[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ56286.1

[Show Plain Result]


## Summary of Sequence Search
    1::430
   10::366     2e-39  34%  383 aa  AAT_THEAQ RecName: Full=Aspartate aminotransferase;       
   14::367     2e-35  37%  385 aa  AAT_THET8 RecName: Full=Aspartate aminotransferase;       
   15::386     3e-35  31%  392 aa  AAT_BACY2 RecName: Full=Aspartate aminotransferase;       
   13::384     7e-33  31%  393 aa  AAT1_BACSU RecName: Full=Aspartate aminotransferase;       
   15::364     2e-30  30%  394 aa  AAT_AQUAE RecName: Full=Aspartate aminotransferase;       
    9::327     3e-30  35%  393 aa  AAT_BACST RecName: Full=Aspartate aminotransferase;       
   11::397     8e-30  31%  400 aa  AATA_RHIME RecName: Full=Aspartate aminotransferase A;       
   10::389     2e-27  30%  389 aa  AAT_SYNY3 RecName: Full=Aspartate aminotransferase;       
   24::372     5e-27  29%  391 aa  AAT_PYRHO RecName: Full=Aspartate aminotransferase;       
   28::373     2e-26  31%  389 aa  AAT_PYRAB RecName: Full=Aspartate aminotransferase;       
   11::381     7e-26  30%  400 aa  AAT_RHILP RecName: Full=Aspartate aminotransferase;       
   20::410     1e-25  30%  410 aa  AATB1_RHIME RecName: Full=Aspartate aminotransferase B;       
   11::331     1e-25  29%  402 aa  AAT_SULSO RecName: Full=Aspartate aminotransferase;       
   27::395     3e-23  30%  397 aa  AAT_STRVG RecName: Full=Aspartate aminotransferase;       
   12::362     5e-23  26%  399 aa  AAT_SULTO RecName: Full=Aspartate aminotransferase;       
   20::404     2e-22  28%  410 aa  AATB2_RHIME RecName: Full=Aspartate aminotransferase B;       
   45::361     6e-21  30%  429 aa  AAT_MYCTU RecName: Full=Probable aspartate aminotransferase;       
   45::361     6e-21  30%  429 aa  AAT_MYCBO RecName: Full=Probable aspartate aminotransferase;       
    9::244     5e-20  33%  377 aa  AAT_THEMA RecName: Full=Aspartate aminotransferase;       
   28::347     7e-20  27%  375 aa  AAT1_METJA RecName: Full=Probable aspartate aminotransferase 1;    
   10::382     2e-19  27%  401 aa  AAT_RICCN RecName: Full=Aspartate aminotransferase;       
   10::382     5e-19  25%  409 aa  AAT_RICFE RecName: Full=Aspartate aminotransferase;       
   10::382     5e-19  26%  399 aa  AAT_RICBR RecName: Full=Aspartate aminotransferase;       
   10::332     8e-19  27%  400 aa  AAT_SULAC RecName: Full=Aspartate aminotransferase;       
   18::357     2e-18  28%  386 aa  DAPAT_NATTJ RecName: Full=LL-diaminopimelate aminotransferase;     
   10::382     2e-18  26%  399 aa  AAT_RICTY RecName: Full=Aspartate aminotransferase;       
   10::382     2e-18  25%  399 aa  AAT_RICPR RecName: Full=Aspartate aminotransferase;       
   21::324     2e-18  31%  364 aa  AAT_PYRKO RecName: Full=Aspartate aminotransferase;       
   27::345     4e-18  29%  390 aa  DAPT2_ANAVT RecName: Full=LL-diaminopimelate aminotransferase 2;   
   18::351     5e-18  28%  390 aa  DAPAT_MOOTA RecName: Full=LL-diaminopimelate aminotransferase;     
   27::359     1e-17  27%  390 aa  DAPT2_ANASP RecName: Full=LL-diaminopimelate aminotransferase 2;   
   20::286     1e-17  30%  388 aa  DAPAT_SYNFM RecName: Full=LL-diaminopimelate aminotransferase;     
   23::249     3e-17  29%  392 aa  DAPAT_GLOVI RecName: Full=LL-diaminopimelate aminotransferase;     
   54::336     7e-17  25%  405 aa  YFBQ_SHIFL RecName: Full=Uncharacterized aminotransferase yfbQ;    
   54::336     7e-17  25%  405 aa  YFBQ_ECOLI RecName: Full=Uncharacterized aminotransferase yfbQ;    
   54::336     7e-17  25%  405 aa  YFBQ_ECOL6 RecName: Full=Uncharacterized aminotransferase yfbQ;    
   21::360     7e-17  28%  388 aa  DAPAT_DESVV RecName: Full=LL-diaminopimelate aminotransferase;     
   21::360     7e-17  28%  388 aa  DAPAT_DESVH RecName: Full=LL-diaminopimelate aminotransferase;     
   21::340     6e-16  25%  404 aa  Y286_HAEIN RecName: Full=Uncharacterized aminotransferase HI0286;  
   29::294     6e-16  27%  387 aa  DAPAT_AQUAE RecName: Full=LL-diaminopimelate aminotransferase;     
   18::303     8e-16  28%  390 aa  DAPAT_CARHZ RecName: Full=LL-diaminopimelate aminotransferase;     
   30::349     2e-15  25%  393 aa  PATA_BACSU RecName: Full=Putative aminotransferase A;       
   21::305     7e-15  27%  388 aa  DAPAT_DESDG RecName: Full=LL-diaminopimelate aminotransferase;     
  148::345     9e-15  31%  495 aa  1A112_ARATH RecName: Full=Probable aminotransferase ACS12;       
