[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ56219.1

[Show Plain Result]


## Summary of Sequence Search
    1::407
   99::366     1e-30  30%  371 aa  RODA_HAEIN RecName: Full=Rod shape-determining protein rodA;
   99::364     8e-24  33%  366 aa  SP5E_BACSU RecName: Full=Stage V sporulation protein E;
  115::336     3e-22  35%  393 aa  FTSW_SYNY3 RecName: Full=Probable cell division protein ftsW;
  131::396     6e-21  38%  397 aa  FTSW_CYAPA RecName: Full=Cell division protein ftsW homolog;
   98::364     2e-19  35%  370 aa  RODA_SHIFL RecName: Full=Rod shape-determining protein rodA;
   98::364     2e-19  35%  370 aa  RODA_ECOLI RecName: Full=Rod shape-determining protein rodA;
   98::364     2e-19  35%  370 aa  RODA_ECO57 RecName: Full=Rod shape-determining protein rodA;
  134::397     3e-19  31%  414 aa  FTSW_ECOLI RecName: Full=Cell division protein ftsW;
  134::397     3e-19  31%  414 aa  FTSW_ECOL6 RecName: Full=Cell division protein ftsW;
  134::397     3e-19  31%  414 aa  FTSW_ECO57 RecName: Full=Cell division protein ftsW;
  113::381     3e-18  31%  394 aa  FTSW_HAEIN RecName: Full=Cell division protein ftsW;
   95::180     2e-17  32%  433 aa  RODA_TREPA RecName: Full=Rod shape-determining protein rodA;
   73::337     3e-17  27%  353 aa  FTSW_BUCAP RecName: Full=Cell division protein ftsW;
  118::382     8e-16  28%  399 aa  FTSW_BUCAI RecName: Full=Cell division protein ftsW;
  131::394     7e-15  30%  415 aa  FTSW_MESVI RecName: Full=Cell division protein ftsW homolog;
  103::334     2e-14  35%  403 aa  YLAO_BACSU RecName: Full=Uncharacterized membrane protein ylaO;
  106::357     2e-13  32%  420 aa  FTSW_LACLA RecName: Full=Probable cell division protein ftsW;
  170::426     6e-13  30%  469 aa  FTSW_MYCTU RecName: Full=Probable cell division protein ftsW;
  170::426     6e-13  30%  469 aa  FTSW_MYCBO RecName: Full=Probable cell division protein ftsW;
  228::379     4e-12  31%  397 aa  FTSW_ENTHR RecName: Full=Probable cell division protein ftsW;
  146::348     3e-10  28%  381 aa  RODA_HELPY RecName: Full=Rod shape-determining protein rodA;
  146::339     4e-10  27%  381 aa  RODA_HELPJ RecName: Full=Rod shape-determining protein rodA;
  208::279     6e-10  36%  380 aa  FTSW_BUCBP RecName: Full=Cell division protein ftsW;
  281::380     5e-09  32%  388 aa  FTSW_HELPY RecName: Full=Probable cell division protein ftsW;
  281::382     5e-09  31%  388 aa  FTSW_HELPJ RecName: Full=Probable cell division protein ftsW;
  101::376     1e-08  29%  393 aa  YWCF_BACSU RecName: Full=Uncharacterized membrane protein ywcF;
  147::422     1e-08  27%  524 aa  FTWH_MYCTU RecName: Full=Uncharacterized ftsW-like protein
