSAFVKATEKAL
ACSA_PSYCK      NSVPMSGRRDIWSLVDGESQHCEPEVMNAEDPLFLLYTSGSTGKPKGVLHTTGGYITYALSTFRVFDIKE
LGRA_BREPA      NTNNLPHVN------------------RPDDLVYVMYTSGSTGLAKGVMIEHHNLVNFCEWYRPYFGVTP
ACVS_EMENI      ---SIIRLEHCLSAIDQQPSTFPRANLRSKQLAYVTYTSGTTGFPKGILKQHTNVVNSITDLSARYGVTG
AAS_YERPE       ---------KLWILFHLCFPRRAMLPQQADGSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIADFTP
AAS_YERPA       ---------KLWILFHLCFPRRAMLPQQADGSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIADFTP
ACSA_SYNY3      DVTMTAGRDHWWHELQPQQSAHPAEPIDSEDMLFILYTSGSTGKPKG--VVHTTNLYTHMTTKWIFDLKD
ACSA_COPCI      TGNPVPGRDVWWEAVARVPRYCPPEVMASEDPLFILYTSGSTGKPKG--VVHTTLLCAALTVKYVFDVHP
ACS1_DEBHA      GNAHIPGRDLWWHEEMAKYGPFPPVPVNSEDPLFLLYTSGSTGKPKGIQSTAGYLLGAAMTSKYTFDVHE
S27A2_RAT       RTSNTNGVDTVLDKVDGVSADPESWRSEFTTPAVYIYTSGTTGLPKAATINHHRLWY---GTSLALRSGI
ACSL6_RAT       ---------------SGQENHRVPVPPRPDDLSIVCFTSGTTGNPKGAMLTHGNVVFSGFLKVTESQWAP
ACSL6_HUMAN     ----------------GQENHQAPVPPQPDDLSIVCFTSGTTGNPKGAMLTHGNVVFLKVTEKVIF---P
ACSL1_RAT       EIIGLKALEDL-----GRVNRTKPKPPEPEDLAIICFTSGTTGNPKGAMVTHQNIMNDCSATESAFIASP
ACSA_STRCO      DVAWDDSRDKWWETVDGQSAEHTPEAFDAEHPLFILYTSGTTGKPKG--ILHTSLTQTAYTHWAVFDLKP
ACVS_STRCL      D-----------GLLSVKPELALGVR----DLAYLTYTSGTTGVPKGVPKYHDSVVNSITDLSERYDRRP
ACSL1_HUMAN     EVTSMKAMEDL-----GXXXXXXXXXXXXEDLAVICFTSGTTGNPKGAMVTHRNIVSDCSAFVKATENTP
TYCA_BREPA      HQPSKP-----------------------TDLAYVIYTSGTTGKPKGTMLEH-----KGIANLQSFFQ--
ACSA_DEIRA      PLEWTEGRDLWWHVVDRQSDQHEATALDSEHPLFILYTSGSTGAPKGVQHTTGGYMVGTLTTQTVFDLRD
MYCA_BACSU      -----------------------------NDLAYMIYTSGSTGNPKGVLIEHRGLANYIEWAKEVYVNDE
ACSA_RALEJ      KVNWVEGRDRWMEDVSGQPDTCEAVPVSAEHPLFVLYTSGSTGKPKGVQSTGGYLLWALMTMQWTFDIKP
BACB_BACLI      DTDG---------------SNLEHLNSPGD-LAYVIYTSGTTGNPKGVMVEHRNIIHAHYTWRKHYELAS
ACSA_COPC7      TGNPVPGRDVWWEAVARVPRYCPPEVMASEDPLFILYTSGSTGKPKG--VVHTTLLCAALTVKYVFDVHP
MYCC_BACSU      LDMEDP--QTF----SEDGSNLESI-SGPNQLAYVIYTSGSTGKPKGVMVEHRSVINRLVERDAILQKTA
ACSL6_MOUSE     ----------------GRENHHAPVPPRPDDLSIVCFTSGTTGNPKGAMLTHGNVVFLKVTEKVIF---P
ACSA_PSYA2      NSVPMSGRRDIWSLVDGESQYCEPEVMNAEDPLFLLYTSGSTGKPKGVLHTTGGYITYALSTFRXXXXXX
ACSA_DICDI      PTITFNPSIDIWAAMLDHRPYCPPVWLDSEDPLFILYTSGSTGTPKG--LVHTQLLYAAMTHRYVFDY--
S27A3_MOUSE     VDEPVPG--------------YLSAPQNIMDTCLYIFTSGTTGLPKAARISHLKVL---QCQGFYHLCGV
SRFAB_BACSU     --------DGKW---RNESKERPSSISGSRNLAYVIYTSGTTGKPKGVQIEHRNLT-NYVS---WFSEEA
GRSA_BREBE      ------------DTIKIREGTNLHVPSKSTDLAYVIYTSGTTGNPKGTMLEHKGISLNVTEKDRIGQFAS
ACSA_THIDA      VNWS--ARDLWWHELTQTQAETEPVWVSAEHPLFILYTSGSTGKPKGVQHSTGGYLLGALLSMLWVFDAK
ACS2_CANGA      -TEGIPAGRDFWLEADKRRSYLPPVPCDAEDPLFLLYTSGSTGSPKG--IVHTTLLGAAMTTKYVFDVHP
S27A2_MOUSE     RTSNTNGVDTILDKVDGVSAEPESWRSEFTTPAVYIYTSGTTGLPKAATINHHRLWY---GTGLAMSSGI
ACSA_THET2      EVPWTPGRDHWWHELEAAPDRCDPESMEAEEPLFILYTSGSTGKPKGVLHXXXXXXXXXXXXXKLVFDLK
SRFAC_BACSU     TTLFIDDQTRF-----EEQASDPATAIDPNDPAYIMYTSGTTGKPKGNITTHANILVKHVDYMAFSDQ--
PRPE_SALTY      KMAWVDGRDLDFATLRQQHASVPVAWLESNETSCILYTSGTTGKPKGVQ---RDVGGYAVALATSMDTGG
GRSA_ANEMI      ------------DTIKIREGTNLHVPSKSTDLAYVIYTSGTTGNPKGTMLEHKGISLNVTEKDRIGQFAS
ACSA_THET8      EVPWTPGRDHWWHELEAAPDRCDPEPMEAEEPLFILYTSGSTGKPKGVLHXXXXXXXXXXXXXKLVFDLK
ACSA_RALEH      KVAWTEGRDRWMEDVSGQPDTCEAEPVSAEHPLFVLYTSGSTGKPKGVQSTGGYLLWALMTMKWTFDIKP
ACS1_KLULA      NIKYIPGRDLDW---DEEVKKYKSYTVDSEHPLFLLYTSGSTGAPKGVQHSTAGYLLQALLSKYTFDIQN
BAIB_EUBSP      ----IPGADEIYEAMEGRSKEMPSDRLANPNM--ISLSGGTSGKMKFIRLDDETIRSWSLMSGMGFEQRQ
ACSA_PSEU5      NIRWYPHRDVSYDDLMRVAGEVCAPKEMGEEPLFILYTSGSTGKPKG--VLHTYLLYAALTHERVFDYRP
ACSA_RALSO      GVNWVEGRDRAMDEVEGQPDTCEVTPVGAEHPLFILYTSGSTGKPKGVQSTGGYLLWALLTMQWTFDLKP
ACSA_PHYBL      PVPWVQGRDVWWHEEMAKARTFCSPEPSAEDPLFLLYTSGSTGTPKGILHTTGGYLLGVAATKYIFDY--
ACS1_CANGA      QVNFQAPRDLDWETERKKKTYFPCEPVDSEHPLFLLYTSGSTGTPKGVQHSTAGYLLGALLTMRYFDVHQ
ACSA_RALME      NVAWTEGRDSMEDVAAGQSDNCPAEPVGAEHPLFVLYTSGSTGKPKGVQSTGGYLLWALMTMRWTFDIKP
ACS2_ZYGBA      GSEGIPGRDYWWHEETAKQRSYPPVPCNSEDPLFLLYTSGSTGSPKGVHSTAGYLLGAAMTTRYVFDIHP
PRPE_ECOLI      KMARVSGRDVDFASLRHQHARVPVAWLESNETSCILYTSGTTGKPKGVQ---RDVGGYAVALATSMDTGG
ACSA_BURS3      IVYRRTGGKIDWHAERGESDQCEPEWVGAEHPLFILYTSGSTGKPKGVQSTGGYLLWAAQTMKWTFDWKP
DLTA_BACC2      EDNL---KDIFFTHKGNTPNPEHAVK--GDENFYIIYTSGSTGNPKGVQITYNCLVFNLQTGQVFLNQAP
ACS2_KLULA      GTQGIPPARDFWEECVKQRGYLPPVPVNSEDPLFLLYTSGSTGSPKGVHSTAGYLLGSALTTRFVFDIHP
DLTA_BACCR      -------KDIFFTHKGNTPNPEHAVK--GDENFYIIYTSGSTGNPKGVQITYNCLVFNLQTGQVFLNQAP
DLTA_BACC4      -------KDIFFTHKGNTPNPEHAVK--GDENFYIIYTSGSTGNPKGVQITYNCLVFNLQTGQVFLNQAP
ACSA_OCHA4      TGGKVPGRDLWYEVASVEP-TCDPEPMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYASMTHQYVFDY--
ACS1_ASHGO      SVSYVADRDLDW---DTEVKKYKSYPVDSEHPLFLLYTSGSTGAPKGVQHSTAGYLLQAYLSM-LYSFDV
LCFH_HAEIN      IQLQQDPLSCTWESFNAQQDELTQRLNQKQDLFTIIYTSGTTGEPKGVMLDYANLAHQLETHDLSLNVT-
ACS2_YEAST      GTEGIPGRDYWWHEEAAKQRTYPPVSCDAEDPLFLLYTSGSTGSPKG--VVHTTLLGAALTTRYVFDIHP
ACS1_YEAST      SVAFHAPRDLDWATXXXXXXXXPCTPVDSEDPLFLLYTSGSTGAPKGVQHSTAGYLLGALLTMRTFD--T
ACSL5_HUMAN     EKSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPKGAMITHQNIVSNAAAFLKCVEHAP
ACSA_CUPTR      NVGWTEGRDRWLDDVANQPDTCEAEPVGAEHPLFVLYTSGSTGKPKGVQSTGGYLLWALMTMKWTFDIKP
ACBG1_HUMAN     NVYTM---EEFMELGNEVPEEALDATQQPNQCCVLVYTSGTTGNPKGVMLSQDNITWTARYGSQAGDIRP
S27A2_HUMAN     RTSNTDGIDSFLDKVDEVSTEPESWRSEFSTPALYIYTSGTTGLPKAAMITHQRIWY---GTGLTFVSGL
DLTA_BACWK      -TSEDNLKDIFFTHKGNTPNPEHAVK--GDENFYIIYTSGSTGNPKGVQITYNCLVFNLQTGQVFLNQAP
DLTA_BACC1      -------KDIFFTHKGNTPNPEHAVK--GDENFYIIYTSGSTGNPKGVQITYNCLVFNLQTGQVFLNQAP
DLTA_BACHK      EDNL---KDIFFTHKGNTPNPEHAVK--GDENFYIIYTSGSTGNPKGVQITYNCLVFNLQTGQVFLNQAP
DLTA_BACC3      EDNL---KDIFFTHKGNTPNPEHAVK--GDENFYIIYTSGSTGNPKGVQITYNCLVFNLQTGQVFLNQAP
DLTA_BACC0      EDNL---KDIFFTHKGNTPNPEHAVK--GDENFYIIYTSGSTGNPKGVQITYNCLVFNLQTGQVFLNQAP
DLTA_BACAH      EDNL---KDIFFTHKGNTPNPEHAVK--GDENFYIIYTSGSTGNPKGVQITYNCLVFNLQTGQVFLNQAP
ACSA_PYRAR      DVPMTEGRDFWWNRLQGIPPNIEPEPVESEHPSFILYTSGTTGKPKGIVHDTGGWAVHVYATMKVFDIRD
ENTF_ECO57      CYNA---------PLTPQ-GSAPLQLSQPHHTAYIIFTSGSTGRPKGVMVGQTAIVYPLTGEDVVAQKTP
DLTA_BACCZ      EDNL---KDIFFTHKGNTPNPEHAVK--GDENFYIIYTSGSTGNPKGVQITYNCLVFNLQTGQVFLNQAP
DLTA_BACCQ      -------KDIFFTHKGKTPNPEHAVK--GDENFYIIYTSGSTGNPKGVQITYNCLVFNLQTGQVFLNQAP
DLTA_BACAN      EDNL---KDIFFTHKGNTPNPEHAVK--GDENFYIIYTSGSTGNPKGVQITYNCLVFNLQTGQVFLNQAP
DLTA_BACAC      EDNL---KDIFFTHKGNTPNPEHAVK--GDENFYIIYTSGSTGNPKGVQITYNCLVFNLQTGQVFLNQAP
DLTA_BACAA      EDNL---KDIFFTHKGNTPNPEHAVK--GDENFYIIYTSGSTGNPKGVQITYNCLVFNLQTGQVFLNQAP
ACSA_CRYPV      VKGRDFDGETL---MRSEKPYCPLEDMDSEDPLFYLYTSGSTGTPKGVQSTAGYLLYAAVTQKYLFNIHP
ACS2_ASHGO      EGIPMKAGRDFWEEVRKQRGYLPPVSVNAEDPIFLLYTSGSTGSPKG--VVHTTLLGAALTTRYVFDIHP
ACBG1_RAT       NVYTMEELIELGQEVPEEALDAIIDTQQPNQCCVLVYTSGTTGNPKGVMLSQDNITWTARYGSQAGDIQP
PPSE_BACSU      GTCIISDAQGLMEE-NDIP---INISSSPDDLAYIMYTSGSTGRPKGVMITXXXXXXXXXXXXYTSASGD
DLTA_BACC7      -------KDIFFTHKGKTPNPEHAVK--GDENFYIIYTSGSTGNPKGVQITYNCLVFNLQTGQVFLNQAP
ACBG1_MACFA     NVYTM---EEFMELGNEVPEEALDATQQPNQCCVLVYTSGTTGNPKGVMLSQDNITWTARYGSQAGDIRP
ACSA_BURP8      KIGWDDKRDLWMHEITASESDHCPPEWVGAEHPLILYTSGSTGKPKGVQSTGGYLLWAAQTMKWTFDWKP
ACBG1_MOUSE     NVYTMEELIELGQEVPEEALDAIIDTQQPNQCCVLVYTSGTTGNPKGVMLSQDNITWTARYGSQAGDIQP
S27A5_RAT       HSSPTPGVEALGAALDAAPSDPVPAKLRANSPAIFIYTSGTTGLPKPAILSHERVI---QMSNVLSFCGR
ACSA_RALPJ      NVNWVEGRDRAMDEVEGQPDTCEVTPVSAEHPLFILYTSGSTGKPKGVQSTGGYLLWALLTMQWTFDLKP
ACSA_HERAR      ----------------------------------ILYTSGSTGKPKGVQHSSAGLLWAMLTMKWVFDIKP
AAS_PHOLL       LESTVTLLDKLWILWHLFFPKQAMVAQKPDDDALVLFTSGSDAVSKGVVHSHASLLANVEQIKTITDFNP
LCF2_SCHPO      ---------------------------KADDICCYMYTSGSTGKPKGVVLLHRNIIAALGGINRILSQHI
ACSL5_MOUSE     -----------------------------EDLSVICFTSGTTGDPKGAMLTHENVVSNMAAFLKFLEPIP
ENTF_SHIFL      CYNA---------PLTPQ-GSAPLQLSQPHHTAYIIFTSGSTGRPKGVMVGQTAIVYPLTGEDVVAQKTP
ENTF_ECOLI      CYNA---------PLTPQ-GSAPLQLSQPHHTAYIIFTSGSTGRPKGVMVGQTAIVYPLTGEDVVAQKTP
DLTA_BACCN      TVSQNNLKDIFFTHKGKIPNPEHAVKD--DENFYIIYTSGSTGNPKGVQITHNCLVFNLQTGQVFLNQAP
MENE_SALTY      VA---------W-----QPQRLVSMTL----------TSGSTGLPKAAVHTCQAHLASAQGVLSLMPFGP
ACSA_HUMAN      STSQSPGIDLWWHELMQEAGECEPEWCDAEDPLFILYTSGSTGKPKG--VVHTYMLYVATTFKYVFDF--
S27A5_MOUSE     HSSPTPGVEALGASLDAAPSDPASLRAKWKSPAIFIFTSGTTGLPKPAILSHERVI---QVSNVLSFCGC
ACSL5_RAT       -----------------------------EDLSVICFTSGTTGDPKGAMLTHQNIVSNMAAFLKFLEPIP
MENE_ECOLI      -------------------------------------TSGSTGLPKAA--VHTYQAHLASAQGVLSLIPF
S27A1_BOVIN     TQLLDPLKETSTAPLAQPPGK------GMDDRLFYIYTSGTTGLPKAAIIVHSR--YYRIAAFGHYSYSM
ACSA_BRUSU      MVNKVTGGKVSWGRVASVEPHCEPEPMNAEDPLFILYTSGSTGKPKGVLHTTGGYL---VYASMTHQYVF
ACSA_BRUSI      MVNKVTGGKVSWGRVASVEPHCEPEPMNAEDPLFILYTSGSTGKPKGVLHTTGGYL---VYASMTHQYVF
ACSA_BRUO2      MVNKVTGGKVSWGRVASVEPHCEPEPMNAEDPLFILYTSGSTGKPKGVLHTTGGYL---VYASMTHQYVF
ACSA_BRUME      MVNKVTGGKVSWGRVASVEPHCEPEPMNAEDPLFILYTSGSTGKPKGVLHTTGGYL---VYASMTHQYVF
ACSA_BRUC2      MVNKVTGGKVSWGRVASVEPHCEPEPMNAEDPLFILYTSGSTGKPKGVLHTTGGYL---VYASMTHQYVF
ACSA_BRUAB      MVNKVTGGKVSWGRVASVEPHCEPEPMNAEDPLFILYTSGSTGKPKGVLHTTGGYL---VYASMTHQYVF
ACSA_BRUA2      MVNKVTGGKVSWGRVASVEPHCEPEPMNAEDPLFILYTSGSTGKPKGVLHTTGGYL---VYASMTHQYVF
ACSA_BRUA1      MVNKVTGGKVSWGRVASVEPHCEPEPMNAEDPLFILYTSGSTGKPKGVLHTTGGYL---VYASMTHQYVF
S27A6_HUMAN     KDSVPQGVISLKEKLSTSPDESHHVVSLLKSTCLYIFTSGTTGLPKAAVISQLQVLRG---SAVLWAFGC
ACSA_BURTA      NVDWHAGRDVWMHEIVANESDCEPEWVGAEHPLFILYTSGSTGKPKGVQSTAGYLLWVAQTMKWTFDWKP
S27A4_MACFA     EPNAVPSTEHLDPLLEDAPKHLPSCPDKGTDKLFYIYTSGTTGLPKAAIVVHSR--YYRMAALVYYGFRM
ACSA_BURPS      NVDWHAGRDVWMHEMVANESDAEPEWVGAEHPLFILYTSGSTGKPKGVQSTAGYLLWVAQTMKWTFDWKP
ACSA_BURP6      NVDWHAGRDVWMHEMVANESDAEPEWVGAEHPLFILYTSGSTGKPKGVQSTAGYLLWVAQTMKWTFDWKP
ACSA_BURP1      NVDWHAGRDVWMHEMVANESDAEPEWVGAEHPLFILYTSGSTGKPKGVQSTAGYLLWVAQTMKWTFDWKP
ACSA_BURP0      NVDWHAGRDVWMHEMVANESDAEPEWVGAEHPLFILYTSGSTGKPKGVQSTAGYLLWVAQTMKWTFDWKP
ACSA_BURMS      NVDWHAGRDVWMHEMVANESDAEPEWVGAEHPLFILYTSGSTGKPKGVQSTAGYLLWVAQTMKWTFDWKP
ACSA_BURMA      NVDWHAGRDVWMHEMVANESDAEPEWVGAEHPLFILYTSGSTGKPKGVQSTAGYLLWVAQTMKWTFDWKP
ACSA_BURM9      NVDWHAGRDVWMHEMVANESDAEPEWVGAEHPLFILYTSGSTGKPKGVQSTAGYLLWVAQTMKWTFDWKP
ACSA_BURM7      NVDWHAGRDVWMHEMVANESDAEPEWVGAEHPLFILYTSGSTGKPKGVQSTAGYLLWVAQTMKWTFDWKP
DLTA_BACLD      -----PGVLEGDGVPETDPGRW----VHGEDTFYIIYTSGSTGNPKGVQISADNLQFPVESGQVFLNQAP
S27A4_MOUSE     EPSTVPSTEHLDPLLEDAPKHLPSHPDKGTDKLFYIYTSGTTGLPKAAIVVHSRYYRMASLVYYGFRMRP
ACSA_BRUMB      MVNKVTGGKVSWGRVASVEPHCEPEPMNAEDPLFILYTSGSTGKPKGVLHTTGGYL---VYASMTHQYVF
S27A4_HUMAN     EPGAVPSTEHLDPLLKDAPKHLPSCPDKGTDKLFYIYTSGTTGLPKAAIVVHSR--YYRMAALVYYGFRM
PKSJ_BACSU      TTALL---DQDWDEI-AQTASDRKVLTRTENLAYVIYTSGSTGKPKGVMIPHTNFLVSMGETPGL-----
VRAA_STAAR      ------------------------------------FTSGTTGLPKAYYRDEDSWLASFEVNEMLMLK--
DLTA_STRPC      ---------------------------KGDDNYYIIFTSGTTGQPKGVQISHDNLLTNWMIEDAAFDVPK
DLTA_STRP6      ---------------------------KGDDNYYIIFTSGTTGQPKGVQISHDNLLTNWMIEDAAFDVPK
DLTA_STRP3      ---------------------------KGDDNYYIIFTSGTTGQPKGVQISHDNLLTNWMIEDAAFDVPK
DLTA_STRP1      ---------------------------KGDDNYYIIFTSGTTGQPKGVQISHDNLLTNWMIEDAAFDVPK
DLTA_STRPZ      ---------------------------KGDDNYYIIFTSGTTGQPKGVQISHDNLLTNWMIEDAAFDVPK
DLTA_STRPM      ---------------------------KGDDNYYIIFTSGTTGQPKGVQISHDNLLTNWMIEDAAFDVPK
DLTA_STRPG      ---------------------------KGDDNYYIIFTSGTTGQPKGVQISHDNLLTNWMIEDAAFDVPK
DLTA_STRPF      ---------------------------KGDDNYYIIFTSGTTGQPKGVQISHDNLLTNWMIEDAAFDVPK
DLTA_STRPD      ---------------------------KGDDNYYIIFTSGTTGQPKGVQISHDNLLTNWMIEDAAFDVPK
DLTA_STRP8      ---------------------------KGDDNYYIIFTSGTTGQPKGVQISHDNLLTNWMIEDAAFDVPK
ACSA_MOUSE      VKRPCPGVDLWWHELMQQAGECEPEWCDAEDPLFILYTSGSTGKPKG--VVHTYMLYVATTFKYVFDFHP
MBTB_MYCSS      RVHGVTPATV-----------------EPDRVAYVLFTSGSTGAPKGVEVTHAAAMNTLEFINDHFGIGP
ACBG1_BOVIN     SVYTM---EELMELGNEVPEEALDVAQKPNQCCALVYTSGTTGNPKGVMLSQDNITWTARYGSQAGDIQP
MYCB_BACSU      DASNL------------------NLSYAENHLLYVIYTSGTTGKPKGVQLEHKTML-NLLAYEREYTQLR
ACBG2_CHICK     ----------------------------------LIYTSGTTGQPKGVMLSHDNLTWTSIAASLMLLEAT
VRAA_STAAW      ------------------------------------FTSGTTGLPKAYYRDEDSWLASFEVNEMLMLK--
VRAA_STAAS      ------------------------------------FTSGTTGLPKAYYRDEDSWLASFEVNEMLMLK--
VRAA_STAAN      ------------------------------------FTSGTTGLPKAYYRDEDSWLASFEVNEMLMLK--
VRAA_STAAM      ------------------------------------FTSGTTGLPKAYYRDEDSWLASFEVNEMLMLK--
VRAA_STAAC      ------------------------------------FTSGTTGLPKAYYRDEDSWLASFEVNEMLMLK--
VRAA_STAA1      ------------------------------------FTSGTTGLPKAYYRDEDSWLASFEVNEMLMLK--
S27A3_HUMAN     VDGPVPG--------------YLSSPQSITDTCLYIFTSGTTGLPKAARISHLKIL-----QCQGFYQLC
FAD11_MYCTU     -----------YAAASGDFFDFESTAVQPEDIVTLIYTSGTTGNPKGVEMTHANLLFEGYAIDEVL--GI
ACSA_HELPH      IRNAVRGRDFVYNEMNYQSDKCEPEMMDSEDPLFLLYTSGSTGKPKGVQ--HSNLLWAQMTMEWVFDIR-
VRAA_STAHJ      --------------------KYISEQLKVDDLLHIGFTSGTTGLPKAYYRNEPSWIASYVENEKLIY---
S27A4_PONAB     EPNAVPSTEHLDPLLKDAPKHLPICPDKGTDKLFYIYTSGTTGLPKAAIVVHSRYYRMAALVYYGFRMRP
DLTA_LISMF      TGCPVLTQDQLMDALEKHFGEVKEACVKNDDNYYIIYTSGSTGNPKGVQISQNNLVFSLSQGLRFLNQAP
ACSA_HELPG      IRNAVRGRDFVYNEMNYQSDKCEPEMMDSEDPLFLLYTSGSTGKPKGVQHSSAGLLWAQMTMEWVFDIR-
ACSA_HELP2      IRNAVRGRDFVYNEMNYQSDKCEPEMMDSEDPLFLLYTSGSTGKPKGVQHSSAGLLWAQMTMEWVFDIR-
PKSN_BACSU      TGSHVKAINIELACRNGYTDQQSSGEVKPEHLAYIIYTSGSTGEPKGVMVEHRSIMNTLNFLESHYPVTA
ACSA_HELPY      IRNAVRGRDFVYNEMNYQSDKCEPEMMDSEDPLFLLYTSGSTGKPKGVQHSSAGLLWAQMTMEWVFDIR-
DLTA_LISMO      TGCPVLTQDQLMDALEKHFGEVKEACVNNDDNYYIIYTSGSTGNPKGVQISQNNLVFSLSQGLRFLNQAP
DLTA_LISMC      TGCPVLTQDQLMDALEKHFGEVKEACVKNDDNYYIIYTSGSTGNPKGVQISQNNLVFSLSQGLRFLNQAP
DLTA_STRE4      ---------------------------KGDDNYYIIFTSGTTGQPKGVQISHANLLTNWMIEDAEF--AI
ACBG2_XENLA     ----------------------------------LIYTSGTTGQPKGVMLSHDNITWTAAAATVRLREAT
SID2_USTMA      EMLGTDSRQFKDAVKDGKATV--SVESRSDDVAFIIYTSGSTGKPKGCLLTQANL---AAAVEGFYKEAP
DLTA_LISMH      TGCPVLSQEQLMDALEKHPDKAECVKN--DDNYYIIYTSGSTGNPKGVQISQNNLVFSLRQGLRFLNQAP
DLTA_LISIN      TGCPVLTQDQLMDALEKHPDPAECVKN--DDNYYIIYTSGSTGNPKGVQISQNNLVFSLRQGLRFLNQAP
ACSS3_PONAB     PLA--PGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVRPTGGYAVMLNWSMSSIYGLQP
ACSS3_HUMAN     PLA--PGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVRPTGGYAVMLHWSMSSIYGLQP
DLTA_BACA2      RENWVKELDTFY----------------------IIYTSGSTGNPKGVQISADNLQFPVGEGKTFLNQAP
BGML_DROME      -------------------------RIRANECAMLIFTSGTVGMPKAVMLSHDNLVFDTKSAAAHMQDIQ
ACSA_HELAH      TLIVIRNAKVYNEMVNYQSDKCEPEMMDSEDPLFLLYTSGSTGKPKGVQHSSAGLLWAQMTMEWVFDIR-
ACBG2_MOUSE     ---------------------------KANQCAVILYTSGTTGTPKGVLLSHDNITWTAGAMSQEMERVS
LCF1_SCHPO      DIKTIPNLKLIFADFEKMXXXXXXXXXXXXXICCIMYTSGSTGLPKGVILSHKNMV---AIVTAIVKHVP
S27A5_HUMAN     --------------------------------ALFIYTSGTTGLPKPAILTHERVL---QMSKMLSLSGA
DLTA_STRMU      ---------------------------KGDDTYYIIFTSGTTGKPKGVQISHDNLLTNWMINAEAF---A
S27A1_HUMAN     PEGILPDTHLLDPLLEASTAPLAQIPSKGDDRLFYIYTSGTTGLPKAAIVVHSR--YYRMAAFGHHAYRM
LCF1_YEAST      IKEVRPDIKTFSLKLGKESCNEIDVHPPGDDLCCIMYTSGSTGEPKGVVLKHSNVVAGVGGASLNVLKFV
ANGR_VIBAN      PSNDLFFFLDWQTAIKSEP-----MRSPQDQPAYIIYTSGSTGTPKGVVISHQGALNTCIAINRRYQIGK
ACSA_CHLTE      IVLKVTGEEIXXXXXXXXXXECEPAQVDSEHPLFLLYTSGSTGKPKGILHTTAGYMVHAASSFKYVFDIK
ACSB_DICDI      ----------------------------------ILYTSGTTGMPKGV-VRDTGGYSVALNYSIRNCYGM
MBTM_MYCSS      ------------------------------EFAVLQGTAGSTGIPRTAQLSPEAVLANLRGLVACIDITP
DLTA_LISW6      TDCPVLNAENLVDALEKHFDEKPDPTSKNDDNYYIIYTSGSTGNPKGVQISQNNLVFSLQQGLRFLNQAP
VRAA_STAEQ      ------------------------------NVIHIGFTSGTTGLPKAFYRNEHSWIVSFKENEKLLQHCE
BGM_DROME       -----------------------------NECCCLVYTSGTVGMPKGVMLSHDNITFDVRGIVKAMDRVV
ACSS3_MOUSE     KVPLMSGRDLDWEEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVRPTGGYAVMLNWTMSSIYGLKP
DLTA_BACSU      QDQWVKEHETFY----------------------IIYTSGSTGNPKGVQISAANLQFPVSGGKIFLNQAP
DLTA_LACCB      ----------------------------GDDNYYIIFTSGTTGKPKGVQISHDNLLFGLKEGVVAMSQPP
DLTA_LACC3      ----------------------------GDDNYYIIFTSGTTGKPKGVQISHDNLLFGLKEGVVAMSQPP
ACBG2_RAT       ---------------------------KANQCAVIIYTSGTTGSPKGVMLSHDNITWTAGAMAREIEHVS
FAD26_MYCTU     TTSSVVGDVTKYAASHGQPAQMPAFSRQHTGAAYLQYTSGSTRTPAGVIVSHTNVIANVTQSMYGYDPAK
ACSL3_PONAB     ------------------------------DIAVIMYTSGSTGLPKGVMISHSNII---AGITGMAERIP
ACSL3_HUMAN     ------------------------------DIAVIMYTSGSTGLPKGVMISHSNII---AGITGMAERIP
FCSB_DICDI      -----------------------------DTLSTIMYTSGTTGPPKGVMITHKNLT-SVVCAVSDFIKVY
MBTB_MYCPA      --------------LGGAPADAECARVDPGELAYVLFTSGSTGEPKGVEVTHDAAMNTVEFIGRHFEIGP
DLTA_STRZP      STPMINLAQVQEAFAQGNNYEITHP-VKGDDNYYIIFTSGTTGKPKGVQISHDNLLSFTNWMITDKEFAT
DLTA_STRR6      STPMINLAQVQEAFAQGNNYEITHP-VKGDDNYYIIFTSGTTGKPKGVQISHDNLLSFTNWMITDKEFAT
DLTA_STRPN      STPMINLAQVQEAFAQGNNYEITHP-VKGDDNYYIIFTSGTTGKPKGVQISHDNLLSFTNWMITDKEFAT
DLTA_STRP2      STPMINLAQVQEAFAQGNNYEITHP-VKGDDNYYIIFTSGTTGKPKGVQISHDNLLSFTNWMITDKEFAT
DLTA_LACPL      ------------AAIFATPVDYQADHVSGDDNYYIIFTSGTTGMPKGVQISHDNLVFGLPDQPNSLSQPP
DLTA_STRA3      ---------------------------KGDDNYYIIFTSGTTGLPKGVQISHDNLLFSVPERPQMLAQPP
ACSL3_RAT       ------------------------------DIAVIMYTSGSTGIPKGVMISHSNIIASITGMARRIPRLG
DLTA_STRP7      STPMINLAQVQEAFAQGNNYEITHP-VKGDDNYYIIFTSGTTGQPKGVQISHDNLLSFTNWMITDKEFAT
DLTA_STRA5      ---------------------------KGDDNYYIIFTSGTTGLPKGVQISHDNLLFSVPERPQMLAQPP
DLTA_STRA1      ---------------------------KGDDNYYIIFTSGTTGLPKGVQISHDNLLFSVPERPQMLAQPP
ACSL4_HUMAN     EIHSMQSVEELGS--NPENLGIPPSRPTPSDMAIVMYTSGSTGRPKGVMMHHSNLIAGMTGQC---ERIP
ACSA_STRAW      EVAWTEGRDVWWHEITAQSAEHTPEAFDAEHPLFILYTSGTTGKPKG--ILHTSLTQTSYTHHAVFDLKP
Y3568_PSEAE     PARLHPGRDLDWQDCLAAAEPADPLPVASGDPLYIMYTSGTTGKPKGIVRDNGGHAV-AVRYAVRTIYGM
ACSS3_BOVIN     PLA--PGYYLDWDEELSKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVRPTGGYAVMLNWSMSSIYGLKP
ACSA_WOLSU      EINYVPGRDYIYNEMIGESAHCPPEPMDAEDPLFLLYTSGSTGKPKGVQHNQAGILWAQTTMEWVFDVK-
VRAA_STAES      ------------------------------NVIHIGFTSGTTGLPKAFYRNEHSWIVSFKENEKLLQHCE
LCF4_YEAST      -----------------------------EDPACIMYTSGSTGTPKGVVLTHYNIVIGGVGHNVIGWIGP
DLTA_STRZT      STPMINLAQVQEAFAQGNNYEITHP-VKGDDNYYIIFTSGTTGKPKGVQISHDNLLSFTNWMITDKEFAT
DLTA_STRPJ      STPMINLAQVQEAFAQGNNYEITHP-VKGDDNYYIIFTSGTTGKPKGVQISHDNLLSFTNWMITDKEFAT
S27A1_MOUSE     TQLLDPMAEAPTTPLAQAPGKGM------DDRLFYIYTSGTTGLPKAAIVVHSR--YYRIAAFGHHSYSM
ACSL4_RAT       EIHSMQSVEEL-----GSKPENSSIRPTPSDMAIVMYTSGSTGRPKGVMMHHSNLIAGMTGQC---ERIP
ACSA_CAMJ8      PIEYIKGRDYVYNELKNESYKCEPEIMDSEDLLFLLYTSGSTGKPKGVMHASAGILWAQMTMEWVFDIK-
ACSA_CAMJJ      PIEYIKGRDYVYNELKNESYKCEPEIMDSEDLLFLLYTSGSTGKPKGVMHASAGILWAQMTMEWVFDIK-
ACSA_CAMJE      PIEYIKGRDYVYNELKNESYKCEPEIMDSEDLLFLLYTSGSTGKPKGVMHASAGILWAQMTMEWVFDIK-
ACSL4_MOUSE     EIHSMQSVEELGAKLSVPPS-----RPTPSDMAIVMYTSGSTGRPKGLMMHHTNLIAGMTGQC---ERIP
DLTA_STAXY      ---------------DNRTVEFES-KIKDQDIAYTIFTSGSTGEPKGVQIRYESLLNKIGENQQWLNQAP
S27A1_RAT       TQLLDPMAEAPTTPLAQAPGKGM------DDRLFYIYTSGTTGLPKAAIVVHSR--YYRIAAFGHHSYSM
ACSL3_MOUSE     ------------------------------DIAVIMYTSGSTGIPKGVMISHSNIIASITGMARRIPRLG
SIB1_SCHPO      VTASDPG---------NYSNNIENPYTEDSNLAYVLYTSGSTGKPKGCCLTHHNVVQCMLAFQDQFAGEW
DLTA_LACRH      ----------------------------GDDNYYIIFTSGTTGKPKGVQISHDNLLFGLEEGVVAMSQPP
MBTB_MYCTU      --------------------EFVPGPSDPTALAYVLFTSGSTGEPKGVEVAHDAAMNTVETFIRHFELGA
MBTB_MYCBO      --------------------EFVPGPSDPTALAYVLFTSGSTGEPKGVEVAHDAAMNTVETFIRHFELGA
FAT1_YEAST      KLNYLEEQDLMHELLNSQSPEFDNVRTPDFKPSMLIYTSGTTGLPKSAIMSWRKSSVGCQVFGHVLHMTN
HMWP2_YERE8     T----------------QP-------------AYIIYTSGSTGTPKGVVISHRGALNTCCDINTRYQVGP
DLTA_STAES      -----------------------------NDVVYTIFTSGSTGEPKGVQIEYASLLNKTGTGKEWLNQAP
ACBG2_HUMAN     ---------------------------KANQCAVLIYTSGTTGIPKGVMLSHDNITWIAGAVTKDF-KLT
MENE_HAEIN      --------------------------------ATMTLTSGSTGLPKAVVHNVQAHLDNAKGVCNLMKF--
FAT1_COCHE      ---------------------------ELDSVRGLIYTSGTTGLPKGVFISTGRELRTDWSISKYLNLKP
LCF2_YEAST      -----------------------------DSLYTISFTSGTTGLPKGVEMSHRNIASGIAFAFSTFRIPP
ACSM6_HUMAN     SDKSYDGWLDFKKLIQVAPPKQTYMRTKSQDPMAIFFTKGTTGAPKMVEYSQYGLMGFSQASRRWMDLQP
DLTA_STAAB      -------------SLEGEVFTIEDIKTSQDDTVYTIFTSGSTGEPKGVQIEYASLLNKSGNEQQWLNQAP
PABL_STRGR      GTETVTEMLERWSGEDPLP-----VEVRPDSPFLLLPSSGTTARPKICLHSHEGLLTNSRAATE--DTAD
LCF3_YEAST      ---------------------------EPKDLACIMYTSGSISAPKGVVLTHYNIVSGIAGVGHNVFGWI
DLTA_STAAW      -------------SLEGEVFTIEDIKTSQDDTVYTIFTSGSTGEPKGVQIEYASLLNKSGNEQQWLNQAP
DLTA_STAAU      -------------SLEGEVFTIEDIKTSQDDTVYTIFTSGSTGEPKGVQIEYASLLNKSGNKQQWLNQAP
DLTA_STAAT      -------------SLEGEVFTIEDIKTSQDDTVYTIFTSGSTGEPKGVQIEYASLLNKSGNEQQWLNQAP
DLTA_STAAS      -------------SLEGEVFTIEDIKTSQDDTVYTIFTSGSTGEPKGVQIEYASLLNKSGNEQQWLNQAP
DLTA_STAAN      -------------SLEGEVFTIEDIKTSQDDTVYTIFTSGSTGEPKGVQIEYASLLNKSGNKQQWLNQAP
DLTA_STAAM      -------------SLEGEVFTIEDIKTSQDDTVYTIFTSGSTGEPKGVQIEYASLLNKSGNKQQWLNQAP
DLTA_STAAE      -------------SLEGEVFTIEDIKTSQDDTVYTIFTSGSTGEPKGVQIEYASLLNKSGNEQQWLNQAP
DLTA_STAAC      -------------SLEGEVFTIEDIKTSQDDTVYTIFTSGSTGEPKGVQIEYASLLNKSGNEQQWLNQAP
DLTA_STAA9      -------------SLEGEVFTIEDIKTSQDDTVYTIFTSGSTGEPKGVQIEYASLLNKSGNKQQWLNQAP
DLTA_STAA8      -------------SLEGEVFTIEDIKTSQDDTVYTIFTSGSTGEPKGVQIEYASLLNKSGNEQQWLNQAP
DLTA_STAA3      -------------SLEGEVFTIEDIKTSQDDTVYTIFTSGSTGEPKGVQIEYASLLNKSGNEQQWLNQAP
DLTA_STAA2      -------------SLEGEVFTIEDIKTSQDDTVYTIFTSGSTGEPKGVQIEYASLLNKSGNKQQWLNQAP
DLTA_STAA1      -------------SLEGEVFTIEDIKTSQDDTVYTIFTSGSTGEPKGVQIEYASLLNKSGNKQQWLNQAP
DLTA_LACLA      -----------------------SKAVSGNDSNYIIYTSGTTGVPKGVEVSHDNLVFMKIENNQILSQAL
LYS2_CANGA      DNGTVEGG-----SLPSESGELKSTRTGPDSNPTLSFTSGSEGIPKGVLGRHFSLAYYFSWMAKQFNLS-
MBTM_MYCPA      --------------------------------AILQGTAGSTGTPKTAALSPDAVLANLRGLNARLGVTP
LYS2_YEAST      ENGTIEGGEDVLAPYDHYKDTRTGVVVGPDSNPTLSFTSGSEGIPKGVLGRHFSLAYYFNWMSKRFNLT-
DLTA_STAAR      ------------------PVIFDS-QIKDNDTVYTIFTSGSTGEPKGVQIEYASLLNKSGNEQQWLNQAP
DLTA_STAEQ      -----------------------------NDVVYTIFTSGSTGEPKGVQIEYASLLNKTGTGKEWLNQAP
FAD28_MYCBO     TFK----------------------EDEYPSTAYLQYTSGSTRTPAGVVMSHQNVRVNEQLMSGYFDGIP
DLTA_STAHJ      T-----------------------------DVVYTIFTSGSTGEPKGVQIEYASLLNESEGSQEWLNQAP
ACSF4_MOUSE     -------------------------------LAYVLHTSGTTGTPKIVRVPHACILPNIQHFRSLFDITQ
ESYN_FUSEQ      -----------------------SASVKAHDLAYVIFTSGSTGIPKGIMIEHRSFSSCAIKFGPALGITS
ORA_PLAFN       ---------------NMTENKIANVTVQNEDIASIVYTSGTSGKPKGVMLSNRNL-YNGVIPPCIIKKYP
HTS1_COCCA      -TKDIP---------HGLSDTVVQSNTKIDDPAFGLFTSGSTGVPKCIVVTHSQICTAVQAYKDRFGVTS
ACSA_NOSLI      NVAMQEGRDHWWAACDNQPKTSTPEPMGAEDPLFILYTSGSTGKPKGVHTTGGYLVWASFTHQNVFDYR-
ACSF4_DANRE     ---------------------------QGEPLAYILHTSGTTGLPKIVKVPHRCIVPNIIHLRSVFKMTP
FAD21_MYCLE     DTDTVPAILEVDSPNLDVENKSNIRLTDAPSTAYLQYTSGSTRLPAGVMVTHRNLMVNFQQLMAYFAPTN
MBTM_MYCTU      ------------------------VASEGP--AVLQGTAGSTGAPRGAVLSNLRGLNQRVGTDA------