  147::422     1e-08  27%  524 aa  FTWH_MYCBO RecName: Full=Uncharacterized ftsW-like protein Mb2178c;
   96::264     3e-08  35%  364 aa  FTSW_BORBU RecName: Full=Cell division protein ftsW;
  231::446     3e-06  33%  465 aa  FTSW_MYCLE RecName: Full=Probable cell division protein ftsW;
    1::407

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RODA_HAEIN      ----------------------------------------------------------------------
SP5E_BACSU      ----------------------------------------------------------------------
FTSW_SYNY3      ----------------------------------------------------------------------
FTSW_CYAPA      ----------------------------------------------------------------------
RODA_SHIFL      ----------------------------------------------------------------------
RODA_ECOLI      ----------------------------------------------------------------------
RODA_ECO57      ----------------------------------------------------------------------
FTSW_ECOLI      ----------------------------------------------------------------------
FTSW_ECOL6      ----------------------------------------------------------------------
FTSW_ECO57      ----------------------------------------------------------------------
FTSW_HAEIN      ----------------------------------------------------------------------
RODA_TREPA      ----------------------------------------------------------------------
FTSW_BUCAP      ----------------------------------------------------------------------
FTSW_BUCAI      ----------------------------------------------------------------------
FTSW_MESVI      ----------------------------------------------------------------------
YLAO_BACSU      ----------------------------------------------------------------------
FTSW_LACLA      ----------------------------------------------------------------------
FTSW_MYCTU      ----------------------------------------------------------------------
FTSW_MYCBO      ----------------------------------------------------------------------
FTSW_ENTHR      ----------------------------------------------------------------------
RODA_HELPY      ----------------------------------------------------------------------
RODA_HELPJ      ----------------------------------------------------------------------
FTSW_BUCBP      ----------------------------------------------------------------------
FTSW_HELPY      ----------------------------------------------------------------------
FTSW_HELPJ      ----------------------------------------------------------------------
YWCF_BACSU      ----------------------------------------------------------------------
FTWH_MYCTU      ----------------------------------------------------------------------