MBTM_MYCBO      ------------------------VASEGP--AVLQGTAGSTGAPRGAVLSNLRGLNQRVGTDA------
LYS2_PENCH      XXXSINGQDVFAVALKSKP---TGVVVGPDSIPTLSFTSGSEGRPKGVRGRHFSLAYYFPWMSETFKLTP
LYS2_ASHGO      TDGAILGGTLPDFHLDTLV-PFASLKNTRTDVVVLSFTSGSEGIPKGVLGRHFSLTYYFDWMAKRFGLSE
ESYN_GIBPU      -------------------------RPSATSLAYVVFTSGSTGKPKGVMIEH-----RAIVRLVKSDNFP
LYS2_SCHPO      LTSVSKGADDILQHVLHLKSEQTGVVVGPDSTPTLSFTSGSEGIPKGVKGRHFSLAYYFDWMAQEFNLS-
FAD25_MYCTU     NAPAV--IEVDRLDLDARPSSGSRSAAHGHDILYLQYTSGSTRTPAGVMVSNKNLFFEQIMTSGVYGKVA
FAD21_MYCTU     TNNVGPIIEIDSLDLTGNSPSFRV--KDLPSAAYLQYTSGSTRAPAGVMISHRNLQFQQLMSNYFGDRPP
FAD21_MYCBO     TNNVGPIIEIDSLDLTGNSPSFRV--KDLPSAAYLQYTSGSTRAPAGVMISHRNLQFQQLMSNYFGDRPP
ACSF4_HUMAN     -------------------------------LAYVLHTSGTTGIPKIVRVPHKCIVPNIQHFRVLFDITQ
LYS2_CANAL      LEGADNDCLNDYQKFKDQPA---GVIVGPDSRPTLSFTSGSEGIPKGVLGRHYSLAYYFPWMAKRFRLS-
PCL_HALHA       ----------------------------------------------------------------------
DIP2A_HUMAN     EVAAFKGPPLSWLVIDGKPKDWHPLAQDGTGTAYIEYKTSKEGSTVGVTVSHASLL--------------
PCL_RHOS4       ----------------------------------------------------------------------
PATJ_DROME      ----------------------------------------------------------------------
DIP2A_MOUSE     ----------------------------------------------------------------------
YAC2_METSO      ----------------------------------------------------------------------
DIP2B_MOUSE     ----------------------------------------------------------------------
DIP2C_HUMAN     ----------------------------------------------------------------------
DIP2B_HUMAN     ----------------------------------------------------------------------
DIP2B_DANRE     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQG
LCFB_BACSU      DERDNVVCALPMFHVFCLTVCMNAPLMSGATVLIEPQFSPASVFKLVKQQQATIFAGVPTMYNYLF--QH
LCFA_BACSU      EGAEKVLGIVPFFHVYGLTAVMNYSIKLGFEMILLPKFDPLETLKIIDKHKPTLFPGAPTIYIGLLHHPE
LCFA_ECO57      LLHELVVTALPLYHIFALTILLFIELGGQNLLITNPR-DIPGLVKELAKYPFTAITGVNTLFNALLN---
LCFA_ECOLI      LLHELVVTALPLYHIFALTILLFIELGGQNLLITNPR-DIPGLVKELAKYPFTAITGVNTLFNALLN---
LCFA_ECOL6      LLHELVVTALPLYHIFALTILLFIELGGQNLLITNPR-DIPGLVKELAKYPFTAITGVNTLFNALLN---
LCFA_SALTY      LLHELVVTALPLYHIFALT--MNCLLFGQNLLITNPR-DIPGLVKELAKYPFTAMTGVNTLFNALLN---
LCFA_SALTI      LLHELVVTALPLYHIFALT--MNCLLFGQNLLITNPR-DIPGLVKELAKYPFTAMTGVNTLFNALLN---
LCFA_YERPE      PGRDLVVTALPLYHIFALTVLLFIELGGRSLLITNPR-DIPGMVKELSRYPFTAITGVNTLFNALLNNEE
LCFA_HAEIN      GDHSSAILALPLYHVFALTVNCLLFLELGVTAILIPR-DIEGFVKELKKYRFEAITGVNTLFNALLN---
CAIC_SALAR      REDDVYLTVMPAFHIDCQCTAAMAAFSVGATFVLIEKYSARAFWGQVRKYCATVTECIPMMIRTLMTAAD
ACSF2_RAT       KTAEELRMVLPLYHCLGSVTMVSVV---HGATLLLPSFNGKKALEAISREKGTLLYGTPTMFVDILN-QP
CAIC_CITK8      REDDVYLTVMPAFHIDCQCTAAMAAFSAGSTFVLIEKYSARAFWGQVRKYRATVTECIPMMIRTLMPEER
CAIC_ECOSM      RDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATITECIPMMIRTLMNDQ-
CAIC_ECO27      RDDDVYLTVMPAFHIDCQCTAAMAAFSTGATFVLVEKYSARAFWGQVQKYRATITECIPMMIRTLMNDQ-
CAIC_ECOUT      RDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATITECIPMMIRTLMVQDR
CAIC_ECOK1      RDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATITECIPMMIRTLMVQDR
CAIC_ECO81      RDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATITECIPMMIRTLMNDQ-
CAIC_ECO45      RDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATITECIPMMIRTLMVQDR
4CL2_SOLTU      HSDDVLMCVLPLFHIYSLNSVLLCALRVGAAILIMQKFDIAQFLELIPKHKVTIGPFVPPIVLAIAKSPL
ACSF2_MOUSE     KTAEELRLVLPLYHCLGSVGGTMVSMMHGATLLLSPSFNGKKALEAISREKGTLLYGTPTMFVDILN-QP
CAIC_SHIFL      RDDDVYMTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQAQKYRATITECIPMMIRTLMVQDR
CAIC_ECO7I      RDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATITECIPMMIRTLMNDQ-
CAIC_ECO5E      RDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATITECIPMMIRTLMVQDR
CAIC_ECO57      RDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATITECIPMMIRTLMVQDR
CAIC_ECOLC      RDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATVTECIPMMIRTLMNDQ-
CAIC_ECOL6      RDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATITECIPMMIRTLMNDQ-
CAIC_ECOL5      RDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATITECIPMMIRTLMNDQ-
CAIC_ECO55      RDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATITECIPMMIRTLMVQDR
4CL1_SOLTU      HSDDVLMCVLPLFHIYSLNSVLLCALRVGAAILIMQKFDIAQFLELIPKHKVTIGPFVPPIVLAIAKSPD
CAIC_ECO8A      RDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATITECIPMMIRTLMVQDR
CAIC_ECOHS      RDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATITECIPMMIRTLMVQDR
CAIC_ESCF3      RDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATVTECIPMMIRTLMVQDR
CAIC_ECO24      RDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQAQKYRATITECIPMMIRTLMVQDR
CAIC_ECOSE      RDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATITECIPMMIRTLMVQDR
CAIC_ECOLU      RDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATITECIPMMIRTLMVQDR
CAIC_SHISS      RDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATVTECIPMMIRTLMAQDR
CAIC_ECOLI      RDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATVTECIPMMIRTLMNDQ-
CAIC_ECODH      RDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATVTECIPMMIRTLMNDQ-
CAIC_ECOBW      RDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATVTECIPMMIRTLMNDQ-
CAIC_SALPK      RDDDVYMTVMPAFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWGQVRKYQATVTECIPMMIRTLMPTDR
CAIC_SALPA      RDDDVYMTVMPAFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWGQVRKYQATVTECIPMMIRTLMPTDR
ACSF2_MACFA     EQLRMILPS-PLYHCLGSVGGTMMCLMYGATLILAPVFNGKKALEAISRERGSFLYGTPTMFVDILN-QP
CAIC_SALNS      RDDDVYMTVMPAFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTLMPTDR
CAIC_PROMH      REDDIYLTVMPAFHIDCQCTASLPAFSVGATFVLLEKYSARAFWKQILKYQATVTECIPMMMRTLMAQPV
ACSF2_PONAB     EQLRMILPS-PLYHCLGSVGGTMMCLMYGATLILAPVFNGKKALEAISRERGSFLYGTPTMFVDILN-QP
4CL1_TOBAC      HSEDVLMCVLPLFHIYSLNSILLCGLRVGAAILIMQKFDIAPFLELIQKYKVSIGPFVPPIVLAIAKSPD
CAIC_SALSV      RDDDVYMTVMPAFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTLMPTDR
CAIC_SALDC      RDDDVYMTVMPAFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTLMPTDR
CAIC_SHIDS      RDDEVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRATITECIPMIIRTLMVQDR
CAIC_SALTI      RDDDVYMTVMPAFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTLMPTDR
CAIC_SALPC      RDDDVYMTVMPAFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRRYQATVTECIPMMIRTLMPTDR
CAIC_SALPB      RDDDVYMTVMPAFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTLMPTDR
CAIC_SALEP      RDDDVYMTVMPAFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTLMPTDR
CAIC_SALCH      RDDDVYMTVMPAFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRRYQATVTECIPMMIRTLMPTDR
CAIC_SALTY      RDDDVYMTVMPAFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTLMPTDR
CAIC_SALHS      RDDDVYMTVMPAFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTLMPTDR
CAIC_SALA4      RDDDVYMTVMPAFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTLMPTDR
ACSF2_HUMAN     EQLRMILPN-PLYHCLGSVAGTMMCLMYGATLILAPIFNGKKALEAISRERGTFLYGTPTMFVDILN-QP
YDAB_BACSU      GLR--FLACHPIYHTSALICIM-LGTFAETTFVFTKDQDPVHMLKVIEEEKIQTVMALPVFYTYLLEAWE
CAIC_PROSL      REDDIYLTVMPAFHIDCQCTASLPAYSVGATIVLLEKYSARASWKQILKYQATVTECIPMMMRTSMAQPV
MENE_BACLD      QEHDRWLIALPLFHISGLSALFKSVIYGM-TVVLHQRFDAEEVLRSIKDQQVTIASVVQTML-SRLAAKV
ACSF2_BOVIN     EESRVVLPS-PLYHCLGSVGGTMVSLMHGVTLILCPVFEGKKTLEAISRERGCFLYGTPTMFVDVLN-QP
4CLL6_ARATH     GSSNVYLAALPLCHIYGLSLFVMGLLSLGSTIVVMKRFDASDVVNVIERFKITHFPVVPPMLMALTK-KA
4CL2_TOBAC      NSEDVMLCVLPLFHIYSLNSVLLCGLRVGAAILIMQKFDIVSFLELIQRYKVTIGPFVPPIVLAIAKSPD
MENE_BACP2      D--DRWLIALPLFHISGLSALFKSVIYGM-TVVLHQKFDVDEVIGSIEQHRVTMISVVQTMLSRLLSR--
MENE_GEOSW      NENDCWLAAVPFFHISGLSIMMRSVIYGM-SMYVMRAFDAKKANELIIGGKVTIMSVVSAMLQKMIADLG
4CLL5_ARATH     DGEQRFICTVPMFHIYGLAAFATGLLAYGSTIIVLSKFEMHEMMSAIGKYQATSLPLVPPILVAMVNGAD
4CL_VANPL       NSDDVLLCVLPLFHIYSLNSVLLCGLRAGSGILIMQKFEIVPFLELIQKYKVTIGPFVPPIVLAIAKSTD
FADK_ECOLI      -WQDVFMMPAPLGHATGFLHGVTAPFLIGARSVLLDIFTPDACLALLEQQRCTCMLGATPFVYDLLNVLE
4CL2_PETCR      HSEDVMICILPLFHIYSLNAVLCCGLRAGVTILIMQKFDIVPFLELIQKYKVTIGPFVPPIVLAI--AKS
4CL1_PETCR      HSEDVMICILPLFHIYSLNAVLCCGLRAGVTILIMQKFDIVPFLELIQKYKVTIGPFVPPIVLAI--AKS
4CLL1_ORYSJ     EGPNVFLCFLPMFHIFGLSVITYAQLHRGNAIIAMSRFDINSLMEAVQRHRVTHLFCVPPVIIALAKKAG
ACSF2_DANRE     RKNVRICLPVPLYHCFGSVGG-GVIMALYGTTVIFPSYDGRANLRAIEKEKCTFVYGTPTMYIDML---G
MENE_GEOKA      HERDCWLAAVPLFHISGLSIAMRSVIYGM-PMRLQTSFDPKEANEWIMRGDVTIMSVVAAMLQRMVAELG
CAIC_SHIF8      RDDDVYMTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQAQKYRATITECIPMMIRTLMVQDR
4CLL2_ARATH     RT----ICTIPMCHIFGFGGFATGLIALGWTIVVLPKFDMAKLLSAVETHRSSYLSLVPPIVVAMVNGAN
4CLL3_ARATH     KRDEIFVCTVPMFHSFGLLAFAMGSVASGSTVVILRRFGLDDMMQAVEKYKATILSLAPPVLVAMINGAD
4CL2_DICDI      KKNDTVMGQLPFFHIYGLMTYLILMVKQGHCVVILPKFEFVRFLDLIQKYKVAISFIVPPI--AIMFAKS
4CLL8_ARATH     QQ--TFICTVPLFHTFGLLNFVLATLALGTTVVILPRFDLGEMMAAVEKYRATTLILVPPVLVTMINKAD
4CLL7_ARATH     EYHGVFLCFLPMFHVFGLAVITYSQLQRGNALVSMARFELELVLKNIEKFRVTHLWVVPPVFLALSKQSK
4CL1_DICDI      KKNDTVMGILPFFHIYGLMLFLMLMVKQGHRVVVLPKFEPVRFLELIQKYKVAISFIVPPV--AIMFAKS
MENE_BACC7      D--DCWLACMPMFHVGGLSLLMKNIMYGM-RILLVPKYDADFIHKALQTRGVTIISVVSKMLTDLLERLG
4CLL4_ORYSJ     DKTETFLCTVPMFHVYGLVAFATGLLGCGATVVVLSKYELPEMLRSINAYGVTYLPLVPPILVAMVAHPK
4CLL4_ARATH     KRDDIFICTVPMFHTYGLLTFAMGTVALGSTVVILRRFQLHDMMDAVEKHRATXXXXXXXXXXXMINDAD
FAT2_SCHPO      DPRDTSYVVMPLFHVHGLLCGLLSTLASGGCAVVPPKFSAHSFWKEFIQYGATWYTAVPTIH----QXXX
3HBCL_THAAR     G--DRVFTTSKMFFGWSLGHSLMGGLQCGATVIVAPGWDAERVMATAARHRPTILFSTPVMYRNLLR-EG
4CL2_ARATH      NLYDVILCVLPMFHIYALNSIMLCSLRVGATILIMPKFEITLLLEQIQRCKVTVAMVVPPIVLAI--AKS
MENE_BACSU      TEQDRWLIALPLFHISGLSALFKSVIYGM-TVVLHQRFSVSDVLHSINRHEVTMISAVQTMLASLLE---
ALKK_PSEOL      SARDTILPVVPMFHVNAWGTPYSAAMVGAKLVLPGPALDGASLSKLIASEGVSIALGVPVVWQGLLAAQA
MENE_BACC0      D--DCWLACMPMFHVGGLSLLMKNIMYGM-RILLVPKYDADFIHKALQTRGVTIISVVSKMLTDLLERLG
4CL3_DICDI      KKNDSVIGVLPFFHSFGLMLHIMLMVKQGYRIVTLPKFEPVRFLELIKKYKVAMSFIVPPI--AIMFAKS
4CL2_ORYSJ      NLHDVALCVLPLFHIFSLNSVLLCAVRAGAAVALMPRFEMGAMLGAIERWRVTXXXXXXXXXXXXXKNPE
MENE_BACCZ      RDDDCWLACMPMFHVGGLSLLMKNIMYGM-RILLVPKYDADFIHKALQTRGVTIISVVSKMLTDLLERLG
MENE_BACHK      D--DCWLACMPMFHVGGLSLLMKNIMYGM-RILLVPKYDADFIHKALQTRGVTIISVVSKMLTDLLERLG
MENE_BACAN      D--DCWLACMPMFHVGGLSLLMKNIMYGM-RILLVPKYDADFIHKALQTRGVTIISVVSKMLTDLLERLG
MENE_BACAH      D--DCWLACMPMFHVGGLSLLMKNIMYGM-RILLVPKYDADFIHKALQTRGVTIISVVSKMLTDLLERLG
MENE_BACAC      D--DCWLACMPMFHVGGLSLLMKNIMYGM-RILLVPKYDADFIHKALQTRGVTIISVVSKMLTDLLERLG
MENE_BACAA      D--DCWLACMPMFHVGGLSLLMKNIMYGM-RILLVPKYDADFIHKALQTRGVTIISVVSKMLTDLLERLG
MENE_BACCQ      D--DCWLACMPMFHVGGLSLLMKNIMYGM-RILLVPKYDADFIHKALQTRGVTIISVVSKMLTDLLERLG
MENE_BACC1      D--DCWLACMPMFHVGGLSLLMKNIMYGM-RILLVPKYDADFIHKALQTRGVTIISVVSKMLTDLLERLG
ACSM2_MOUSE     TS-DIIWTIMNILGAFLEPWVLGACIFVH----LLPKFDSQTVLKVLSSYPINTLVGAPIIYRMLLQ---
4CL1_ARATH      NSDDVILCVLPMFHIYALNSIMLCGLRVGAAILIMPKFEINLLLELIQRCKVTVAPMVPPIVLAI--AKS
MENE_BACWK      D--DCWLACMPMFHVGGLSLLMKNIMYGM-RILLVPKYDANFIHKALQTRGVTIISVVSKMLTDLLERLG
4CLL9_ARATH     VNYDVGLFSLPLFHVFG-FMMMIRAISLGETLVLLGRFELEAMFKAVEKYKVTGMPVSPPLIVALVKSEL
MENE_BACCR      D--DCWLACMPMFHVGGLSLLMKNIMYGM-RILLVPKYDADFIHKALQTRGVTIISVVSKMLTDLLERLG
MENE_LISMO      TEKDSWLCAVPIFHISGLSIMMRSVIYGI-PVYLEEHFDEEKITQLLESGKVSTISVVTSMLERLLKIHG
4CL3_ARATH      KSNDVILCVLPLFHIYXXXXXXXXXXXXGATVLLMHKFEIGALLDLIQRHRVTXXXXXXXXXXXXXKTVN
ACSM3_MOUSE     NTSDTGWAKSAWSSVFSPWTQ-GACVFAH----YLPRFESTSILQTLSKFPITVFCSAPTAYRMLV--QN
BCLA_THAAR      EG-DVVFSAAKLFFAYGLGNGLIFPLAVGATAVLMAERPTPAAVERLRRHQPDIFYGVPTLYASML-ANP
MENE_OCEIH      HDNDKWLIPLPLFHVSGLSTMLKSVIYGMPIYVL-EKFEVEKVHNAIMDRKXXXXXXXXXXXQRLIKRLG
MENE_BACCN      D--DCWLACMPMFHVGGLSLLMKNIMYGM-RVLLVPKYDPDFIHQAIQTKGVTIISVVAKMLTDLLERLG
MENE_LISMF      TEKDSWLCAVPIFHISGLSIMMRSVIYGI-PVYLEEHFDEEKITQLLESGKISTISVVTSMLERLLKIHS
ACSM3_RAT       NTSDTGWAKSAWSSVFSPWTQ-GACVFAH----YLPRFDSTSILQTLSKFPITVFCSAPTAYRMLI--QN
LUCI_LUCMI      SPGTAILTVVPFHHGFGMFTTLGACGYR---VVMLTKFDEELFLRTLQDYKCTSVILVPTLF-AILNKSE
ACSM2_RAT       S--DTMWTILNILGSFLEPWVLGTCIFVH----LLPKFDPQTVLKVLSSYPINTLLGAPLIYRMLLQ---
4CLL6_ORYSJ     DAGKVTLFPLPLFHVMG-FGLLTRTISSGETAVVMXXXXXXXXXXXXXXXXVTKLSAAPPVVVAL--TKS
ACSM5_MOUSE     ES-DIFWNTTDTGWVKAAWTLFSA--WSNGACIFLPRVDAKTILNTLCRFPITTLCCVPTLFRLLVQ---
4CLL9_ORYSJ     ETAGVTLGLMPFFHIYGITGICCATLRHKGTVVVMDRFDLRTFLRALVDHRVMFAPLVPPVMLAMVKSPV
FAT2_YEAST      --LDRSYVVMPLFHVHGLIGVLLSTFRTQGSVVVPDGFHPKLFWDQFVKYNCNWFSCVPTISMIMLNMPK
ACSF3_MOUSE     TKNDVIXXXXXXXXXXXXXNKLLCPLWVGATCVMLPEFSAQEKFLSSEAPQITVFMAVPTVYSKLLDYYD
LUCI_PHOPY      IPDTAILSVVPFHHGFGMFTTLGYLICGF-RVVLMYRFEEELFLRSLQDYKIQSALLVPTLF--SFFAKS
4CL1_ORYSJ      NAGDVILCALPMFHIYSLNTIMMCGLRVGAAIVVMRRFDLAAMMDLVERHRXXXXXXXXXXXXXXXXXXX
ACSM4_RAT       DTGWIKAAIGSVF----STWLRGACVFVHR----MAQFNTDTFLDTLTSYPITTLCSAPTVYRMLVQ---
4CL2_SOYBN      NTEDVLLCVLPLFHIFSLNSVLLCALRAGSAVLLMQKFEIGTLLELIQRHRXXXXXXXXXXXXXXXKNPA
ACSF3_BOVIN     TKDDVIXXXXXXXXXXXXXNKLLCPLWVGATCVMLPEFSAQEKFLSSEAPQINVFMAVPTIYSKLMDYYD
4CL4_ORYSJ      NLYDVVLCLLPLFHIYSLNSVLLAGLRAGSAIVIMRKFDLGALVDLTRRHGVTVAPFVPPIVVEI--AKS
4CL5_ORYSJ      NLHDVVLCVLPMFHVYSLHSILLCGMRAGAAIVVMKRFDTVKMLQLVERHGVTIAPLVPPIVVEMADALD
MENE_LISIN      TEKDSWLCAVPIFHISGLSIMMRSVIYGI-PVYLEEHFDEEKITQLLESGKISTISVVTSMLERLLKIQG
ACSM5_RAT       ES-DIFWNTTDTGWVKAAWTLFSA--WANGACVFLPQVDAQTILNTLCRFPITTICCVPTLFRLLVQ---
4CL4_ARATH      NANDVILCFLPMFHIYALDALMLSAMRTGAALLIVPRFELNLVMELIQRYKXXXXXXXXXXXLAFIKSPE
LUCI_LUCCR      SPGTAVLTVVPFHHGFGMFTTLGYLICGF-RVVMLTKFDEETFLKTLQDYKCTSVILVPTLF-AILNKSE
LUCI_LUCLA      SPGTAILTVVPFHHGFGMFTTLGY-LTCGFRIVMLTKFDEETFLKTLQDYKCSSVILVPTLF-AILNRSE
ACSM3_HUMAN     NTSDTGWAKSAWSSVFSPW-IQGACVFTHH----LPRFEPTSILQTLSKYPITVFCSAPTVYRMLVQ---
ACSM5_HUMAN     ES-DIFWNTTDTGWVKAAWTLFSA--WPNGSCIFLPRVDAKVILNTLSKFPITTLCCVPTIF--RLLVQE
4HBCL_RHOPA     D--DVVFSAAKLFFAYGLGNAMFCPMGIGATSVLYPRPTADSVFDTLRLHQPTLLFAVPTLYAAML-ADP
4CL_PINTA       NSDDVILCVLPLFHIYSLNSVLLCALRAGAATLIMQKFNLTTCLELIQKYKVTVAPIVPPIVLDITKSPS
MENE_STAAW      DTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQILTIIKNERITHISLVPTLNW--LMQQG
MENE_STAAS      DTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQILTIIKNERITHISLVPTLNW--LMQQG
LUCI_PHOPE      NPTTAILTVIPFHHGFGMTTTLG--YFTCGFRVLMHTFEEKLFLQSLQDYKVESTLLVPTLFFPKSALVE
4CL3_ORYSJ      NLYDVILCLLPLFHIYSLNSVLLAGLRAGSTIVIMRKFDLGALVDLVRKHNITIAPFVPPIVVEI--AKS
ACSM3_PONAB     NTSDTGWAKSAWSSVFSPW-IQGACVFTHH----LPRFEPTSILQTLSKYPITVFCSAPTVYRMLVNDMA
ACS2B_HUMAN     QASDIMWTISDILNILGESWTLGACTFVH----LLPKFDPLVILKTLSSYPIKSMMGAPIVYRMLLQ---
MENE_STAAB      DTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQILTMIKNERITHISLVPTLNW--LMQQG
MENE_BACA2      TERDRWLIALPLFHISGLSALFKSVIYGM-PVVLHQKFSVTDVLDSISSHQVTIISAVQTMLSGLLA---
MENE_STAAN      DTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQILTMIKNERITHISLVPTLNW--LMQQG
MENE_STAAM      DTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQILTMIKNERITHISLVPTLNW--LMQQG
MENE_STAA9      DTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQILTMIKNERITHISLVPTLNW--LMQQG
MENE_STAA2      DTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQILTMIKNERITHISLVPTLNW--LMQQG
MENE_STAA1      DTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQILTMIKNERITHISLVPTLNW--LMQQG
ACS2A_HUMAN     QASDIMWTILNILCSLMEPWALGACTFVH----LLPKFDPLVILKTLSSYPIKSMMGAPIVYRMLLQ---
DHBE_BACSU      DHSTVYLAALPMAHNYPLSSPVLGVLYAGGRVVLSPSPSPDDAFPLIEREKVTITALVPAMVW-MXXXXX
ACSM4_MOUSE     DTGWIKAAIGSVF----STWLRGACVFVHR----MAQXXXXXXXXXXXXYPITTLCSAPTVYRMLVQK--
ACSM4_HUMAN     DTGWVKAAIGSVF----SSWLCGACVFVHR----MAQXXXXXXXXXXXXYPITTLCSPPTVYRMLVQK--
MENE_STAAR      DTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQILTMIKNERITHISLVPTLNW--LMQQG
ACSM1_BOVIN     ACRKLLLKMSDVFWCLSDTGWILAALWTAGSTVFLPQFDPKVIIETFFKYPITQCLAAPSVYRMIL--QQ
ACSF3_HUMAN     TKDDVIXXXXXXXXXXXXXNALLCPLWVGATCVMMPEFSPQEKFLSSETPRINVFMAVPTIYTKLMEYYD
ACSA_XANP2      G--DIYWCTADVGWVTGHSYIVYGPLANGATTLMFEGIPNYPSVSVIDKHKVNIFYTAPTAIRSLMQA-G
MENE_STAAU      DTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQILTMIKNERITHISLVPTLNW--LMQQG
MENE_STAAT      DTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQILTMIKNERITHISLVPTLNW--LMQQG
MENE_STAAE      DTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQILTMIKNERITHISLVPTLNW--LMQQG
MENE_STAAC      DTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQILTMIKNERITHISLVPTLNW--LMQQG
MENE_STAA8      DTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQILTMIKNERITHISLVPTLNW--LMQQG
MENE_STAA3      DTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQILTMIKNERITHISLVPTLNW--LMQQG
MENE_ENTFA      TAEDCWLCAVPLFHISGLSIVVRQ-LVLGCSIRLYDKFDEQQVTQDLQEGRGTVISVVATMLQQLLSVYP
ACSA_NOVAD      GQ--IYWCAADIGWVTGHSYVVYGPLMNGATTVMVPNFDASRFWQVVDKFKVEIFYGAPTALRALMR-EG
4CLL3_ORYSJ     QYHNVYMAALPMSHVYGLSLFAVGLLSIGATVVVMRRFDAGDAVAAIGRYKVTHMPLVPPIXXXXXXXXX
ACSM1_MOUSE     KTSDILWCMSDPGWILATVGCLIEPWTSGCTVFILPQFDPKVIVEVLFKYPITQCLAAPGVYRMVLQ-QK
ACSA_BACSU      E--DIYWCTADPGWVTGTVYGIFAPWLNGATNVIVGRFSPESWYGTIEQLGVNVWYSAPTAFRMLMGAGD
ACSM1_HUMAN     TSDDSGWIVATIWTLVEPWTAGCTVFIHH-----LPQFDTKVIIQTLLKYPINHFWGVSSIYRMIL--QQ
4CL1_SOYBN      ------------------------------TILLMPKFDINSLLALIHKHKVTIAPVVPPIVLAISKSPD
ACSA_PSYIN      QEGDIYWCTADVGWITGHTYSVYGPLANGATSLIVPNYPTPARMSVVDKHKVSILYTAPTAIRALM-AKG
ACSA_SHEFN      D--EVYWCTADVGWITGHSYMVYGPFANAATVLIVPNHPTPARLGMIDRHKVNILYTAPTLIRALMAEGK
ACSA_METPB      HDGDVYWCTADVGWVTGHSYIVYGPLANGATTLMIPTYPSNSRFEVIDKHKVNIFYTAPTAIRSLMGG-G
ACSA_DESAA      HDGDIYWCTADIGWVTGHSYIIYGPLANGAVTIMIPNYDFSRFWQICDKHQVNIFYTAPTVVRALMQ-QG
ACSA_SYNFM      HDGDIYWCTADIGWVTGHSYIIYGPLANGATTVMIPNYDWSRFWNVVDKHKINIFYTAPTAIRALMR-QG
ACSA_METRJ      G--DVYWCTADVGWVTGHSYIVYGPLANGATTLMIPTYPSTSRFEVVDKHKVNIFYTAPTAIRSLMGG-G
ACSA_SHEAM      G--EVYWCTADVGWITGHSYMVYGPLANGATILIIPNFPSPARLGIVDRHQVNILYTAPTLIRALMAEGK
ACSA_METC4      --HDVYWCTADVGWVTGHSYIVYGPLANGATTLMIPTYPSNSRFEVIDKHKVNIFYTAPTAIRSLMGG-G
ACSA_METEP      HDGDVYWCTADVGWVTGHSYIVYGPLANGATTLMIPTYPSNSRFEVIDKHNVNIFYTAPTAIRSLMGG-G
MENE_LACLA      DN-DNWLVILPMFHVSGLSIIMRT-LYNATSATVVDKFDENQLLEMINSGKINMVSLVPTLLTRIAD---
ACSA_XANAC      D--DIYWCTADVGWVTGHSYIVYGPLANGATAVMVPNYPNVSRFEVIDKHQVTIFYTAPTAIRALMRDGA
ACSA_RHOP5      HDGDVYWCTADVGWVTGHSYILYGPLANGATTLMVPNYPTNSRFEVIDKHQVNIFYTAPTAIRALMQGGD
ACSA_PARL1      HDGDIYWCTADVGWVTGHSYILYGPLANGATTLMVPNYDASRCWQVIDKHEVNIFYTAPTALRALMR-EG
ACSF3_XENLA     TKEDSIXXXXXXXXXXXXXNKLMCPLWVGATCVILPEFCPKTVWQHFDVPSINIFMAVPTIYSKLIAYYE
ACSA2_PSEAE     HDGDVYWCTADVGWVTGHSYIVYGPLANGATTLMVPNYDASRFWQVIDKHQVNIFYTAPTAIRALMR-EG
ACSA_SHESA      G--EIYWCTADVGWITGHSYMVYGPLANGATVLIIPNYPSPARLGMIDRHKVNILYTAPTLIRALMAEGK
ACSA_SHESM      G--EIYWCTADVGWITGHSYMVYGPLANGATVLIIPNHPSPARLGMIDRHKVNILYTAPTLIRALMAEGK
ACSA_BRAJA      HDGDIYWCTADVGWVTGHSYILYGPLANGATTLMVPNYDNSRFWNVIDKHKVNTFYTAPTAIRALMQG-G
ACSA_SHESR      G--EIYWCTADVGWITGHSYMVYGPLANGATVLIIPNHPSPARLGMIDRHKVNILYTAPTLIRALMAEGK
ACSA_BRASO      HEGDVYWCTADVGWVTGHSYILYGPL-ANGAVTLMPNYDNSRFWNVIDKHKVNIFYTAPTAIRALMQGGD
ACSA_XANOM      D--DIYWCTADVGWVTGHSYIVYGPLANGATAVMVPNYPNVSRFEVIDKHQVTIFYTAPTAIRALMRDGA
4CLL5_ORYSJ     DNREXXXXXXXXFHVFGFMMVLRSVSMGE-TSVLMERFDFIAALRAIERYRVTLLPAAPPVLVAMVKYE-
ACSA_SODGM      G--DVYWCTADVGWVTGHSYLLYGPLACCAITLMFEGVPNWPAASRMDKHQVNILYTAPTAIRALM-AEG
ACSA_SHEON      G--EIYWCTADVGWITGHSYMVYGPLANGATVLIVPNHPSPARLGMIDRHKVNILYTAPTLIRALMAEGK
ACSA_HALHL      QDGEVYWCTADVGWVTGHSYIVYGPL-ANGAKTLMPTYDAGRFWQVVDKHEVSIFYTAPTAIRALMGQGD
ACSA_XANCP      D--DIYWCTADVGWVTGHSYIVYGPLANGATAVMVPNYPNVSRFEVIDKHQVTIFYTAPTAIRALMR-EG
ACSA_XANC8      D--DIYWCTADVGWVTGHSYIVYGPLANGATAVMVPNYPNVSRFEVIDKHQVTIFYTAPTAIRALMR-EG
4CLL1_ARATH     IGQIVTLGLIPFFHIYGIVGICCATMKNKGKVVAMSRYDLRIFLNALIAHEVSFAPIVPPIILNLVKNPI
LGRC_BREPA      FSFDVSVSEIVMSLLAGATLVIE------DRESLLP---GPELIRVLQEQRITTFA--------MVSSVX
4CLL7_ORYSJ     EVRT--LLGAPMFHSMGFLFVLQXXXXXXXXXXXXXXXXXXXIRGLVEAAEVMDMTASPPVVLGMTKQRC
ACSA_XYLFA      -ENDIYWCTADIGWITGHSYIVYGPLANGATVLLFEGVPHYPTVSVIDKHHVTLFYTAPTAIRALMR-EG
ACSA_XYLFT      -ENDIYWCTADIGWITGHSYIVYGPL-ANGTTVLL--FEGSRFWEVIDKHHVTLFYTAPTAIRALMR-EG
ACSA_BEII9      HDGDVYWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPNYPSVSVIDKHKVTIFYTAPTAIRALMGS-G
ACSA_VIBCH      N--EVFWCTADVGWITGHSYLVYGPLANGAKTILVPNYPTTARMSVVDKHKVNILYTAPTAIRALM-AKG
PPSB_BACSU      FNHEDVWTLFHSYCFDFSVWEMFGALLNGSTLVVVSKRDPQAFRLLLKKERVTVLNQTPTAFYGLMLEDQ
ACSA_YERPS      G--DIYWCTADVGWVTGHSYLLYGPL-ACGAITLMPNYPGVNRLSVVDKHKVNILYTAPTAIRALM-AEG
ACSA_YERP3      G--DIYWCTADVGWVTGHSYLLYGPL-ACGAITLMPNYPGVNRLSVVDKHKVNILYTAPTAIRALM-AEG
ACSA_RHILO      HDGDIYWCTADVGWVTGHSYIVYGPLANGATTLMVPNYPSQSRFEVIDKHKVNIFYTAPTALRALMGAGN
ACSA_PSEA6      G--DIYWCAADVGWVTGHSYIVYGPLANGATSVMVPTYPDVRRIGIVDKHKVNILYTAPTAIRALM-AHG
ACSA_ALCBS      QDGDIYWCTADVGWITGHSYIVYGPLANGATTLMVPTYDASRCWQVVDKHKVNIFYTAPTAIRALMGL-G
ACSA_YERPP      G--DIYWCTADVGWVTGHSYLLYGPL-ACGAITLMPNYPGVNRLSVVDKHKVNILYTAPTAIRALM-AEG
ACSA_YERPN      G--DIYWCTADVGWVTGHSYLLYGPL-ACGAITLMPNYPGVNRLSVVDKHKVNILYTAPTAIRALM-AEG
ACSA_YERPE      G--DIYWCTADVGWVTGHSYLLYGPL-ACGAITLMPNYPGVNRLSVVDKHKVNILYTAPTAIRALM-AEG
ACSA_YERPA      G--DIYWCTADVGWVTGHSYLLYGPL-ACGAITLMPNYPGVNRLSVVDKHKVNILYTAPTAIRALM-AEG
4CLL2_ORYSJ     ARDNVYLAALPMFHVYGLSLFAVGLLSLGCTVVVMRRFNVDDAVKAIRKYKVTHLPLVPPIMSALLRANP
ACSA_YERE8      G--DIYWCTADVGWVTGHSYLLYGPL-ACGAITLMPNYPGVNRLGVIDKHQVNILYTAPTAIRALM-AEG
ACSA_AERS4      E--DIYWCTADVGWVTGHSYLVYGPLANGATTIMVPNYPATNRMSVVDKHQVTILYTAPTAIRALM-AKG
ACSA_NEUCR      HDGDRYFCGGDVGWITGHTYVLYAPLLLGVSTVV---FEGTPAYDIIEEHKVTQFYVAPTAL-RLLKRAG
ACSA_AGRRK      G--DIYWCTADVGWVTGHSYIVYGPLANAATSLMVPNYDQGRFWDIIDKHKVNIFYTAPTAIRSLMGA-G
ACSA_AGRT5      G--EVFWCTADVGWVTGHSYIVYGPLANCATTLMVPNFDQGRFWEVIDKHKVNIFYTAPTALRSLMGA-G
ACSA_AERHH      E--DIYWCTADVGWVTGHSYLVYGPLANGATTIMVPNYPATNRMSVVDKHQVSILYTAPTAIRALM-AKG
ACSA_METSO      D--DVWWCTADIGWVTGHSYIVYAPLILGMTSLMYEGADFGRWWKNIQDHKVTVLYTAPTAVRMFMKQGA
ACSA_RHOCA      G--DVFWCTADVGWVTGHSYIIYGPLANGATTLMVPTFDAGRFWAVCEKHKVNQFYTAPTAIRALMGQGP
ACSA_EMENI      D--DRYFCGGDVGWITGHTYVVYAPLLLGCSTVVFPAYDFSRYWDVIEKHKVTQFYVAPTAL-RLLKRAG
ACSA_MAGSM      D--DIYWCTADVGWVTGHTYIVYGPLANGATTLMVPTYDASRFWQVVDKHQVSIFYTAPTAIRSIMS-QG
ACSA_RHOBA      G--DVYWCTADCGWITGHSYVVYGPLSAGATCLMYPNFPAEDRFDIVERHKVSILYTAPTAVRAFIKWGD
ACSA_METSB      G--EVYWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPSYPTISVVDKHQVNIFYTAPTAIRSLMGA-G
ACSA_LEPIN      E--DTYWCTADIGWVTGHSYLVYGPLSNGASSVMVPSYDAGRFWDVIDKYGVNIFYTAPTAIRALMREGL
ACSA_LEPIC      E--DTYWCTADIGWVTGHSYLVYGPLSNGASSVMVPSYDAGRFWDVIDKYGVNIFYTAPTAIRALMREGL
ACSA_ECOLI      G--DIYWCTADVGWVTGHSYLLYGPLACGATTLMVPNWPTPARMAVVDKHQVNILYTAPTAIRALM-AEG
ACSA_ECOL6      G--DIYWCTADVGWVTGHSYLLYGPLACGATTLMVPNWPTPARMAVVDKHQVNILYTAPTAIRALM-AEG
MENE_STAEQ      --NTVWLSVLPIYHISGLSVILRAVIEGF-TVRLVKKFQTDDMLTQIKTYPITHMSLVPQTLKWLMDAGL
ACSA_ENTS8      G--DIYWCTADVGWVTGHSYLLYGPLACGATTLMVPNWPSANRMAVVDKHKVNILYTAPTAIRALM-AEG
ACSA_BARHE      HAGEIYWCTADIGWITGHSYLVYGPLCNAATTLMFPTFDNGRFWEIVDKHQVNIFYTAPTAIRALMGAGN
ENTE_ECOLI      QTR--YLCAIPAAHNYAMSSPGSLGVFAGGTVVLAADPSATLCFPLIEKHQVNVTALVPPAVSLWLQALI
ACSA_VIBVY      G--ETFWCTADVGWITGHTYLVYGPLANGAKTILVPNYPNTSRMSVVDKHQVNILYTAPTAIRALM-AKG