FTWH_MYCBO      ----------------------------------------------------------------------
FTSW_BORBU      ----------------------------------------------------------------------
FTSW_MYCLE      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNGSRSWIALGDLRVQPA
RODA_HAEIN      ------------------------------------------------------GAQRWLDLGFIRFQPS
SP5E_BACSU      -----------------------------------------------------NGSRSWIGVGAFSIQPS
FTSW_SYNY3      -----------------------------------------------------NGARRWISLGPILIQPS
FTSW_CYAPA      -----------------------------------------------------NGARRWIAVYGFLVQPS
RODA_SHIFL      ------------------------------------------------------GAQRWLDLGIVRFQPS
RODA_ECOLI      ------------------------------------------------------GAQRWLDLGIVRFQPS
RODA_ECO57      ------------------------------------------------------GAQRWLDLGIVRFQPS
FTSW_ECOLI      ------------------------------------------------------GASRWIDLGLLRIQPA
FTSW_ECOL6      ------------------------------------------------------GASRWIDLGLLRIQPA
FTSW_ECO57      ------------------------------------------------------GASRWIDLGLLRIQPA
FTSW_HAEIN      -----------------------------------------------------NGAKRWISLGILNFQPA
RODA_TREPA      -----------------------------------------------------NGAKSWIGVGEFGIQIS
FTSW_BUCAP      -----------------------------------------------------HGSYRWINIGILHIQPA
FTSW_BUCAI      -----------------------------------------------------HGSFRWINIGFLHIQPS
FTSW_MESVI      -----------------------------------------------------NGASRWIAIGPILLQPS
YLAO_BACSU      -------------------------------------------------------AQSWFKIGGMSIQPG
FTSW_LACLA      -----------------------------------------------------NGARGWIHIPGITVQPA
FTSW_MYCTU      -----------------------------------------------------NGAKIWIRLPGFSIQPA
FTSW_MYCBO      -----------------------------------------------------NGAKIWIRLPGFSIQPA
FTSW_ENTHR      ----------------------------------------------------------------------
RODA_HELPY      ----------------------------------------------------------------------
RODA_HELPJ      ----------------------------------------------------------------------
FTSW_BUCBP      ----------------------------------------------------------------------
FTSW_HELPY      ----------------------------------------------------------------------
FTSW_HELPJ      ----------------------------------------------------------------------
YWCF_BACSU      ------------------------------------------------------GAKSWFRIGRITIQPS
FTWH_MYCTU      -----------------------------------------------------NGSRGWFVVAGFSMQPS
FTWH_MYCBO      -----------------------------------------------------NGSRGWFVVAGFSMQPS