ACSA_VIBVU      G--ETFWCTADVGWITGHTYLVYGPLANGAKTILVPNYPNTSRMSVVDKHQVNILYTAPTAIRALM-AKG
ACSA_CITK8      D--DIYWCTADVGWVTGHSYLLYGPLACGATTLMVPNWPTPARMAVVDKHQVTILYTAPTAIRALM-AEG
ACSA_CHRVO      N--DVFWCTADVGWITGHSYVCYGPLANGATQVIVPTYDAGRFWKMIEQHKVSIFYTAPTAIRSLIKLGS
ACSA_GEMAT      KEEDVYWCTADIGWITGHSYLVYGPLANGATCVMYEGADKDRFWQICERYGVTILYTAPTMKWGTEYVK-
ENTE_ECO57      QTR--YLCAIPAAHNYAMSSPGSLGVFAGGTVVLAADPSATLCFPLIEKHQINVTALVPPAVSLWLQALT
MENE_STAES      --NTVWLSVLPIYHISGLSVILRAVIEGF-TVRLVKKFQTDDMLTQIKTYPITHMSLVPQTLKWLMDAGL
ACSA_PHOLL      G--EVYWCTADVGWVTGHSYLLYGPL-SCGAITLMPNYPAVNRLSIIDKHQVNILYTAPTAIRALM-AEG
DHBF_BACSU      EDRLLAVTTV-AFDISALELYLPLISGAQIVIAKKETIREPQALAMIENFDINIMQATPTLWHALVTSEP
ACSA_LEPBJ      E--DTYWCTADIGWVTGHSYLVYGPLSNGASSVMVPSYDAGRFWDVIDKYGVNIFYTAPTAIRALMREGL
ACSA_BDEBA      D--DIYWCSADVGWVTGHSYIVYGPLANGATSLFVPNYPTPSRFEVVDKHKVTIFYTSPTAIRSLMR-EG
ACSA_ALHEH      QEGEVYWCTADVGWVTGHSYIVYGPLANGATTLMVPTYSAARCWEVVDKHNVSIFYTAPTAIRALMGQGN
TYCB_BREPA      DSGXXXXXXXXXXXXXXXXXXIVSG----STVVLMPDHEAKDPIALIAAWECSYVVFVPSMFQAILECST
ACSA_ECO57      G--DIYWCTADVGWVTGHSYLLYGPLACGATTLMVPNWPTPARMAVVDKHQVNILYTAPTAIRALM-AEG
ACSA_BART1      G--EIYWCTADIGWITGHSYLVYGPLCNGATTLMFPTFDKGRFWEIVDKHKVNTLYTAPTAIRALMGA-G
GRSB_BREBE      G--DTALQVFS-FAFDGFVASLFAPILAGATSVLPKEEEAKDPVALIASEEITHYYGVPSLFSAILDVSS
BACA_BACLI      DNSSIYASISFDAFVWELFPYITAGATVH-VLNQETRLDVEKLNRYFHDHHITI-SFLPTPVCEQFTALD
ACSA_LARHH      N--DIYWCTADVGWITGHSYICYGPLAMGATQVVIPTYDAGRFWRMIEQHKVNIFYTAPTAIRSLIKLGA
ACSA_SHESW      -AGEVYWCTADVGWITGHSYMVYGPLANGATVLIVPNHPSPARLGMIDRHKVNILYTAPTLIRALMAEGK
ACSA_SHEPC      -AGEVYWCTADVGWITGHSYMVYGPLANGATVLIVPNHPSPARLGMIDRHKVNILYTAPTLIRALMAEGK
ACSA_PHOPR      QEGDVYWCTADVGWITGHSYLVYGPLANGATTVLVPNYPSTSRMSVVDKHNVSILYTAPTAIRALM-AKG
VIBE_VIBCH      --HTRYLCVLPAAHNFPLSSPGALGVFAGGCVVLSQDASPQHAFKLIEQHKITVTALVPALLWMDHAEKS
ACSA_SHEB8      -AGEVYWCTADVGWITGHSYMVYGPLANGATVLIVPNHPSPARLGMIDRHKVSILYTAPTLIRALMAEGK
ACSA_SHEB5      -AGEVYWCTADVGWITGHSYMVYGPLANGATVLIVPNHPSPARLGMIDRHKVSILYTAPTLIRALMAEGK
ACSA_BARBK      G--EIYWCTADIGWITGHSYLVYGPLCNGATTLMFPTFDEGRFWEIVDKHKVNIFYTAPTAIRALMGA-G
4CLL8_ORYSJ     DDHDAYGCVLPMFHMFGFSSFXXXXXXXXXXXXXXPRFSVEKTMAAVEEYGVTLLXXXXXXXXXXXXXXG
ACVS_NOCLA      ESAEAVLFLANYVFDFSVEQLALSVLGGHKLLVPPPSAADDPAFELANREGLSYLSGTPTQV-------E
ACSA_VIBPA      G--ETFWCTADVGWITGHTYLIYGPLANGAKTILVPNYPNTSRMSVVDKHQVNILYTAPTAIRALM-AKG
ACSA_SHEHH      -ENEVYWCTADVGWITGHSYMVYGPLANGATVLIVPNYPSPARLGMVDRHKVNILYTAPTLIRALM-AEG
GRSB_ANEMI      G--DTALQVFS-FAFDGFVASLFAPILAGATSVLPKEEEAKDPVALIASEEITHYYGVPSLFSAILDVSS
ACSA_METFK      -ATDIFWCTADVGWITGHSYVAYGPLALGSTQVVVPTYDAGRFWQMIERHKVSIFYTAPTAIRSLIKLGG
ACSA_MARMS      D--DVYWCAADVGWITGHSYMVYGPLANGTTSILVPTYDSGRIGRVVDKFDVTILYTAPTAIRALM-AKG
ACSA_LEPBL      E--DTYWCTADIGWVTGHSYLVYGPLSNGASSVMVPSYDAGRFWDVIDKYGVNIFYTAPTAIRALMREGL
AAS_SALTI       -ANDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN
ACSA_SALTY      G--DIYWCTADVGWVTGHSYLLYGPLACGATTLMVPNWPTPARMQVVDKHQVNILYTAPTAIRALM-AEG
ACSA_PRB01      E--DKYWCTADVGWITGHTYILYGPLSNGATTLMVPTYSASRCWEICDKHDISIFYTAPTAIRALM-AQG
AAS_SALSV       -ANDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN
AAS_SALPB       -ANDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN
AAS_SALHS       -ANDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN
AAS_SALG2       -ANDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN
AAS_SALEP       -ANDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN
AAS_SALA4       -ANDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN
ACSA_PASMU      N--DIFWCTADVGWITGHSYVCYGPLANGATQVIVPTYDPGRIWRMIQRHKINVFYTSPTLIRSLTRL-G
AAS_SALPC       -ANDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN
AAS_SALCH       -ANDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN
ACSA_SHEDO      -ENEVYWCTADVGWITGHSYMVYGP-FANGATVLMPNYPTPARLGIVDRHKVNILYTAPTLIRALMAEGK
ACSA_SALTI      G--DIYWCTADVGWVTGHSYLLYGPLACGATTLMVPNWPTPARMQVVDKHQVNILYTAPTAIRALM-AEG
ACSA_SACD2      G--EVYWCTADVGWVTGHTYIVYGPLTNGATTLMVPTYPAARCWEVCDKHNVNIFYTAPTAIRALMG-QG
ACSA_RHISN      HDGDIYWCTADVGWVTGHSYIVYGPLANAATTLMVPNFDAGRFWEVIDKHKVNIFYTAPTAIRSLMGAGD
AAS_SALTY       -ANDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN
AAS_SALPK       -ANDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN
AAS_SALPA       -ANDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN
AAS_SALNS       -ANDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN
AAS_ENT38       -AKDRFMSALPLFHSFGLTVGLFTPLFTGAEVFLYPSLHYRVVPELVYDRNCTVLFGTSTFLGHYARFAN
LGRB_BREPA      TEQDVFLQASTVFEIWG--SLLNGA-----KLVLLP----PELPSLAEIGQAIQSHHVTTLWLGLFTLMV
ACSA_RHIE6      HHGDIYWCTADVGWVTGHSYIVYGPLANCATTLMVPNFDQGRFWEVIDKHKVNIFYTAPTAIRSLMGAGD
ACSA_SHEB9      -AGEVYWCTADVGWITGHSYMVYGPLANGATVLIVPNHPSPARLGMIDRHKVSILYTAPTLIRALMAEGK
ACSA_PSEHT      D--DVFWCSADVGWITGHSYIAYGPLVNGCTQVVVPTYPTAGRMEVVDKHGVTILYTAPTAIRALM-AKG
ACSA_BARQU      G--EIYWCTADIGWISGHSYLIYGPLCNGATTLMIPTFDQGRFWEIVDKHKVNTLYTAPTAIRALMGA-G
ACSA_AGRVS      G--EIFWCSADVGWVTGHSYIVYGPLANCATTVMVPNFDQGRFWEIIDKHKVNIFYTAPTAIRSLMGAGD
ACSA2_PSEPK     DG-EVFWCTADVGWVTGHSYIVYGPL-ANGAISLMPNYDTSRFWQVVDKHQVNIFYTAPTALRALMR-EG
ACSA_RHIEC      HHGDIYWCTADVGWVTGHSYIVYGPLSNCATTLMVPNFDQGRFWEVIDKHKVNIFYTAPTAIRSLMGAGD
ACSA_PYRAE      D--DIFWCTADIGWVTGHSYVVLGPLLMGATEVIYPDYQPDRWWSIIERYGVTIFYTSPTAIRMFMRYGE
LGRD_BREPA      TSRVLQXXXXXXXXXXXXXXM---ALLAGATLVIEDRLPGPELIQVLQEQRITTVS--------MVSSVX
AAS_SALDC       -ANDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN
AAS_ENTS8       D--DKFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRVVPELVYDRNCTVIFGTSTFLGHYARFAH
ACSA_MARAV      HDGDVYWCTADFGWVTGHSYILYGPLANGAITLLVPNYDSSRMGQVVDKHKVNILYTAPTAIRALM-AQG
ACSA_LEPBP      DT-DTYWCTADIGWITGHSYILYGPLSNGATSLMVPSYDMGRFWDVIDKYKVTVFYTAPTAIRALMREGL
ACSA_LEPBA      DT-DTYWCTADIGWITGHSYILYGPLSNGATSLMVPSYDMGRFWDVIDKYKVTVFYTAPTAIRALMREGL
TYCC_BREPA      S--DKALQVFS-FAFDGFVASLFAPLLGGATCVLPQEAAAKDPVALMAATEVTHYYGVPSLFQAILDCST
SRFAA_BACSU     GSQTLRMALLAPFHFDASVKQIFASLLLGQTLYIVPKTNGAALTAYYRKNSIEATDGTPA-HLQMLAAAG
ACSA_SYNAS      HDGDIYWCTADIGWVTGHSYTIYGPLANGATTVMVPNYDWSRFWRIVDKHGVTILYTAPTAIRALMR-QG
AAS_KLEP3       -ANDRFMSALPLFHSFGLTVGLLTPLFTGAEVFLYPSLHYRVVPELVYDRNCTVLFGTSTFLANYARFAN
ACSA_SHEPA      -ENEVYWCTADVGWITGHSYMVYGPLANGATVLIVPNYPTPARLGMVDRHKVNILYTAPTLIRALM-AEG
ACSA_RHILW      HDGDVYWCTADVGWVTGHSYIVYGPLANCATTLMVPNFDQGRFWEVIDKHKVNIFYTAPTAIRSLMGAGD
AAS_SHISS       -TNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN
AAS_SHIFL       -TNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPDLVYDRSCTVLFGTSTFLGHYARFAN
AAS_SHIF8       -TNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPDLVYDRSCTVLFGTSTFLGHYARFAN
AAS_SHIB3       -TNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN
AAS_ECOSE       -TNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN
AAS_ECOLC       -TNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN
AAS_ECOHS       -TNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN
AAS_ECO5E       -TNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN
AAS_ECO57       -TNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN
AAS_ECO55       -TNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN
AAS_ECO24       -TNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN
ACSA_THEEB      QDTDVYWCTADVGWITGHSYIVYGPLSNGATTLMYPRPSNPGCFDVIEKYGVTIFYTAPTAIRAFIK-MG
AAS_ECOLU       -TNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN
AAS_ECOLI       -TNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN
AAS_ECODH       -TNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN
AAS_ECOBW       -TNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN
AAS_ECO7I       -TNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRSCTVLFGSSTFLGHYARFAN
PPSD_BACSU      YAFNETDTILQLFSFSGFITSMFTPLLSGAKAVLLHEEEAKDILAILSRQRITHMIIVPVLYRALLDVVQ
BACC_BACLI      QSIAFDLTVTSIFTISGNRVIV----YRHSE-------DGEPLIRKVFRDQK---AGIVKLTPSHLSLVK
ACSA_SHESH      G--EVYWCTADVGWITGHSYMVYGPLANGATVLIVPNYPTPARLGMVDRHKVNILYTAPTLIRALM-AEG
ACSA_SCHPO      TDRDVGWITGHTYIVYGPLMLGAATLVFEST----PAYDYSRYWSVVERHRLTQWYIAPTAI-RLLQRAG
ACSA1_PSEAE     G--EVYWCTADIGWVTGHTYIVYGPLANGATTILVPNYDVTRVAKIIDKHKVNILYTAPTAIRAMM-AEG
AAS_ECOSM       -TNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN
AAS_ECOL6       -TNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN
AAS_ECO27       -TNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN
ACVS_CEPAC      EDDEVILVFSAVFEPFVRQMLM--ALTTGNSLAIIDKFDPDTLIPFIQKHKVTYIHATSSVL-------Q
AAS_KLEP7       -ANDRFMSALPLFHSFXXXXXXXXXXXXXAEVFLYPSLHYRVVPELVYDRNCTVLFGTSTFLANYARFAN
AAS_ESCF3       -TNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRNCTVLFGTSTFLGHYARFAN
AAS_ECOUT       -TNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN
AAS_ECOK1       -TNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN
AAS_ECO45       -TNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN
ACSA_NITEU      D--DVFWCTADVGWVTGHSYVAYGPLAIGATQVI---FEGTPTWEIIQKHRITTFYTAPTAIRSLIKLGS
ACS1_CANAL      D--DILFTAGDIGWITGHTYCVYGPLLAGATSVV---FEGTPAYEIVDKYKVNQFYVAPTALRLLKRAGT
ACSA_PENCH      D--DRYFCGGDVGWITGHTYVVYAPLLLGCATVVFPNF--SRYWDVIDKHDVTQFYVAPTAL-RLLKRAG
ACSA_AGRRH      QHGDIYWCTADVGWVTGHSYIVYGPLANCATTLMIPTFDAGRFWDVIDKHKVNIFYTAPTAIRSLMGAGD
ACVS2_PENCH     QHHEILLFSACVFEPFVRQTLM-ALVNGHLLAVIVEKYDADTLLPFIRRHSITYLNGTASVL-------Q
ACVS1_PENCH     QHHEILLFSACVFEPFVRQTLM-ALVNGHLLAVIVEKYDADTLLPFIRRHSITYLNGTASVL-------Q
ACSA_SERP5      HDGDVYWCTADVGWVTGHSYLLYGPL-ACGAITLMPNYPGVNRLSVIDKHQVNILYTAPTAIRALM-AEG
AAS_ECOL5       -TNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSLHYRIVPELVYDRSCTVLFGTSTFLGHYARFAN
ACSA2_RHIME     QDGDIYWCTADVGWVTGHSYIVYGPLANAATTLMVPNFDAGRFWEVVDKHKVNIFYTAPTAIRSLMGAGD
ACSA_SINMW      QDGDIYWCTADVGWVTGHSYIVYGPLANAATTLMVPNFDAGRFWEVVDKHKVNIFYTAPTAIRSLMGAGD
ACSA_RUBXD      D--DVYWCTADIGWVTGHSYIVYGPLSNGATALMFPSYPADRWWDIIERHGVTILYTAPTAIRAFMK-QG
ACS2L_MOUSE     G--DVFGCVADIGWITGHSYVVYGPLCNGATTVLFESTDAGRYWETVQRLKINQFYGAPTAV-RLLLKYG
ACSA_PSESM      G--EIYWCTADVGWVTGHSYIVYGPLANGATTLLVPNYDITRVSKIIDKHKVNILYTAPTAIRAMM-AEG
ACSA_NITEC      HSEDIFWCTADVGWVTGHSYVTYGPLAIGATQVI---FEGTPTYEIIQKHRVTTFYTAPTAIRSLIKLGP
ACSA_CAUCR      G--EVFWCTADVGWVTGHSYVVYGPLANGGTSLIVPNYPTPSRFEVIDKHQVSIFYTAPTALRALMREGD
AAS_PECCP       --RDRFMSALPLFHAFGLTVGLLTPLMTGARIFLYPSLHYRIVPELVYDQNCTVLFGTSTFLGNYARFAH
FCSA_DICDI      IPEDVHMSYLPLAHSF-ERAVVSLMCYVGGQIGF---FSGPELFNDIQVLRPTFLCGAPRVWWGLNSKQS
ACSA_PSE14      G--EIYWCTADVGWVTGHSYIVYGPLANGATTLLVPNYDITRVSKIIDKHKVNILYTAPTAIRAMM-AEG
ACSA1_PSEPK     G--EVYWCTADVGWVTGHSYIVYGPLANGATTLLVPNYDITRVSKIVDKHKVNILYTAPTAIRAMM-AEG
AAS_ERWT9       C--DRFMSALPLFHAFGLTVGLFTPLMTGARVFLYPSLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN
ACSA_PSEU2      G--EVYWCTADVGWVTGHSYIVYGPLANGATTLLVPNYDITRVSKIIDKHKVNILYTAPTAIRAMM-AEG
AAS_ERWCT       G--DRFMSALPLFHAFGLTVGLLTPLITGARVFLYPSLHYRIVPELVYDQNCTVLFGTSTFLGNYARFAH
AAS_CITK8       -ANDRFMSALPLFHSFXXXXXXXXXXXXXAEVFLYPSLHYRIVPELVYDRNCTVLFGTSTFLGNYARFAN
ACSA_SHELP      G--EIYWCTADVGWITGHSYMVYGPLANGATILIIPNYPTPARLGMIDRHKVNILYTAPTLIRALM-AEG
AAS_YERE8       --RDRFMSSLPLFHAFGLTVGLFTPLMTGSRVFLYPSLHYRVVPELVYDRNCTVLFGTSTFLGNYARFAH
ACS2_CANAL      E--DILFTAGDVGWITGHTYALYGPLLLGVPTII---FEGTPAYQIVEKHKATHFYVAPTAL-RLLRKAG
ACSL1_MOUSE     D--DVLISFLPLAHMF--ETVVECVMLCHGAKIGF--FQGDIRL-LMDDLKVTIFPVVPR----LLNRMF
ACSA_DROME      G--DIYWCTADVGWITGHTYVVYGPLANGATSVIFPFFPGDRYWSVIDKYKVTQFYTAPTAIRALMKFGE
ACS2L_HUMAN     G--DIFGCVADIGWITGHSYVVYGPLCNGATSVLFESTNAGRYWETVERLKINQFYGAPTAV-RLLLKYG
PPSA_BACSU      LSEDDIVMVKTSFSFDASVQLFWWSLSGASAYLLPPGWEKDSALQAIHQENVTTAHFIPAMLNSFLD---