FTSW_BORBU      -----------------------------------------------------SGAKRWIFFQGVSIQPS
FTSW_MYCLE      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ETAKXXXXXXXXXXXGXXXXXXXXXXASDVLISLGVAAVPIGLILLQPDLGSALVLTAIYLALLACSGAP
RODA_HAEIN      EIVKLAVPLMVAVYLGNRPLPPKL---SETFIAIAMILLPTLLVAIQPDLGTSILVSASGLFVVFLAG--
SP5E_BACSU      EFMKLAMIAFLAKFLSEKQKNITSFRRGFVP-ALGIVFSAFLIIMCQPDLGTGTVMVGTCIVMIFVAGAR
FTSW_SYNY3      EFMKPCLVLQAANLFGNWHRFPWRSR----LIWLGIFALTLGSILLQPNLSTALCGMGLWLIALA-SGLP
FTSW_CYAPA      ELIKPFWVLQISKIFGQWEFLTTRTKIFWLIIFL----IQIVAVLIQPNLSTASLLGITLWLMGLCANFP
RODA_SHIFL      EIAKIAVPLMVARFINRDVCPPSLKNTG---IALVLIFMPTLLVAAQPDLGTSIXXXXXXXXXXXXXXXS
RODA_ECOLI      EIAKIAVPLMVARFINRDVCPPSLKNTG---IALVLIFMPTLLVAAQPDLGTSIXXXXXXXXXXXXXXXS
RODA_ECO57      EIAKIAVPLMVARFINRDVCPPSLKNTG---IALVLIFMPTLLVAAQPDLGTSIXXXXXXXXXXXXXXXS
FTSW_ECOLI      ELTKLSLFCYIANYL-VRKGDEVRNNLRGFLKPMGVIXXXXXXXXXQPDLGXXXXXXXXXXXXXXXXGAK
FTSW_ECOL6      ELTKLSLFCYIANYL-VRKGDEVRNNLRGFLKPMGVIXXXXXXXXXQPDLGXXXXXXXXXXXXXXXXGAK
FTSW_ECO57      ELTKLSLFCYIANYL-VRKGDEVRNNLRGFLKPMGVIXXXXXXXXXQPDLGXXXXXXXXXXXXXXXXGAK
FTSW_HAEIN      EFAKLALTCFLASYFTRRYDEVRSRHVS--IFKPFIVMLVLGFLLLQPDLGSTVVLFIIMSGMLFIVGAK
RODA_TREPA      EFAKIAYILYLAHYLVYSQSEPMLKRFAKAGV---ITLLPMALILSQPDLGTASVYLPIFLVMCFIAGFP
FTSW_BUCAP      EICKISSFFYISNYLSRKTNEVRNNFWG-FLKPITIIIIQSVLLLAEPDLGTVIXXXXXXXXXXXXXGVX
FTSW_BUCAI      EICKISSFCYLASYLSRKSNEVRNNFWG-FFKPMSVIITQSMLLLAEPDLGTVVVLFFTTISVLFLSGAK
FTSW_MESVI      EIIKPFLILQSSYIFSQWDNISY----SKKIFWVXXXXXXXXXXXXQPNLSTASLCGAIIWLVALTAGIH
YLAO_BACSU      EFVKLVVILYLAAVYAKKQSYIDHLLTG-VAPPVVMTLIICGLIAMQPDFGTAMIIGLIATCMILCSGFS
FTSW_LACLA      EFAKVFIIWYLASVFSTKQEEIEKRDINEIFKGFGGWRLPVVAILLMPDLGNTLIIAAVALIMIGASGIS
FTSW_MYCTU      EFSKILLLIFFSAVLGKHLLGMTXXXXXXXXXXXXXWVISVGVMVFEKDLGASLLLYTSFLVVVYLATQR
FTSW_MYCBO      EFSKILLLIFFSAVLGKHLLGMTXXXXXXXXXXXXXWVISVGVMVFEKDLGASLLLYTSFLVVVYLATQR
FTSW_ENTHR      ----------------------------------------------------------------------
RODA_HELPY      --------------------------------------LPAALILKQPDLGTALIVLIMGFGILLIVGLR
RODA_HELPJ      --------------------------------------LPAALILKQPDLGTALIVLIMGFGILLIVGLR
FTSW_BUCBP      ----------------------------------------------------------------------
FTSW_HELPY      ----------------------------------------------------------------------
FTSW_HELPJ      ----------------------------------------------------------------------
YWCF_BACSU      EFMKVGLIMMLASVIGKANPKGVRTLRDDIHLLLGVAVIPVGLILMQ-DAGTAGICMFIVLVMVFMSG--
FTWH_MYCTU      ELAKMAFAIWGAHLLAARRMERASLREMXXXXXXXXXXXXXXXXX-QPDLGQTVSMXXXXXXXXWYAGLP
FTWH_MYCBO      ELAKMAFAIWGAHLLAARRMERASLREMXXXXXXXXXXXXXXXXX-QPDLGQTVSMXXXXXXXXWYAGLP
FTSW_BORBU      EIFKISFTIYLSAYLSKFDPRKNNGISYWIKPML-IFAIFWVLIILQNDYSTAIYFAILFFIVLFVSNMA
FTSW_MYCLE      --------------------------------------ISVSVMVFEKDLGTSLLLYASFLVVVYLATQR


                         .         .         .         +         .         .         .:280
query           LRWPLALLGCGAFTGLAVWQLGLLKDYQVARFTAFLDPHADPLGAGYNVNQALIAVXXXXXXXXXXXXXX
RODA_HAEIN      MSWWLILAAVIGLAGIPIMWLYLMHDYQRTRVLTLLDPEKDPLGAGYHILQSKIAIGSGGLSGKGWMQGT
SP5E_BACSU      IAHFLGLIGLSGFVGLV-----LSAPYRIKRITSYLNPWEDPLGSGFQIIQSLYAVXXXXXXXXXXXQSR
FTSW_SYNY3      WIYLISTALLGITT--AVTSISI-RDYQRARVTSFLDPFADPRGDGYQLVQSLYAIASGGVLGRGFGMSQ
FTSW_CYAPA      WKY---LLGT-VFVGLSMAITSILKPYQLSRITSFLDPWKDPRGKGYQLVQSLXXXXXXXXXXXXXXXXL
RODA_SHIFL      WRLGVAVVLVAAFIPI-LWFF-LMHDYQRQRVMMLLDPESDPLGAGYHIIQSKIAIGSGGLRGKGWLHGT
RODA_ECOLI      WRLGVAVVLVAAFIPI-LWFF-LMHDYQRQRVMMLLDPESDPLGAGYHIIQSKIAIGSGGLRGKGWLHGT
RODA_ECO57      WRLGVAVVLVAAFIPI-LWFF-LMHDYQRQRVMMLLDPESDPLGAGYHIIQSKIAIGSGGLRGKGWLHGT
FTSW_ECOLI      LWQFIAIIGMGIS---AVVLLILAEPYRIRRVTAFWNPWEDPFGSGYQLTQSLMAFGRGELWGQGLGNSV
FTSW_ECOL6      LWQFIAIIGMGIS---AVVLLILAEPYRIRRVTAFWNPWEDPFGSGYQLTQSLMAFGRGELWGQGLGNSV
FTSW_ECO57      LWQFIAIIGMGIS---AVVLLILAEPYRIRRVTAFWNPWEDPFGSGYQLTQSLMAFGRGELWGQGLGNSV
FTSW_HAEIN      ILQFVGLIALGGI--LFVW-LVLTASYRLKRFIGFLEPFKEPYGTGFQLTNSLIAFGRGEITGEGLGNSI
RODA_TREPA      LR------------GASLLGVRVLKPYQMMRLIIFLNPEVDPLKAGWHIIQSMIAIGSGGAFGMGYLRGP
FTSW_BUCAP      XXXXXXXXXX---VTLIITALVLFEPYRIKRILSFWNPWKDPFGNGYQLTQSLIALGRGHFFGQGLGNSI
FTSW_BUCAI      IG---QFFXXXXXXXXXXXXXXXXEPYRIKRVLSFWNPWEDPFGNGYQLTQSLIALGRGNFLGQGLGNSI
FTSW_MESVI      WFYLNSILSIGAVTALI--SLGS-QEYQRQRIISFLNPWANPTSIGYQLVQSLLAVGSGRLTGSGISCSY
YLAO_BACSU      GKTLVRLVILGGIVFILVSQDKILTEGRLARFESLEDPFKYANSSGLQVINSYYAXXXXXXXXXXXXXXX
FTSW_LACLA      WRWKLILSLMAIFLGFLFIVGGLPITYINKRFEAFVNPFTDLANSGHQLANSYYAIVNGGWTGRGLGNSI
FTSW_MYCTU      FSWVVI--------GLTLFAAGTLVAYFILRVQTWLDPFADPDGTGYQIVQSLFSFATXXXXXXXXXXXQ
FTSW_MYCBO      FSWVVI--------GLTLFAAGTLVAYFILRVQTWLDPFADPDGTGYQIVQSLFSFATXXXXXXXXXXXQ
FTSW_ENTHR      ------------------------------------NPFLDEHGAGYQMSNSYYALYNGGLFGRGMGNSI
RODA_HELPY      TRVWLPL-----FIALLVASYHFLHDYQKKRIADFLSEKPN-----YHVMQSIIAIGSGGFLGKSKEACT
RODA_HELPJ      TRVWLPLLIALIVASPIAYHF--LHDYQKKRIADFLSEKPN-----YHVMQSIIAIGSGGFLGKSKEACT
FTSW_BUCBP      --------------------------YRFERIMSFWNPWNDPFGKGYQLTQSLMALGRGNIFGMGLGHSI
FTSW_HELPY      ----------------------------------------------------------------------
FTSW_HELPJ      ----------------------------------------------------------------------
YWCF_BACSU      INWKXXXXXXXXXXXXXXXXXXVIQDYQIKRVTSWVNETQEDSNDSWQVDQAIMAXXXXXXXXXXXXXXK
FTWH_MYCTU      LR---VFXXXXXXXXXXXXXXXXXXGYRSDRVRSWLNPENDPQDSGYQARQAKFALAQXXXXXXXXXXXV
FTWH_MYCBO      LR---VFXXXXXXXXXXXXXXXXXXGYRSDRVRSWLNPENDPQDSGYQARQAKFALAQXXXXXXXXXXXV