AAS_YERPY       --RDRFMSSLPLFHAFGLTVGLFTPLMTGSRVFLYPSLHYRVVPELVYDRNCTVLFGTSTFLGNYARFAH
AAS_YERPS       --RDRFMSSLPLFHAFGLTVGLFTPLMTGSRVFLYPSLHYRVVPELVYDRNCTVLFGTSTFLGNYARFAH
AAS_YERPP       --RDRFMSSLPLFHAFGLTVGLFTPLMTGSRVFLYPSLHYRVVPELVYDRNCTVLFGTSTFLGNYARFAH
AAS_YERPG       --RDRFMSSLPLFHAFGLTVGLFTPLMTGSRVFLYPSLHYRVVPELVYDRNCTVLFGTSTFLGNYARFAH
AAS_YERPB       --RDRFMSSLPLFHAFGLTVGLFTPLMTGSRVFLYPSLHYRVVPELVYDRNCTVLFGTSTFLGNYARFAH
AAS_YERP3       --RDRFMSSLPLFHAFGLTVGLFTPLMTGSRVFLYPSLHYRVVPELVYDRNCTVLFGTSTFLGNYARFAH
ACS2_DEBHA      E--DVLFTAGDVGWITGHTYALYGPLSLGVPTVVFPAFDYGRLWQIVEKHKATHFYVAPTAL-RLLRKSG
ACSA_MYCTU      DS-DVFWCTADIGWVTGHTYGVYGPLCNGVTEVLYEGTDRHRHFQIIEKYGVTIYYTAPTMKWGR-EIPD
ACSA_MYCBO      DS-DVFWCTADIGWVTGHTYGVYGPLCNGVTEVLYEGTDRHRHFQIIEKYGVTIYYTAPTMKWGR-EIPD
PPSC_BACSU      D--DIVMVKTSFSFDASVWQLFWWALSGASAYLLPPGWEKDSALQAIHQENVTTAHFIPAMLNSFLD---
ACSL1_CAVPO     NASDIHISFLPLAHMYEQ--LLQCVMLCHGAKIGF--FQGDIRL-LMDDLKATIFPVVPRLLNRMFDAQA
ACSA_PSYCK      D--DVYWCTADVGWVTGHTYATYAPLANGTTTVMVPEYPTWARIGIIDKHQITVLYTAPTAIRAMMK-EG
LGRA_BREPA      ADKAL---VYSSFSFDGSALDIFTHLLAGAALHIVPKYDLDALNDYCNQEGITI-SYLPT-------GAA
ACVS_EMENI      DHHEAIL--LFSAYVFEPFVRQMLMALVNGHLLAMEKYDAEKLIPFIREHKITYLNGTASVL-------Q
AAS_YERPE       --RDRFMSSLPLFHAFGLTVGLFTPLMTGSRVFLYPSLHYRVVPELVYDRNCTVLFGTSTFLGNYARFAH
AAS_YERPA       --RDRFMSSLPLFHAFGLTVGLFTPLMTGSRVFLYPSLHYRVVPELVYDRNCTVLFGTSTFLGNYARFAH
ACSA_SYNY3      T--DVYWCTADVGWITGHSYIVYGPLSNGATTVMVPRPSNPGCFDVIERYGVNIFYTAPTAIRAFIRMGE
ACSA_COPCI      D--DRFACMADVGWITGHTYIVYGPLAIGATTTVFPVYPTPSRYETVEKYKLTQFYSAPTAIRLLRRLGH
ACS1_DEBHA      D--DVLFTAGDVGWITGHTYVVYGPLLCGATTVV---FEGTPAWEIVDKYQVTQFYVAPTAL-RLLKRAG
S27A2_RAT       KAHDVIYTTMPLYHSAALMIGLHGCIVVGATFALRSKFSASQFWDDCRKYNATVIQYIGELLRYLCNTDR
ACSL6_RAT       TCADVHFSYLPLAHMFER--MVQSVVYCHGGRVGF--FQGDIRLLSMKALRPTIFPVVPRLLYDKIFHQA
ACSL6_HUMAN     RQDDVLISFLPLAHMFER--VIQSVVYCHGGRVGF--FQGDIRLLSDDMKALTIFPVVPRLLYDKIFSQA
ACSL1_RAT       E--DVLISFLPLAHMF--ETVVECVMLCHGAKIGF--FQGDIRL-LMDDLKVTIFPVVPRLLNRMFDGQA
ACSA_STRCO      ET-DVFWCTADVGWVTGHSYIVYGPLANGATQVM---YEGTPDTEIVQKYGVTILYTAPTAIRTFMKWGD
ACVS_STRCL      GTERVALFASYVFEPHLRQTLI--ALINGQTLVVVPRLDPDRFPAYIEEHGVT-----------YLNATG
ACSL1_HUMAN     CPDDTLISFLPLAHMFER--VVECVMLCHGAKIGF--FQGDIRL-LMDDLKVTVFPVVPR----LLNRMF
TYCA_BREPA      -------------NSFGVTEQDRIGLFASMSFMFMALLSG-ASLYILSKQTIHDFAAFEXXXXXXXXXXX
ACSA_DEIRA      D--DIYWCTADIGWITGHSYSVYGPLLNGATVVMYEQPDWGRFWDIVQKHRVTILYTAPTAIRSFMQHGD
MYCA_BACSU      KTN------FPLYSSISTVTSIFTPLVTGNTIIVFDGEDKSAVLSIMQDPRIDIIKLTPAHL--------
ACSA_RALEJ      D--DLFWCTADIGWVTGHTYIAYGPLAAGATQIIVPTYNAGRFWDMIARHKVSIFYTAPTAIRSLIKAEA
BACB_BACLI      FSVNLLQLASMSFDVFAGD--LCRSLLNGGTMYIVPKLEMNLLYDMINKYGIHMLESTPSLIIPLMKYID
ACSA_COPC7      D--DRFACMADVGWITGHTYIVYGPLAIGVTTTVFPVYPTPSRYETVEKYKLTQFYSAPTAIRLLRRLGH
MYCC_BACSU      ITFDVSVWELFWWSIVG------------SKVVLLP--NGGEILDTIEQKGVSTLHFVPAMLHAFLESME
ACSL6_MOUSE     RQDDVLISFLPLAHMFER--VIQSVVYCHGGRVGF--FQGDIRLLSMKALRPTIFPVVPRLLYDKIFHQA
ACSA_PSYA2      XXXXYWCTA-DVGWVTGHTYATYAPLANGTTTVMVPEYPTWARIGIIDKHQITVLYTAPTAIRAMMK-EG
ACSA_DICDI      HDSDVYACMADVGWITGHSYIVYGPLANGATTFI---FEGTPLYEMVQRHKITQFYTAPTAIRSLMKFPI
S27A3_MOUSE     HQEDVIYLALPLYHMSGSLLGIVGCLGIGATVVLKPKFSASQFWDDCQKHRVTVFQYIGELCRYLVNAEC
SRFAB_BACSU     GLTENDKTVLLSSYAFGYTSMF-PVLLGGGELHIVQKETPDEIAHYIKEHGITYIKLTPSLFHTIVNTAS
GRSA_BREBE      ISFDA--SVWEMF----MALLTGASLY----IILKDTIDFVKFEQYINQKEITVITLPPTYVVHL-----
ACSA_THIDA      ADNDVYWCTADVGWITGHTYVAYGPLALGMTEVIIPTYPAGRFWETIAKHKVTTFYTAPTAIRSLIKLGS
ACS2_CANGA      E--DVFFTAGDVGWITGHTYALYGPLLLGVPTICFPAYDYGRYWRIVERHKATHFYVAPTAM-RLIKRVG
S27A2_MOUSE     TAQDVIYTTMPLYHSAALMIGLHGCIVVGATLALRSKFSASQFWDDCRKYNVTVIQYIGELLRYLCNTDR
ACSA_THET2      DE-DVYWCTADVGWITGHSYVVYGPLLNGATTVMYPNWEPDRFWRIVDKYGVTVFYTAPTMKWGE-GWPG
SRFAC_BACSU     ---DTFLSVXXXXXXXXXXSMLNAA-----RLIIADELDTERLTDLILQENVNVMFAT-TALFNLLTDAG
PRPE_SALTY      KAGGVFFCASDIGWVVGHSYIVYAPLLAGMATIVLPTYDCGVWWKIVEKYQVNRMFSAPTAIRVLKKAQR
GRSA_ANEMI      ISFDA--SVWEMF----MALLTGASLY----IILKDTIDFVKFEQYINQKEITVITLPPTYVVHL-----
ACSA_THET8      DE-DVYWCTADVGWITGHSYVVYGPLLNGATTVMYPNWEPDRFWRIVDKYGVTVFYTAPTMKWGE-GWPG
ACSA_RALEH      D--DLFWCTADIGWVTGHTYIAYGPLAAGATQVVVPTYNAGRFWDMIARHKVSIFYTAPTAIRSLIKAEA
ACS1_KLULA      D--DIFFTAGDIGWITGHTYCVYGPLLQGCTTLV---FEGTPAYEIVDKYQVTQFYVAPTAL-RLLKRAG
BAIB_EUBSP      ------LLVGPLFHGAPHSAAFNG-LFMGNTLVLTRNLCPGNILNMIKKYKIEFIQMVPTLMNRLLEGVG
ACSA_PSEU5      G--DIYWCTADIGWITGHSYLIYGPLANGATTLMVPNYDVTRIARIIDKHRVNILYTAPTAIRXXXXXXX
ACSA_RALSO      D--DVFWCTADIGWVTGHTYIAYGPLAAGATQVVVPTYNAGRFWDMIQKHRVNTFYTAPTAIRSLIKAET
ACSA_PHYBL      QENDIYACMADIGWVTGHSYIVYGPLTLGATTVLFPTYPNPSRFQLIEKHKITQFYTAPTAIRALQRL-G
ACS1_CANGA      E--DVFFTAGDIGWITGHTCVYGPLLYGCTTLV----FEGTPAYEIIDKHQVTQFYVAPTAL-RLLKRAG
ACSA_RALME      D--DMFWCTADIGWVTGHTYITYGPLAAGATQIVVPTFNAGRFWDMIQRHKVSIFYTAPTAIRSLIKAEA
ACS2_ZYGBA      E--DVLFTAGDVGWITGHTYALYGPLVLGTASIIFPAYDYGRYWRIIQRHKATHFYVAPTAL-RLIKRVG
PRPE_ECOLI      KAGSVFFCASDIGWVVGHSYIVYAPLLAGMATIVLPTWDCGVWWTIVEKYQVSRMFSAPTAIRVLKKFPT
ACSA_BURS3      T--DVFWCTADIGWVTGHTYITYGPLACGGTQVVVPTYDAGRFWKMIGDHKVTVFYTAPTAIRSLIKAEA
DLTA_BACC2      FSFD-----LSVMDIYPSLVTGGTLWAIDKDMIARPK----DLFASLEQSDIQVWTSTPSFEMCLMEASF
ACS2_KLULA      E--DVLFTAGDVGWITGHTYALYGPLTLGTATIIFPAYDYGRYWRIIERHRATHFYVAPTAL-RLIKRVG
DLTA_BACCR      FSFD-----LSVMDIYPSLVTGGTLWAIDKDMIARPK----DLFASLEQSDIQVWTSTPSFEMCLMEASF
DLTA_BACC4      FSFD-----LSVMDIYPSLVTGGTLWAIDKDMIARPK----DLFASLEQSDIQVWTSTPSFEMCLMEASF
ACSA_OCHA4      HDGDIYWCTADVGWVTGHSYIVYGPLANGATTLMVPNFDQGRFWEVVDKHHVNIFYTAPTAIRALMGAGD
ACS1_ASHGO      HSDDIFFTAGDIGWITGHTYVVYGPLFSGCTTVV---FEGTPAYDIIDKYSVTQFYVAPTAL-RLLKRAG
LCFH_HAEIN      -DQDISLSFLPFSHIFERAW---AAYILHRGAILCYLEDTNQVRSALTEIRPTLMCAVPRFYWAISVGQK
ACS2_YEAST      E--DVLFTAGDVGWITGHTYALYGPLTLGTASIIFPAYDYGRYWRIIQRHKATHFYVAPTAL-RLIKRVG
ACS1_YEAST      HQEDVFFTAGDIGWITGHTVVYGPLLYGCATLV----FEGTPAYDIIDEHKVTQFYVAPTAL-RLLKRAG
ACSL5_HUMAN     TPDDVAISYLPLAHMFER--IVQAVVYSCGARVGF--FQGDIRLLAMKTLKPTLFPAVPRLFWDKLIFAK
ACSA_CUPTR      D--DLFWCTADIGWVTGHTYIAYGPLAAGATQVVVPTYNAGRFWDMIARHKVSIFYTAPTAIRSLIKAEA
ACBG1_HUMAN     AEQEVVVSYLPLSHIAAQIYDLWTGI-QWGAQVCFAEPDAGSLVNTLREVEPTSHMGVPRVWEKIMERSG
S27A2_HUMAN     KADDVIYITLPFYHSAALLIGIHGCIVAGATLALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSPN
DLTA_BACWK      FSFD-----LSVMDIYPSLVTGGTLWAIDKDMIARPK----DLFASLEQSDIQVWTSTPSFEMCLMEASF
DLTA_BACC1      FSFD-----LSVMDIYPSLVTGGTLWAIDKDMIARPK----DLFASLEQSDIQVWTSTPSFEMCLMEASF
DLTA_BACHK      FSFD-----LSVMDIYPSLVTGGTLWAIDKDMIARPK----DLFASLEQSDIQVWTSTPSFEMCLMEASF
DLTA_BACC3      FSFD-----LSVMDIYPSLVTGGTLWAIDKDMIARPK----DLFASLEQSDIQVWTSTPSFEMCLMEASF
DLTA_BACC0      FSFD-----LSVMDIYPSLVTGGTLWAIDKDMIARPK----DLFASLEQSDIQVWTSTPSFEMCLMEASF
DLTA_BACAH      FSFD-----LSVMDIYPSLVTGGTLWAIDKDMIARPK----DLFASLEQSDIQVWTSTPSFEMCLMEASF
ACSA_PYRAR      D--DIYWCTADIGWVTGHSYVVLGPLLMGTTEIIAPDYQPDRWWSIIERYGVTILYTSPTMFMRYGEAPG
ENTF_ECO57      CSFDVSVWEFFWPFIAGAKLVM-AEPEAHRDPLAMQQFFAEYG--------VTTTHFVPSMLAAFVASLT
DLTA_BACCZ      FSFD-----LSVMDIYPSLVTGGTLWAIDKDMIARPK----DLFASLEQSDIQVWTSTPSFEMCLMEASF
DLTA_BACCQ      FSFD-----LSVMDIYPSLVTGGTLWAIDKDMIARPK----DLFASLEQSDIQVWTSTPSFEMCLMEASF
DLTA_BACAN      FSFD-----LSVMDIYPSLVTGGTLWAIDKDMIARPK----DLFASLEQSDIQVWTSTPSFEMCLMEASF
DLTA_BACAC      FSFD-----LSVMDIYPSLVTGGTLWAIDKDMIARPK----DLFASLEQSDIQVWTSTPSFEMCLMEASF
DLTA_BACAA      FSFD-----LSVMDIYPSLVTGGTLWAIDKDMIARPK----DLFASLEQSDIQVWTSTPSFEMCLMEASF
ACSA_CRYPV      G--DIFGCAGDIGWITGHSYLVYAPLCNGITTLIVPTYNAGRYWEMVERHRITHFYAAPTAIRTLKRLGD
ACS2_ASHGO      E--DVLFTAGDVGWITGHTYALYGPLCLGTATIIFPAYDYGRYWRIIQRHKATHFYVAPTAM-RLIKTVG
ACBG1_RAT       AEQEVVVSYLPLSHIAAQIYDLWTGIQLKGTLVIMERIQEVAAQSGFIRRKMLLWAMSVTLEQNLTCPSN
PPSE_BACSU      DRFIMTGSIAVTFEMFG--ALLNGAIIDKSTMLTPDRF----GAYLLEND-ITVLFLTTALFNQLAQVRA
DLTA_BACC7      FSFD-----LSVMDIYPSLVTGGTLWAIDKDMIARPK----DLFASLEQSDIQVWTSTPSFEMCLMEASF
ACBG1_MACFA     AEQEVVVSYLPLSHIAAQIYDLWTGI-QWGAQVCFAEPDAGSLVNTLREVEPTSHMGVPRVWEKIMERSG
ACSA_BURP8      T--DVFWCTADIGWVTGHSYITYGPLTLGGTQVVVPTYNAGRFWDMIQKHKVTVFYTAPTAIRSLIKAEA
ACBG1_MOUSE     AEQEVVVSYLPLSHIAAQIYDLWTGIQLKGTLVIMERIQEVAAQSGFIRRKMLLWAMSVTLEQNLTCPSN
S27A5_RAT       TADDVVYNVLPLYHSMXXXXXXXXXXXXXATCVLAPKFSASRYWAECRQYSVTVVLYVGEVLRYLCNVPG
ACSA_RALPJ      D--DIFWCTADIGWVTGHSYIAYGPLAAGATQVVVPTYNAGRFWDMIQRHKVNTFYTAPTAIRSLIKAEA
ACSA_HERAR      N--DVYWCTADIGWVTGHTYVTYGPLAVGATQIVVPMYNAGRFWEMVQKHKVSIFYTAPTAIRSLIKAAS
AAS_PHOLL       --LDRFMSSLPLFHAFGLTVGLFTPLLSGSRIFLYPNLHYRVVPELVYECNCTVLLGTSSFLENYAYSAH
LCF2_SCHPO      NVKDYVLAYLPLAHIF-EFIFEMCCLYWGGVLYASPRTLTDASVGDLTEFRPTVLIGVPAVYKGILSSMP
ACSL5_MOUSE     TSDDVTISYLPLAHMFER--LVQGILFSCGGKIGF--FQGDIRLDDMKALKPTVFPTVPR----LLNRVY
ENTF_SHIFL      CSFDVSVWEFFWPFIAGAKLVM-AEPEAHRDPLAMQQFFAEYG--------VTTTHFVPSMLAAFVASLT
ENTF_ECOLI      CSFDVSVWEFFWPFIAGAKLVM-AEPEAHRDPLAMQQFFAEYG--------VTTTHFVPSMLAAFVASLT
DLTA_BACCN      FSFD-----LSVMDIYPSLVTGGTLWAIDKDMIARPK----DLFASLKQSNIQVWTSTPSFAEMCLMETS
MENE_SALTY      Q--DDWLLSLPLFHVSGQGIMWRW-LFAGARMTVRDKQPLEQMLA-----GCTHASLVPTQLWRLL----
ACSA_HUMAN      HAEDVFWCTADIGWITGHSYVTYGPLANGATSVLIPTYDVNRLWSIVDKYKVTKFYTAPTAI-RLLMKFG
S27A5_MOUSE     RADDVVYDVLPLYHTIGLVLGFLGCLQVGATCVLAPKFSASRFWAECRQHGVTVILYVGEILRYLCNVP-
ACSL5_RAT       TPEDVTISYLPLAHMFER--LVQGVIFSCGGKIGF--FQGDIRLDDMKALKPTVFPTVPRLLNGIIRRNS
MENE_ECOLI      GDHDDWLLSLPLFHVSGQGIMWRW-LYAGARMTVRDKQPLEQMLA-----GCTHASLVPTQLWRLL----
S27A1_BOVIN     QAADVLYDCLPLYHSAGNIMGVGQCLIYGLTVVLRKKFSASRFWDDCVKYNCTVVQYIGEICRYLLEAEG
ACSA_BRUSU      DYHDIYWCTADVGWVTGHSYIVYGPLANGATTLMVPNFDQGRFWEVVDKHHVNIFYTAPTALRALMGAGD
ACSA_BRUSI      DYHDIYWCTADVGWVTGHSYIVYGPLANGATTLMVPNFDQGRFWEVVDKHHVNIFYTAPTALRALMGAGD
ACSA_BRUO2      DYHDIYWCTADVGWVTGHSYIVYGPLANGATTLMVPNFDQGRFWEVVDKHHVNIFYTAPTALRALMGAGD
ACSA_BRUME      DYHDIYWCTADVGWVTGHSYIVYGPLANGATTLMVPNFDQGRFWEVVDKHHVNIFYTAPTALRALMGAGD
ACSA_BRUC2      DYHDIYWCTADVGWVTGHSYIVYGPLANGATTLMVPNFDQGRFWEVVDKHHVNIFYTAPTALRALMGAGD
ACSA_BRUAB      DYHDIYWCTADVGWVTGHSYIVYGPLANGATTLMVPNFDQGRFWEVVDKHHVNIFYTAPTALRALMGAGD
ACSA_BRUA2      DYHDIYWCTADVGWVTGHSYIVYGPLANGATTLMVPNFDQGRFWEVVDKHHVNIFYTAPTALRALMGAGD
ACSA_BRUA1      DYHDIYWCTADVGWVTGHSYIVYGPLANGATTLMVPNFDQGRFWEVVDKHHVNIFYTAPTALRALMGAGD
S27A6_HUMAN     TAHDIVYITLPLYHSSAAILGISGCVELGATCVLKKKFSASQFWSDCKKYDVTVFQYIGELCRYLCKREG
ACSA_BURTA      D--DVFWCTADIGWVTGHSYITYGPLAVGATQVVVPTYNAGRFWKMIGDHKVSVFYTAPTAIRSLIKAEA
S27A4_MACFA     RPNDIIYDCLPLYHSAGNIVGIGQCLLHGMTVVIRKKFSASRFWDDCIKYKCTIVQYIGELCRYLLNAEN
ACSA_BURPS      D--DVFWCTADIGWVTGHSYITYGPLAVGATQVVVPTYNAGRFWKMIGDHKVTVFYTAPTAIRSLIKAEA
ACSA_BURP6      D--DVFWCTADIGWVTGHSYITYGPLAVGATQVVVPTYNAGRFWKMIGDHKVTVFYTAPTAIRSLIKAEA
ACSA_BURP1      D--DVFWCTADIGWVTGHSYITYGPLAVGATQVVVPTYNAGRFWKMIGDHKVTVFYTAPTAIRSLIKAEA
ACSA_BURP0      D--DVFWCTADIGWVTGHSYITYGPLAVGATQVVVPTYNAGRFWKMIGDHKVTVFYTAPTAIRSLIKAEA
ACSA_BURMS      D--DVFWCTADIGWVTGHSYITYGPLAVGATQVVVPTYNAGRFWKMIGDHKVTVFYTAPTAIRSLIKAEA
ACSA_BURMA      D--DVFWCTADIGWVTGHSYITYGPLAVGATQVVVPTYNAGRFWKMIGDHKVTVFYTAPTAIRSLIKAEA
ACSA_BURM9      D--DVFWCTADIGWVTGHSYITYGPLAVGATQVVVPTYNAGRFWKMIGDHKVTVFYTAPTAIRSLIKAEA
ACSA_BURM7      D--DVFWCTADIGWVTGHSYITYGPLAVGATQVVVPTYNAGRFWKMIGDHKVTVFYTAPTAIRSLIKAEA
DLTA_BACLD      FSFD--LSVMDLY----------PCLQSGGTLWTVTKDMINRPKLLFEALKVNVWTSTPS--FAQMCLMD
S27A4_MOUSE     D--DIVYDCLPLYHSAGNIVGIGQCLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRYLLNAES
ACSA_BRUMB      DYHDIYWCTADVGWVTGHSYIVYGPLANGATTLMVPNFDQGRFWEVVDKHHVNIFYTAPTALRALMGAGD
S27A4_HUMAN     RPNDIVYDCLPLYHSAGNIVGIGQCLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRYLLNAEN
PKSJ_BACSU      TAEDKMLAVTTYCFDIAALELFLPLIKGAHCYICQTEHTKD-----VEKLKRDIRAIKPTVMWKMLFYSG
VRAA_STAAR      -NENAIAAPGPLSHSLTLYALL-FALSSGRTFIGQTTFHPERLLNQCRKYKVAMFL-VPTMIKSLLLVYN
DLTA_STRPC      QPQ---MLAQPPYSFDLSVMYWAPTLALGGTLFALPK-----ELVADFKQLFTTIAQLPVGIWTSTPSFA
DLTA_STRP6      QPQ---MLAQPPYSFDLSVMYWAPTLALGGTLFALPK-----ELVADFKQLFTTIAQLPVGIWTSTPSFA
DLTA_STRP3      QPQ---MLAQPPYSFDLSVMYWAPTLALGGTLFALPK-----ELVADFKQLFTTIAQLPVGIWTSTPSFA
DLTA_STRP1      QPQ---MLAQPPYSFDLSVMYWAPTLALGGTLFALPK-----ELVADFKQLFTTIAQLPVGIWTSTPSFA
DLTA_STRPZ      QPQ---MLAQPPYSFDLSVMYWAPTLALGGTLFALPK-----ELVADFKQLFTTIAQLPVGIWTSTPSFA
DLTA_STRPM      QPQ---MLAQPPYSFDLSVMYWAPTLALGGTLFALPK-----ELVADFKQLFTTIAQLPVGIWTSTPSFA
DLTA_STRPG      QPQ---MLAQPPYSFDLSVMYWAPTLALGGTLFALPK-----ELVADFKQLFTTIAQLPVGIWTSTPSFA
DLTA_STRPF      QPQ---MLAQPPYSFDLSVMYWAPTLALGGTLFALPK-----ELVADFKQLFTTIAQLPVGIW--TSTPS
DLTA_STRPD      QPQ---MLAQPPYSFDLSVMYWAPTLALGGTLFALPK-----ELVADFKQLFTTIAQLPVGIWTSTPSFA
DLTA_STRP8      QPQ---MLAQPPYSFDLSVMYWAPTLALGGTLFALPK-----ELVADFKQLFTTIAQLPVGIWTSTPSFA
ACSA_MOUSE      E--DVFWCTADIGWITGHSYVTYGPLANGATSVLIPTYPDEGRLSIVDKYKVTKFYTAPTAIRMLMKFGD
MBTB_MYCSS      SDRSLALSTLSVLDVFG---MLRAG----GSLVVVQRRDPDSWARLIAEHSVTVLHWMPGWLEMLLEVGG
ACBG1_BOVIN     AEQEVVVSYLPLSHIAAQIYDLWTGI-QWGAQVCFAEPDAGSLVNTLREVEPTSHMGVPRVWEKIMEQSG
MYCB_BACSU      FDRVLQFAAMS-FDVCYQEIF--STILSGGTLYIIDNEAKREIRELNEFVKTHRIAFLPTAFLKLLASEK
ACBG2_CHICK     EKQELVVSYLPLSHVAAQ--MIDIWLVTFGGQVFFAQPDALKGVDTLREVRPTAFLGVPRVWEKIEEKMK
VRAA_STAAW      -NENAIAAPGPLSHSLTLYALL-FALSSGRTFIGQTTFHPEKLLNQCHKYKVAMFL-VPTMIKSLLLVYN
VRAA_STAAS      -NENAIAAPGPLSHSLTLYALL-FALSSGRTFIGQTTFHPEKLLNQCHKYKVAMFL-VPTMIKSLLLVYN
VRAA_STAAN      -NENAIAAPGPLSHSLTLYALL-FALSSGRTFIGQTTFHPEKLLNQCHKYKVAMFL-VPTMIKSLLLVYN
VRAA_STAAM      -NENAIAAPGPLSHSLTLYALL-FALSSGRTFIGQTTFHPEKLLNQCHKYKVAMFL-VPTMIKSLLLVYN
VRAA_STAAC      -NENAIAAPGPLSHSLTLYALL-FALSSGRTFIGQTTFHPEKLLNQCHKYKVAMFL-VPTMIKSLLLVYN
VRAA_STAA1      -NENAIAAPGPLSHSLTLYALL-FALSSGRTFIGQTTFHPEKLLNQCHKYKVAMFL-VPTMIKSLLLVYN
S27A3_HUMAN     GVHDVIYLALPLYHMSGSLLGIVGCMGIGATVVLKSKFSAGQFWEDCQQHRVTVFQYIGELCRYLVNAER
FAD11_MYCTU     RFGDRVTSFLPSAHIADRMT----GLYMFGTQXXXXXXXXXXXXXLPD-VRPTVWGAVPRV-WEKLKAGI
ACSA_HELPH      -DNDNFWCTADIGWITGHTYVVYGPLACGATTLIMSYPDYGRWWRMIEEYRVDKFYTSPTAI-RMLHAKG
VRAA_STAHJ      NYEKALAAPGPLAHSLSLYTCIYA-LYSGRTFIGQRQFDAKRFISILNEQNIALFL-VPTMLHQLLNV--
S27A4_PONAB     N--DIVYDCLPLYHSAGNIVGIGQCLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRYLLNAEN
DLTA_LISMF      FSFD--LSVMDLY----------PSLLSGGTLVPLDKTITANMKDLYREQNLDVWVSTPS--FADLCLLD
ACSA_HELPG      -DNDNFWCTADIGWITGHTYVVYGPLACGATTLIMSYPDYGRWWRMIEEYRVDKFYTSPTAI-RMLHAKG
ACSA_HELP2      -DNDNFWCTADIGWITGHTYVVYGPLACGATTLIMSYPDYGRWWRMIEEYRVDKFYTSPTAI-RMLHAKG
PKSN_BACSU      E--DAYL--LKTNYVFDVSSELFGWFIGDGRLVILPP-NGEKSPQLIETYKVTHINFVPAMLHVFLEMAK
ACSA_HELPY      -DNDNFWCTADIGWITGHTYVVYGPLACGATTLIMSYPDYGRWWRMIEEYRVDKFYTSPTAI-RMLHAKG
DLTA_LISMO      FSFD--LSVMDLY----------PSLLSGGTLVPLDKTITANMKDLYREQNLDVWVSTPS--FADLCLLD
DLTA_LISMC      FSFD--LSVMDLY----------PSLLSGGTLVPLDKTITANMKDLYREQNLDVWVSTPS--FADLCLLD
DLTA_STRE4      PERPQMLAQPP--YSFDLSVMYWATLALGGTLFALPKSDFKRLFSTIAELPIGIWTSTPSFAMAMLN---
ACBG2_XENLA     DLQEIVVSYLPLSHIAAQMIDIWLTMYGGATYFAQPALKGSLAITLREV-RPTAFMGVPRVWEKMMKAVG
SID2_USTMA      GSFESRARFLALLEIF-------LSLRVGATIVTGPRLIHDDIAKTMSTLEVTHACVVPSLFF----SKG
DLTA_LISMH      FSFD--LSVMDLY----------PSLLSGGTLVPLDKTITANMKDLYREIPAQNFVWVSTPSFADLCLLD
DLTA_LISIN      FSFD--LSVMDLY----------PSLLSGGTLVPLDKTITANMKDLYREIPAQNFVWVSTPSFADLCLLD
ACSS3_PONAB     G--EVWWAASDLGWVVGHSYICYGPLLHGNTTVLVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDP
ACSS3_HUMAN     G--EVWWAASDLGWVVGHSYICYGPLLHGNTTVLVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDP
DLTA_BACA2      FSFD--LSVMDIF----------PSLQTGGTLVTKDKINKPKVLEELEKSKLNVWTSTPSFVQMCLMDPG
BGML_DROME      VGKESFVSYLPLSHVAAQIFDVFLGLSHAGCVT----FADKDALKTFRKARPTKMFGVPRVFEKLQERLV
ACSA_HELAH      -DNDNFWCTADIGWITGHTYVVYGPLACGATTLIMSYPDYGRWWRMIEEYRVDKFYTSPTAI-RMLHAKG
ACBG2_MOUSE     GKQNTIVSYLPLSHIAAQLTDIWIPI-KIGALTFFAQPDAGTLVYTLQEVKPTLFMGVPRI-WEKMQDTI
LCF1_SCHPO      ESKDYLLAYLPLAHIL-EFAFENICLAWGGTVRTLVDTNCRNCKGDINTFRPTIMVGVPAVWMSKLNAAS
S27A5_HUMAN     TADDVVYTVLPLYHVMGLVVGILGCLDLGATCVLAPKFSTSCFWDDCRQHGVTVILYVGELLRYLCNIP-
DLTA_STRMU      TPHRPQMLAQPPYSFDLSVMYWAPTLALGGTLFALPKADFKQLFTTINQLPIGVWTSTPS-FVDMAMLSD
S27A1_HUMAN     QAADVLYDCLPLYHSAGNIIGVGQCLIYGLTVVLRKKFSASRFWDDCIKYNCTVVQYIGEICRYLLK---
LCF1_YEAST      GNTDRVICFLPLAHIFELVSFYWGACIGYATVKTLTSSSVRNCQGDLQEFKPTIMVGVETVRKGILNQID
ANGR_VIBAN      NDRVLALSALSVYDIFG-------LLSAGGTIVLVSELERRDPIAAIEEHNVTMWNSVPALFDMLLTYAT
ACSA_CHLTE      D-EDIYFCTADIGWITGHTYIIYGPLLNGATVFMAPNYQWDRFWDIINRHKITILYTAPTAIRAFIRAGN
ACSB_DICDI      KSGDTFFAGSDVGWVVGHTLSVYGPLMVGLTSII---FEGKPTVKLIEKHRVNALFSAPTAIRAIHRDDA
MBTM_MYCSS      A--DTGCSWLPLYHDMGLAFLLTNALGGAELWQAPTTAFSASPFSWLQTESTATLTAAPNMAYGLIGKYG
DLTA_LISW6      FSFD--LSVMDLY----------PCLLSGGTLVPMDKTITSNLKDLYHEIPAQSFVWVSTPSFADLCLLD
VRAA_STAEQ      ET---IVAPGPLSH----SLSLYACIYALSTGKTFIGQKNFNPLSLMQLNKATAIFVVPTMVQQLISTQ-
BGM_DROME       VGAESIVSYLPLSHVAAQTVDIYTCAFVAGCIWFADKLKGTLVKSLQDA-RPTRFMGVPRVYEKFQEASS
ACSS3_MOUSE     G--EVWWAASDLGWVVGHSYICYGPLLHGNTTVLVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDP
DLTA_BACSU      FSFD--LSVMDLY----------PCLQSGGTLHCVTKDAVNKPKVLFEKSGLNVWTSTPSFVQMCLMDPG
DLTA_LACCB      YSFD--LSVMDLY----------PTLVLGGTLKALPKEVTDNFKTLFATPKLGLNEWVSTPSFAEIALLD
DLTA_LACC3      YSFD--LSVMDLY----------PTLVLGGTLKALPKEVTDNFKTLFATPKLGLNEWVSTPSFAEIALLD
ACBG2_RAT       GKQDTIVSYLPLSHIAAQLMDIWIPI-KVGVLTFFAQPDAGTLVYTLQEVKPTYFLGVPRVWWAKMKMLG
FAD26_MYCTU     IPTGTVVSWLPLYHDMGLILGICAPLVRRRAMLMSPMSFLRRPARWMQLLATSCFSAAPNFAFELVRRTS
ACSL3_PONAB     EEEDVYIGYLPLAHVLELSAEL--VCLSHGCRISSPQTLADQSSKIKKGSKPTLMAAVPEIYKNVMNKVS
ACSL3_HUMAN     EEEDVYIGYLPLAHVLELSAEL--VCLSHGCRISSPQTLADQSSKIKKGSKPTLMAAVPEIYKNVMNKVS
FCSB_DICDI      DT-DVHYSYLPYAHVLER--VVXXXXXXXXXXXXXXXXDISNILVEVKLLSPTLFIGVPTLFNGAYNLKY
MBTB_MYCPA      ADRCLALSTLE-----GDISVMDVTLRTGGAIVVVQRRDPDAWARLIDTHRVTVLHFMP----GWLEMLX
DLTA_STRZP      PSRPQMLAQPP--YSFDLSVMYWATLALGGTLFTLP--------SVITQDFKQLFAAIPIAIW--TSTPS
DLTA_STRR6      PSRPQMLAQPP--YSFDLSVMYWATLALGGTLFTLP--------SVITQDFKQLFAAIPIAIW--TSTPS
DLTA_STRPN      PSRPQMLAQPP--YSFDLSVMYWATLALGGTLFTLP--------SVITQDFKQLFAAIPIAIW--TSTPS
DLTA_STRP2      PSRPQMLAQPP--YSFDLSVMYWATLALGGTLFTLP--------SVITQDFKQLFAAIPIAIW--TSTPS
DLTA_LACPL      YSFD--LSVMDVY----------PTLALGGTLYALPKAVTDDFKQL--------FAALPTLVW--VSTPS
DLTA_STRA3      YSFD--LSVM----YWAPTLAMG------GTLFALPKTDFKKLFATINELPVQVWTSTPS-FADMALLSN
ACSL3_RAT       EE-DVYIGYLPLAHVLELSAEL--VCLSHGCRISSPQTLADQSSKIKKGSKPTLMAAVPEIYKNVMNKVN
DLTA_STRP7      PSRPQMLAQPP--YSFDLSVMYWATLALGGTLFTLP--------SVITQDFKQLFAAIPIAIW--TSTPS
DLTA_STRA5      YSFD--LSVM----YWAPTLAMG------GTLFALPKTDFKKLFATINELPIQVWTSTPS-FADMALLSN
DLTA_STRA1      YSFD--LSVM----YWAPTLAMG------GTLFALPKTDFKKLFATINELPIQVWTSTPS-FADMALLSN
ACSL4_HUMAN     GPKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSKPTLMAAVPEIMKTLFKIGY
ACSA_STRAW      ET-DVYWCTADIGWVTGHSYITYGPLSNGATQVM---YEGTPDTEIVQKYGVTILYTAPTAIRTFMKWGD
Y3568_PSEAE     QAGDVWWGISDVGWVVGHSLIVYGPLFYEGKPVRTP--DAGAYWRVIEEHRVNSLFCAPTAIRAIRDPHG
ACSS3_BOVIN     G--EVWWAASDLGWVVGHSYICYGPLLHGNTTVLVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDP
ACSA_WOLSU      -ENDTYWCTADVGWITGHTYIVYGPLAMGATTVMVPIYDTGRWWKMIEHYRVNQFYTAPTAI-RLLHKEG
VRAA_STAES      ET---IVAPGPLSH----SLSLYACIYALSTGKTFIGQKNFNPLSLMQLNKATAIFVVPTMVQQLISTQ-
LCF4_YEAST      T--DRIIAFLPLAHIF-ELTFEFEAFYWNGILTLTPTSTRNCQGDLMEF-KPTVMVGVATLFWGLLSGLI
DLTA_STRZT      PSRPQMLAQPP--YSFDLSVMYWATLALGGTLFTLP--------SVITQDFKQLFAAIPIAIW--TSTPS
DLTA_STRPJ      PSRPQMLAQPP--YSFDLSVMYWATLALGGTLFTLP--------SVITQDFKQLFAAIPIAIW--TSTPS
S27A1_MOUSE     RAADVLYDCLPLYHSAGNIMGVGQCVIYGLTVVLRKKFSASRFWDDCVKYNCTVVQYIGEICRYLLR---
ACSL4_RAT       GPKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSKPTLMAAVPEIMKTLFKIGY
ACSA_CAMJ8      -DYDNYWCSADVGWITGHTYVVYGPLACGATTIMTPTYNSGRWWRMIEEYQISKFYTSPTAIRMLHADAP
ACSA_CAMJJ      -DYDNYWCSADVGWITGHTYVVYGPLACGATTIMTPTYNSGRWWRMIEEYQISKFYTSPTAI-RMLHADA
ACSA_CAMJE      -DYDNYWCSADVGWITGHTYVVYGPLACGATTIMTPTYNSGRWWRMIEEYQISKFYTSPTAI-RMLHADA
ACSL4_MOUSE     GPKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSKPTLMAAVPEIMKTLFKIGY
DLTA_STAXY      FSFD--LSVMAIYPCLATAGTLNLV---DKTMINKPKLLND----MLEQSKINVWVSTPSMCLMLPNLAE
S27A1_RAT       RANDVLYDCLPLYHSAGNIMGVGQCIIYGLTVVLRKKFSASRFWDDCVKYNCTVVQYIGEICRYLLR---
ACSL3_MOUSE     EE-DVYIGYLPLAHVLELSAEL--VCLSHGCRISSPQTLADQSSKIKKGSKPTLMAAVPEIYKNVMNKVN
SIB1_SCHPO      DTNSRFL-AFASFH-FDVSVLEQYFSWSTGTLVAAPQ-------SLILQDLPTAISALKITHVDLTPSLA
DLTA_LACRH      YSFD--LSVMDLY----------PTLVLGGTLKALPKEVTDELFATLPKLGLNEWVSTPSF---VEIALL
MBTB_MYCTU      ADRWLALATLEVLDIF-------AALRSGGAIVVVDRRDPDAWARLIDTYEVTALNFMPGWLDMLLEVGG
MBTB_MYCBO      ADRWLALATLEVLDIF-------AALRSGGAIVVVDRRDPDAWARLIDTYEVTALNFMPGWLDMLLEVGG
FAT1_YEAST      ES--TVFTAMPLFHSTAALLGACAILSHGGCLALSHKFSASTFWKQVYLTGATHIQYVGEVCRYLLHTP-
HMWP2_YERE8     HDRVLALSALSVYDIFG-------VLRAGGALVMVQRRDPHAWCELIQRHQVTLWNSVPALFDMLLTGFA
DLTA_STAES      FSFD--LSVMAIYPCLTSGGTLNLV---DKDMIKKPKLLNE----MLVQTPMNVWVSTPSLLLPNLNEQQ
ACBG2_HUMAN     DKHETVVSYLPLSHIAAQ--MMDIWVIKIGALTYFAQADAGTLVSTLKEVKPTVFIGVPQIWWAMLGKYN
MENE_HAEIN      DCNQSWLLSLPLYHVSGQGIVWRW-LYC-GAQLHFP--EDDFYASLLKTTHVSL---VPTQLQRLLDYLQ
FAT1_COCHE      T--DRMYTCMPLYHAAAHSLCTASVIHGGGTVVLSRKFSHKKFWPEVVASEANIIQYVGELGRYLLNGPK
LCF2_YEAST      DKRNQQLCFLPLAHIF------------------------------------------------------
ACSM6_HUMAN     TD-----VLWSLGDAFGGSLSLSAVLWFQGACVFMPTFCPETVLNVLSRFPITTLSANPEMYQELLQHKC
DLTA_STAAB      FSFD--LSVMAIYPCLASGGTLNLV---DKNMINKPKLLNEMLTSI----PINIWVSTPSFMCLLLPTLN
PABL_STRGR      AYAGTLITACPLTHCFGLQSAY-SALFRAGRQVLLSGWDVGRFLELARRERPSVVVAVP-----------
LCF3_YEAST      GSTDRVLSFLPLAHIFELVFEFEAFYWNYGSVKTLTNTSTRNCKGDLVEFKPTIMIGVAAVWETVRKAEK
DLTA_STAAW      FSFD--LSVMAIYPCLASGGTLNLV---DKNMINKPKLLNE----MLTATPINIWVSTPSFMEMLLPTLN
DLTA_STAAU      FSFD--LSVMAIYPCLASGGTLNLV---DKNMINKPKLLNE----MLTATPINIWVSTPSFMEMLLPTLN
DLTA_STAAT      FSFD--LSVMAIYPCLASGGTLNLV---DKNMINKPKLLNE----MLTATPINIWVSTPSFMEMLLPTLN
DLTA_STAAS      FSFD--LSVMAIYPCLASGGTLNLV---DKNMINKPKLLNE----MLTATPINIWVSTPSFMEMLLPTLN
DLTA_STAAN      FSFD--LSVMAIYPCLASGGTLNLV---DKNMINKPKLLNE----MLTATPINIWVSTPSFMEMLLPTLN
DLTA_STAAM      FSFD--LSVMAIYPCLASGGTLNLV---DKNMINKPKLLNE----MLTATPINIWVSTPSFMEMLLPTLN
DLTA_STAAE      FSFD--LSVMAIYPCLASGGTLNLV---DKNMINKPKLLNE----MLTATPINIWVSTPSFMEMLLPTLN
DLTA_STAAC      FSFD--LSVMAIYPCLASGGTLNLV---DKNMINKPKLLNE----MLTATPINIWVSTPSFMEMLLPTLN
DLTA_STAA9      FSFD--LSVMAIYPCLASGGTLNLV---DKNMINKPKLLNE----MLTATPINIWVSTPSFMEMLLPTLN
DLTA_STAA8      FSFD--LSVMAIYPCLASGGTLNLV---DKNMINKPKLLNE----MLTATPINIWVSTPSFMEMLLPTLN
DLTA_STAA3      FSFD--LSVMAIYPCLASGGTLNLV---DKNMINKPKLLNE----MLTATPINIWVSTPSFMEMLLPTLN
DLTA_STAA2      FSFD--LSVMAIYPCLASGGTLNLV---DKNMINKPKLLNE----MLTATPINIWVSTPSFMEMLLPTLN
DLTA_STAA1      FSFD--LSVMAIYPCLASGGTLNLV---DKNMINKPKLLNE----MLTATPINIWVSTPSFMEMLLPTLN
DLTA_LACLA      YSFD-----LSIFSLY-------PSLTTGGTLISLSRDETTNFKLLFERNKTVINTWISTPSFVDICLLD
LYS2_CANGA      -ENDKFTMLSGIAHDPIQRDMFTPLFL--GAQLYVPTQDDGRLAEWMGKYGCTVTHLTPAM-GQLLTAQA
MBTM_MYCPA      A--DVGCSWLPLYHXXXPTSAFTASPFRW--------------LAWLSESRATITAA-PNFAYNLVGKYA
LYS2_YEAST      -ENDKFTMLSGIAHDPIQRDMFTPLFL--GAQLYVPTQDDGRLAEWMSKYGCTVTHLTPAM-GQLLTAQA
DLTA_STAAR      FSFD--LSVMAIYPCLASGGTLNLV---DKNMINKPKLLNE----MLTATPINIWVSTPSFMEMLLPTLN