FTSW_BORBU      FSYVFAIV----VTFLPVSAIFLLEPYRVSRIFAFLNPYDDPSGKGYQIIASLNAXXXXXXXXXXXXXXE
FTSW_MYCLE      LSW--VIIGLVLFTAGSTIAYFTFEHIRV-RMQVWWDPFTNLDVGGYQIVQSLFSFATXXXXXXXXXXXQ


                         .         *         .         .         .         .         +:350
query           QTSGKFVPEQHTDFVFSVAAEELGFAGGCAXXXXXXXXXXXXXXXASRCDEVHGRLVCIGVAAWFCVQVF
RODA_HAEIN      QSQLEFLPEPHTDFIFAVMGEEHGMIGFLILMAIYLFIIVRGLMIAVNAQTSFGRILAGATTLIFFVYVF
SP5E_BACSU      Q-KFFYLPEPQTDFIFAILSEEXXXXXXXXXXXXXSVLLWRGIRIALGAPDLYGSFVAVGIISMIAIQVM
FTSW_SYNY3      QKL-FYLPIQTTDFIFAVFAEEFGLVGCITFLAFLGLFTTMGLRVAMRCRHRVKRLIGLGVVIFLVGQSL
FTSW_CYAPA      QKTG-YLPIHYTDFIFAVYIEEFGFIGAVSXXXXXXXXXXXXXXXXXKTNHPVLRLVGCGAIILLMIQTL
RODA_SHIFL      QSQLEFLPERHTDFIFAXXXXXXXXXXXXXXXXXXXXXXMRGLWIAARAQTTFGRVMAGGLMLILFVYVF
RODA_ECOLI      QSQLEFLPERHTDFIFAXXXXXXXXXXXXXXXXXXXXXXMRGLWIAARAQTTFGRVMAGGLMLILFVYVF
RODA_ECO57      QSQLEFLPERHTDFIFAXXXXXXXXXXXXXXXXXXXXXXMRGLWIAARAQTTFGRVMAGGLMLILFVYVF
FTSW_ECOLI      QKL-EYLPEAHTDFIFAIIGEELGYXXXXXXXXXXXXXXXXXMSIGRKALEIDHRFLACSIGIWFSFQAL
FTSW_ECOL6      QKL-EYLPEAHTDFIFAIIGEELGYXXXXXXXXXXXXXXXXXMSIGRKALEIDHRFLACSIGIWFSFQAL
FTSW_ECO57      QKL-EYLPEAHTDFIFAIIGEELGYXXXXXXXXXXXXXXXXXMSIGRKALEIDHRFLACSIGIWFSFQAL
FTSW_HAEIN      QKL-DYLPEAHTDFIMAXXXXXXXXXXXXXXXXXXXXXXXRAMKIGRESLMLEQRFFALGIGFWIFFQGF
RODA_TREPA      QSHYRFLPQQSTDFIFSILSEEWGFVGGVIVFGLYLLFFLHTLSIMSHVDDLYGKLIASGVLGMFLFHFV
FTSW_BUCAP      QKL-NYLPEAHSDFIFSIIGEELGYIGCXXXXXXXXXXSFRAMYIGQQSFEVFSGFLACSIGLWFSFQTL
FTSW_BUCAI      QKL-DYLPDAHSDFIFSIIGEELGYXXXXXXXXXXXXXXXRAMYIGQKALEFSGFLAC-SIGIWLSFQTS
FTSW_MESVI      QKL-FYLPIQYTDFIFSVFSEEFGLLGAXXXXXXXXXXXXXGMIVVLSNKSKVNRLLALGCIMVLVGQSL
YLAO_BACSU      QKYG-YLPESHTDFIMAVIAEEXXXXXXXXXXXXXXXXXXKGFYIARKCEDPFGSLLAIGISSMIAIQSF
FTSW_LACLA      QKNG-FLPEAQTDFIFPIVVEEXXXXXXXXXXXXXXXXXSRMLIVGIRAKSAFNSLIMIGVSGLLLVQVF
FTSW_MYCTU      PDT---VPAASTDFIIAAFGEELGLVGLTAILMLYTIVIIRGLRTAIATRDSFGKLLAAGLSSTLAIQLF
FTSW_MYCBO      PDT---VPAASTDFIIAAFGEELGLVGLTAILMLYTIVIIRGLRTAIATRDSFGKLLAAGLSSTLAIQLF
FTSW_ENTHR      TKKG-YLPESETDFIFSVIAEEFGLIGAXXXXXXXXXXCMRIFQKSTKQKNQQANLILIGVGTWILVQTS
RODA_HELPY      QTKFKFLPIATSDFIFAYFVERFGFLGAMLLFAIYIGLSLHLFFYLFESNDWFLKIVALGISILIFVYSS
RODA_HELPJ      QTKFKFLPIATSDFIFAYFVERFGFLGAILLFAIYIGLSLHLFFYLFESNDWFLKIVALGISILIFVYSS
FTSW_BUCBP      QKL-EYLPEAHTDFIFAIIGEELGYIGAC-----------------------------------------
FTSW_HELPY      --------EVHTDMVLAGIAEEWGFLGLCVCFILFSVLIVLIFRIANRLKEPKYSLFCVGVVLLISFSLV
FTSW_HELPJ      --------EVHTDMVLAGIAEEWGFLGLCVCFILFSVMIVLIFRIANRLKEPKYSLFCVGVVLLIGFSLV
YWCF_BACSU      ----VYVPESTTD-XXXXXXXXXXXXXXCAIVVIMFFFLIYRLVVL--IDKIHASFFCVGYTALIVIHTF
FTWH_MYCTU      -AKWNYLPNAHNDFIFAIIXXXXXXXXXXXXXXXXXXXXYTGMRIASRSADPFLRLLTATTTLWVLGQAF
FTWH_MYCBO      -AKWNYLPNAHNDFIFAIIXXXXXXXXXXXXXXXXXXXXYTGMRIASRSADPFLRLLTATTTLWVLGQAF
FTSW_BORBU      VKLGK-LPEANSDFIFS-----------------------------------------------------
FTSW_MYCLE      PDA---IPAASTDFIIXXXXXXXXXXXXXXXXXXYTIVIVRGLRTAIATRDSFGKLLAAGLASTLAIQLF


                         .         .         .         .         *         .         .:420
query           VNIXXXXXXXXXXXXXXXFVSYGGSAAVANFAALGLVMAVHAHNEERRSLEPAGxxx
RODA_HAEIN      VNIGMVSGILPVVGVPLPLFSYGGTSYVAIMASFGLLMSIHTHKSQ-----------
SP5E_BACSU      INIGVVTGLIPVTGITLPFLSYGGSSLTLMLMAVGVLLNVSRYS-------------
FTSW_SYNY3      LNI------------------------------------------------------
FTSW_CYAPA      LNMAVATGIFPTTGLPLPFFSYGGNALLANLINCSFLIRLALETKDR----------
RODA_SHIFL      VNIGMXXXXXXXXXXXXXXXXXXXSALIVLMAGFGIVMSIHTHRK------------
RODA_ECOLI      VNIGMXXXXXXXXXXXXXXXXXXXSALIVLMAGFGIVMSIHTHRK------------
RODA_ECO57      VNIGMXXXXXXXXXXXXXXXXXXXSALIVLMAGFGIVMSIHTHRK------------
FTSW_ECOLI      VNVGAAAGMLPTKGLTLPLISYGGSSLLIMSTAIMMLLRI-----------------
FTSW_ECOL6      VNVGAAAGMLPTKGLTLPLISYGGSSLLIMSTAIMMLLRI-----------------
FTSW_ECO57      VNVGAAAGMLPTKGLTLPLISYGGSSLLIMSTAIMMLLRI-----------------
FTSW_HAEIN      VNLGMALGMLPTKGLTFPLVSYGGSSIIIMSATIGILLRIDHEN-------------
RODA_TREPA      VNV------------------------------------------------------
FTSW_BUCAP      INIGAVTGILPTKGLTLPLISYGGSSLIVNLMAICILLRI-----------------
FTSW_BUCAI      INVGSVTGILPTKGLTLPFISYGGSSLIINSIAIFFLLRI-----------------
FTSW_MESVI      INIGVSVGILPTTGLPLPFFSYGGNSILATFFVSAILIRVAIETE------------
YLAO_BACSU      INL------------------------------------------------------
FTSW_LACLA      VNV------------------------------------------------------
FTSW_MYCTU      IVVGGVTRLIPLTGLTTPWMSYGGSS-------------------------------
FTSW_MYCBO      IVVGGVTRLIPLTGLTTPWMSYGGSS-------------------------------
FTSW_ENTHR      INIGSILGLIPMTGVPLPFVSYGGTSYLILSFAIGLALNISSRQVKEKN--------
RODA_HELPY      VNIAMTLGLAPVVGIPLPLFSYGGSSFITFMILFGIL--------------------
RODA_HELPJ      VNIAMTLGLAPVVGIPLPLFSYGGSSFI-----------------------------
FTSW_BUCBP      ---------------------------------------------------------
FTSW_HELPY      INAFGVGGILPVKGLAVPFLSYGGSSLLANCIAIGLVL-------------------
FTSW_HELPJ      INAFGVGGIFPVKGLAVPFLSYGGSSLLANCIAIGLVLSL-----------------
YWCF_BACSU      QNIGMNIGIMPVTGIPLLFVSYGGSSTLSTLIGFGIV--------------------
FTWH_MYCTU      INIGYVIGLLPVTGLQLPLISAGGTSTAATLSLIGIIANAARHEPEAVAALRAG---
FTWH_MYCBO      INIGYVIGLLPVTGLQLPLISAGGTSTAATLSLIGIIANAARHEPEAVAALRAG---
FTSW_BORBU      ---------------------------------------------------------
FTSW_MYCLE      IVSXXXXXXXXXXXXXXPWMSYGGSSLLANYVLLAILARIHSARHPLRS--------