DLTA_STAEQ      FSFD--LSVMAIYPCLTSGGTLNLV---DKDMIKKPKLLNE----MLVQTPMNVWVSTPSLLLPNLNEQQ
FAD28_MYCBO     PPNSALVSWLPFYHDMGLVIGICAPILGGYPAVLTSPVSFLQRMHLMASD-FHAFSAAPNFAFELATTDD
DLTA_STAHJ      FSFD--LSVMAIYPCLTSGGTLNLV---DKEMINKPKLLNE----MLVNTPINAWVSTPSFMEMCLLLPN
ACSF4_MOUSE     E--DILFLASPLVEIFVSLSSGACLLIVPTSVKVLPSKLAD---ILFSRHRVTVLQATPT----LLRRFG
ESYN_FUSEQ      DTRALQFG----SHAFGACILEIMTTLIHGGCVCIPSDDDNNVLEFINRTNVQLGHATPS-YMGTFQ---
ORA_PLAFN       LT--THLSYLPVSHIYERVIFFIALFL--GVKINIWSRDIKFLNTDICNSKAEIILGVPKVFWIAKQAEG
HTS1_COCCA      ETRVLQFSSYTFDISIADTF---TALFYGGTLCIPSE---EDRMSNLQDYMVSVRPNWAVLTPTVSRFLD
ACSA_NOSLI      -DGEIYWCTADVGWVTGHTYIVYGPLANGATTLMFEGVPNYPTVSVIDKHQVNIFYTAPTAIRALMR-DG
ACSF4_DANRE     E--DVVFLSSPLVEVFLALSSGACLLIVPSAVKKMPR---RLAHVLFKRNTTTVLQATPTLVRRFGKVVL
FAD21_MYCLE     GVAPLDLTILPFYHDMGLVLGVVAPILGGWRSELTSPISFLQRIQAMATSSHPFSAGPNFAFELAARRTS
MBTM_MYCTU      -ATDVGCSWLPLYHDMGLAFVXXXXXXXXXXXXXXXXXFTASPLSWLSDSGATMTAA-PNFAYNLIGKYA
MBTM_MYCBO      -ATDVGCSWLPLYHDMGLAFVXXXXXXXXXXXXXXXXXFTASPLSWLSDSGATMTAA-PNFAYNLIGKYA
LYS2_PENCH      D--EKFTMLSGIAHDPIQRDIFTPLFL--GAQLLVPAIQNEKLAEWIEKYGATITHLTPAMGQILVGGAS
LYS2_ASHGO      D--DKFTMLSGIAHDPIQRDMFTPIYL--GAQLLVPQEDD---------------IGTPGRLATWMATHG
ESYN_GIBPU      N----FPSPARMSHVFGASWEMFWMLLNGGTVVYLATLDGKELAAVFAKERVNCAFLAPAMLKLYLT---
LYS2_SCHPO      -ESDRFTMLSGIAHDPIQRDIFTPLFL--GASLIVPTAEDGQLAQWANKYKVTVTHLTPAM-GQLLAAQA
FAD25_MYCTU     PPGSTVVSWLPFYHDMGFXXXXXXXXXXXXXXXXTSPIGFLQRPARMLASNTLAFTAAPNFAFDLASRKT
FAD21_MYCTU     DT--TIVSWLPFYHDMG-----------------------------------------------------
FAD21_MYCBO     DT--TIVSWLPFYHDMG-----------------------------------------------------
ACSF4_HUMAN     E--DVLFLASPL--TFDPSVVIFLALSSGASLLIVPTLPSKLASVLFSHHRVTVLQATPT----LLRRFG
LYS2_CANAL      -EKDKFTILSGIAHDPIQRDMFTPLFL--GAQLLVPTADDGKLADWMAKYGATV-THLTLAMGQLLSAQA
PCL_HALHA       ----------------------------------------------------------------------
DIP2A_HUMAN     ----------------------------------------------------------------------
PCL_RHOS4       ----------------------------------------------------------------------
PATJ_DROME      ----------------------------------------------------------------------
DIP2A_MOUSE     ----------------------------------------------------------------------
YAC2_METSO      ----------------------------------------------------------------------
DIP2B_MOUSE     ----------------------------------------------------------------------
DIP2C_HUMAN     ----------------------------------------------------------------------
DIP2B_HUMAN     ----------------------------------------------------------------------
DIP2B_DANRE     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG
LCFB_BACSU      ENGKKDDFSSIRLCISGGASMPVALLTAFEEKFGVTILEGYGLSEASPVTCFNPFDRGRKPGSIGTSILH
LCFA_BACSU      HYDLSSIKSCL----SGSAALPVEVKQKFEKVTGGKLVEGYGLSEASPVTHANFIWGKNKPGSIGCPWPS
LCFA_ECO57      NKEFQQLDSSLHLSAGGGMPVQQVVAERWVKLTGQYLLEGYGLTECAPLVSVNPYDIDYHSGSIGLPVPS
LCFA_ECOLI      NKEFQQLDSSLHLSAGGGMPVQQVVAERWVKLTGQYLLEGYGLTECAPLVSVNPYDIDYHSGSIGLPVPS
LCFA_ECOL6      NKEFQQLDSSLHLSAGGGMPVQQVVAERWVKLTGQYLLEGYGLTECAPLVSVNPYDIDYHSGSIGLPVPS
LCFA_SALTY      NKEFQQLDSSLHLSAGGGMPVQNVVAERWVKLTGQYLLEGYGLTECAPLVSVNPHDIDYHSGSIGLPVPS
LCFA_SALTI      NKEFQQLDSSLHLSAGGGMPVQNVVAERWVKLTGQYLLEGYGLTECAPLVSVNPHDIDYHSGSIGLPVPS
LCFA_YERPE      FTHLD--FSTLRLSVGGGMPVQKAVAEKWETLTGKHLLEGYGLTECSPLVTGNPYDLKHYSGSIGLPVPS
LCFA_HAEIN      NENFKEVDSALKLSVGGGMAIQQSVATRWHELTGCNIIEGYGMTECSPLIAACPINVVKHNGTIGVPVPN
CAIC_SALAR      DHCLREVMFYLNLSV--------QEKEAFTERFGVRLFTSYGMTETIVGIIGDRPGDKRRWPSIGRPGFC
ACSF2_RAT       DFSSYDFT-TIRGGVIAGSLAPPELIRAIISKMNMELVVVYGTTENSPVTFMNFPEDEQKAGSVGRIMPH
CAIC_CITK8      QHCLREVMFYLNLSVQ---EKDAFIAR-----FGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRPGFC
CAIC_ECOSM      QHRLREVMFYLN--------LSAQEKDAFCERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFC
CAIC_ECO27      QHRLREVMFYLN--------LSEQEKDAFCERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGQAGFC
CAIC_ECOUT      QHRLREVMFYLN--------LSEQEKDAFCERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFC
CAIC_ECOK1      QHRLREVMFYLN--------LSEQEKDAFCERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFC
CAIC_ECO81      QHRLREVMFYLN--------LSEQEKDAFCERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFC
CAIC_ECO45      QHRLREVMFYLN--------LSEQEKDAFCERFGVSLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFC
4CL2_SOLTU      VHNYDLSS--VRTVMSGAAPLGKELEDAVRAKFNAKLGQGYGMTEAGPVLAFAKEPFDIKSGACGTVVRN
ACSF2_MOUSE     DFSSYDFT-SIRGGVIAGSPAPPELIRAIINKMNMELVVVYGTTENSPVTFMNFPEDEQKAGSVGRIMPH
CAIC_SHIFL      QHRLREVMFYLN--------LSEQEKDAFCERFGVRLLTSYGMTETIVGIIGDRPSDKRRWPSIGRAGFC
CAIC_ECO7I      QHRLREVMFYLN--------LSAQEKDAFCERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFC
CAIC_ECO5E      QHRLREVMFYLN--------LSEQEKDTFCERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFC
CAIC_ECO57      QHRLREVMFYLN--------LSEQEKDTFCERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFC
CAIC_ECOLC      QHRLREVMFYLN--------LSEQEKDAFCERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFC
CAIC_ECOL6      QHRLREVMFYLN--------LSEQEKDAFCERFSVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFC
CAIC_ECOL5      QHRLREVMFYLN--------LSEQEKDAFCERFSVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFC
CAIC_ECO55      QHRLREVMFYLN--------LSEQEKDAFCERFGVRLLTSYGMTETIVGIIGDRPSDKRRWPSIGRAGFC
4CL1_SOLTU      NYDLSSV----RTVMSGAAPLGKELEDAVRAKFNAKLGQGYGMTEAGPVLAFAKEPFDIKSGACGTVVRN
CAIC_ECO8A      QHRLREVMFYLN--------LSEQEKDAFCERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFC
CAIC_ECOHS      QHRLREVMFYLN--------LSEQEKDAFCERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFC
CAIC_ESCF3      QHHLREVMFYLN--------LSEQEKDAFCERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFC
CAIC_ECO24      QHRLREVMFYLN--------LSEQEKDAFCERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFC
CAIC_ECOSE      QHRLREVMFYLN--------LSEQEKDAFCERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFC
CAIC_ECOLU      QHCLREVMFYLN--------LSEQEKDAFCERFSVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFC
CAIC_SHISS      QHRLREVMFYLN--------LSEQEKDAFCERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFC
CAIC_ECOLI      QHRLREVMFYLN--------LSEQEKDAFCERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFC
CAIC_ECODH      QHRLREVMFYLN--------LSEQEKDAFCERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFC
CAIC_ECOBW      QHRLREVMFYLN--------LSEQEKDAFCERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFC
CAIC_SALPK      QHHLREVMFYLN--------LSAQEKDAFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFS
CAIC_SALPA      QHHLREVMFYLN--------LSAQEKDAFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFS
ACSF2_MACFA     DFSSYDIS-TMRGGVIAGSPAPPELIRAIINKINMDLVVAYGTTENSPVTFANFPEDEQKAESVGRIMPH
CAIC_SALNS      QHHLREVMFYLN--------LSAQEKDAFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFS
CAIC_PROMH      SPDEKQHKLR---EVMFYLNLADEEKDAFIERFNVRLLTSYGMTETIVGLIGDRPGDKRRWPSIGRPGFC
ACSF2_PONAB     DFSSYDIS-TMCGGVIAGSPAPPELIRAIINKINMDLVVAYGTPENSPVTFAHFPEDEQKAESVGRIMPH
4CL1_TOBAC      SYDLSSV----RTVMSGAAPLGKELEDAVRTKFNAKLGQGYGMTEAGPVLAFAKEPFDIKSGACGTVVRN
CAIC_SALSV      QHHLREVMFYLN--------LSAQEKDAFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFS
CAIC_SALDC      QHHLREVMFYL--------NLSAQEKDAFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFS
CAIC_SHIDS      QHRLREVMFYLN--------LSEQEKDAFCERFGVRLLTSYGMTETIVGIIGDRLGDKRRWPSIGRAGFC
CAIC_SALTI      QHHLREVMFYLN--------LSAQEKDAFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFS
CAIC_SALPC      QHHLREVMFYLN--------LSAQEKDAFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFS
CAIC_SALPB      QHHLREVMFYLN--------LSAQEKDAFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFS
CAIC_SALEP      QHHLREVMFYLN--------LSEQEKDDFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFS
CAIC_SALCH      QHHLREVMFYLN--------LSAQEKDAFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFS
CAIC_SALTY      QHHLREVMFYLN--------LSEQEKDDFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFS
CAIC_SALHS      QHHLREVMFYLN--------LSEQEKDDFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFS
CAIC_SALA4      QHHLREVMFYLN--------LSEQEKDDFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFS
ACSF2_HUMAN     DFSSYDIS-TMCGGVIAGSPAPPELIRAIINKINMDLVVAYGTTENSPVTFAHFPEDEQKAESVGRIMPH
YDAB_BACSU      KHQTDLSSLVI--LMTGGTKVPSSLISRYLD-IGIPLAHGYGSTEAWGISTWTPDMGMDXXXXXXXXXXX
CAIC_PROSL      SPDEKQ--HKLREVMSYLNLADKEKDASI-ERLNVRLLTSHGMTETIVGLIGDRPGDKRRWPSIGRPGFC
MENE_BACLD      DRCPGSLRCXXXXXXXXXXXXXEECKRK-----RLPVVQSYGMTETCSQIATLAPEYSIKLGSAGKPLFA
ACSF2_BOVIN     DFSSYDIS-TMRGGVIAGSPAPPELIRAIINKLNMELVVAYGTTENSPVMNFTEDTVEQKAESVGRVMPH
4CLL6_ARATH     KGVCGEVFKSLKQVSSGAAPL----SRKFIEDFHVDLIQGYGMTESTAVGTRGNSEKLSRYSSVGLLAPN
4CL2_TOBAC      DYDLSSV----RTVMSGAAPLGKELEDTVRAKFNAKLGQGYGMTEAGPVLAFAKEPFEIKSGACGTVVRN
MENE_BACP2      ---LEECPSSLRCXXXXXXXXXXXMLQESKEK-GFPVFQSYGMTETSQIVTLAPEFSVEKLGSAGKPLFG
MENE_GEOSW      ERRYPETFRCMXXXXXXXXXXXXEVCKAK----GIPVYQTYGMTETASQIATLAPEYSTKLGSAGKPLFP
4CLL5_ARATH     QIKAKYDLSSMHTVLCGGAPLSKEVTEGFAEKYPVKILQGYGLTESTGIASTDTVEESRRYGTAGKLSAS
4CL_VANPL       NYDLSSV----RTVMSGAAPLGKELEDAVRAKFNAKLGQGYGMTEAGPVLAFAKEPFDIKSGACGTVVRN
FADK_ECOLI      KQPADL--SALRFFLCGGTTIPKKVARECQQR-GIKLLSVYGSTESSPVVNLDDPLSRFMHTD-GYAAAG
4CL2_PETCR      PVVDKYDLSSVRTVMSGAAPLGKELEDAVRAKFNAKLGQGYGMTEAGPVLAFAKEPYEIKSGACGTVVRN
4CL1_PETCR      PVVDKYDLSSVRTVMSGAAPLGKELEDAVRAKFNAKLGQGYGMTEAGPVLAFAKEPYEIKSGACGTVVRN
4CLL1_ORYSJ     KYDLS----SLKFIGSGAAPLGKDVMEVVAKKFDSEIVQGYGMTETCGIISLEYPEKAREFGSTGTLVSG
ACSF2_DANRE     QPDLAKFDSSVRGGIAAGSPCPPEVMRKILNVMGIEMVIGYGTTENSPVTFCGFPVDSAKIVTVGCISPH
MENE_GEOKA      E---ARYPDTFRCMXXXXXXXXXXXXEACKEK-GIPVYQTYGMTETASQIATLAPEYSTKLGSAGKPLFP
CAIC_SHIF8      QHRLREVMFYLN--------LSEQEKDAFCERFGVRLLTSYGMTETIVGIIGDRPSDKRRWPSIGRAGFC
4CLL2_ARATH     EINSKYDLSSLHTVVAGGAPLSREVTEKFVENYPVKILQGYGLTESTAIASMFNKEETKRYGASGLLAPN
4CLL3_ARATH     QLKAKYDLTSLRKVRCGGAPLSKEVMDSFLEKYPVNIFQGYALTESGSGASTESVEESLKYGAVGLLSSG
4CL2_DICDI      PIVDKFDLSSLRTLFSGAAPLSREVEDLIKERFKGKLIQGYGATELSPAC-FVIPSGLIKSGSAGILLPN
4CLL8_ARATH     QIMKKYDVSFLRTVRCGGAPLSKEVTQGFMKKYPVDVYQGYALTESNGAASIESVEESRRYGAVGLLSCG
4CLL7_ARATH     KFDLSSLKYIGSGAAPLGKDLMEECGRNIPN---VLLMQGYGMTETCGIVSVEDPRLKRNSGSAGMLAPG
4CL1_DICDI      PIVDKFDLSSLRTLFSGAAPLSSEVEDLIKERFKLVIKQGYGATELSPAC-FVIPSGLVKSGSAGILLPN
MENE_BACC7      ---AETYPSSLRCMLLGGGPAPKPILETCVEK-GIPVYQTYGMTETSSICTLSADYMLTKVGSAGKPLFQ
4CLL4_ORYSJ     PLPLGQMRKVL----SGGAPLGKELIEGFREKYQVEILQGYGLTESTAIASTDSAEESRRYGTAGLLSPN
4CLL4_ARATH     LIKAKYDLSSLKTVRCGGAPLSKEVTEGFLEKYPVDILQGYALTESNGGGAFTNSAEESRRGTAGTLTSD
FAT2_SCHPO      XXXXXXXXXXXXXXXSCSSPLAPPVLSKLEATFRAPVLEAYAMTEASHQMTTNPPPLVHKPHSVGKP-FG
3HBCL_THAAR     AGESAAMRDIRHF-VSAGEKLPENIGQQWLDTFGIPITEGIGASETVFLFLCARPDAY-RIGSCGKRVPW
4CL2_ARATH      PETEKYDLSSVRMVKSGAAPLGKELEDAISAKFNAKLGQGYGMTEAGPVLAFAKEPFPVKSGACGTVVRN
MENE_BACSU      --ETNRCPESIRCIXXXXXXXXXXXXEECREK-GFPVFQSYGMTETSQIVTLSPEFSMEKLGSAGKPLFS
ALKK_PSEOL      GNGSK--SQSLTRVVVGGSACPASMIREFNDIYGVEVIHAWGMTELSPFGTANTPEKLSLRKSQGRPPYG
MENE_BACC0      EGTYPSSLRCMXXXXXXXXXXXXETCVDK----GIPVYQTYGMTETSSICTLSADYMLTKVGSAGKPLFQ
4CL3_DICDI      PIVDKFDLSSLRTLFCGAAPLGSEIEDLIKERFKLVIKQGYGATELSPCC-FVTPNGLVKSGSSGTLLPN
4CL2_ORYSJ      RHDLSSIRIVL----SGAAPLGKELEDALRARLPQAIFQGYGMTEAGPVLSFAKEPTPAKSGSCGTVVRN
MENE_BACCZ      EETYPPSLRCMXXXXXXXXXXXXEACVEKR----IPVYQTYGMTETSSICTLSADYM