   36::305     3e-14  27%  408 aa  DAPAT_PROMA RecName: Full=LL-diaminopimelate aminotransferase;     
   69::263     4e-14  34%  416 aa  ATTY_TRYCR RecName: Full=Tyrosine aminotransferase;       
   21::362     8e-14  27%  388 aa  DAPAT_DESAD RecName: Full=LL-diaminopimelate aminotransferase;     
   60::307     1e-13  30%  370 aa  HIS8_GRABC RecName: Full=Histidinol-phosphate aminotransferase;    
   18::301     1e-13  25%  404 aa  DAPAT_EUBE2 RecName: Full=LL-diaminopimelate aminotransferase;     
   14::235     2e-13  34%  359 aa  PATR_STRCO RecName: Full=Putative phenylalanine aminotransferase;  
   18::250     2e-13  28%  389 aa  DAPAT_HALOH RecName: Full=LL-diaminopimelate aminotransferase;     
   36::317     2e-13  26%  408 aa  DAPAT_SYNPW RecName: Full=LL-diaminopimelate aminotransferase;     
   19::353     2e-13  30%  370 aa  AAT2_METJA RecName: Full=Probable aspartate aminotransferase 2;    
   36::305     3e-13  28%  408 aa  DAPAT_SYNS9 RecName: Full=LL-diaminopimelate aminotransferase;     
   21::361     3e-13  26%  389 aa  DAPAT_DESVM RecName: Full=LL-diaminopimelate aminotransferase;     
   31::366     4e-13  27%  412 aa  YFDZ_ECOLI RecName: Full=Uncharacterized aminotransferase yfdZ;    
   18::250     4e-13  27%  388 aa  DAPAT_DEHSC RecName: Full=LL-diaminopimelate aminotransferase;     
   18::250     4e-13  27%  388 aa  DAPAT_DEHSB RecName: Full=LL-diaminopimelate aminotransferase;     
   43::235     5e-13  31%  359 aa  PATR_STRAW RecName: Full=Putative phenylalanine aminotransferase;  
   81::316     5e-13  30%  454 aa  ATTY_MOUSE RecName: Full=Tyrosine aminotransferase;       
   36::305     8e-13  28%  408 aa  DAPAT_SYNR3 RecName: Full=LL-diaminopimelate aminotransferase;     
   18::250     8e-13  28%  388 aa  DAPAT_DEHE1 RecName: Full=LL-diaminopimelate aminotransferase;     
   35::265     1e-12  31%  386 aa  YBDL_ECOLI RecName: Full=Aminotransferase ybdL;         EC=2.6.1.-;
   63::330     1e-12  23%  450 aa  KAT3_DANRE RecName: Full=Kynurenine--oxoglutarate transaminase 3;  
   77::320     1e-12  33%  461 aa  DAPAT_ARATH RecName: Full=LL-diaminopimelate aminotransferase,
   81::316     1e-12  30%  454 aa  ATTY_RAT RecName: Full=Tyrosine aminotransferase;       
   68::389     2e-12  27%  422 aa  KAT1_HUMAN RecName: Full=Kynurenine--oxoglutarate transaminase 1;  
   43::235     2e-12  32%  359 aa  PATR_STRGG RecName: Full=Putative phenylalanine aminotransferase;  
   36::389     2e-12  25%  424 aa  KAT1_MOUSE RecName: Full=Kynurenine--oxoglutarate transaminase 1;  
   36::305     2e-12  27%  408 aa  DAPAT_PROM4 RecName: Full=LL-diaminopimelate aminotransferase;     
   81::316     2e-12  30%  454 aa  ATTY_HUMAN RecName: Full=Tyrosine aminotransferase;       
   37::337     3e-12  25%  418 aa  Y1391_METJA RecName: Full=Uncharacterized aminotransferase MJ1391; 
   18::360     3e-12  27%  405 aa  AATC_RHIME RecName: Full=Putative aminotransferase aatC;       
  102::274     4e-12  27%  482 aa  ALA2_HORVU RecName: Full=Alanine aminotransferase 2;       
   36::305     5e-12  25%  408 aa  DAPAT_SYNS3 RecName: Full=LL-diaminopimelate aminotransferase;     
  135::440     5e-12  28%  444 aa  BNA3_YEAST RecName: Full=Probable kynurenine--oxoglutarate
  102::298     7e-12  30%  457 aa  KAT1_RAT RecName: Full=Kynurenine--oxoglutarate transaminase 1,
   56::234     9e-12  32%  356 aa  HIS8_LACPL RecName: Full=Histidinol-phosphate aminotransferase;    
   72::240     9e-12  34%  372 aa  HIS8_ARTAT RecName: Full=Histidinol-phosphate aminotransferase;    
   36::317     1e-11  26%  411 aa  DAPAT_NOSP7 RecName: Full=LL-diaminopimelate aminotransferase;     
   29::240     2e-11  31%  363 aa  HIS8_MAGSA RecName: Full=Histidinol-phosphate aminotransferase;    
   76::267     2e-11  29%  417 aa  ATTY_DICDI RecName: Full=Tyrosine aminotransferase;       
   74::283     2e-11  31%  447 aa  ATTY_BOVIN RecName: Full=Tyrosine aminotransferase;       
   98::266     2e-11  30%  482 aa  ALA2_PANMI RecName: Full=Alanine aminotransferase 2;       
   36::301     2e-11  29%  409 aa  DAPAT_DESOH RecName: Full=LL-diaminopimelate aminotransferase;     
   66::254     3e-11  30%  401 aa  Y104_SULSO RecName: Full=Uncharacterized aminotransferase SSO0104; 
   35::227     3e-11  37%  361 aa  PATR_LEIXX RecName: Full=Putative phenylalanine aminotransferase;  
   40::243     3e-11  32%  367 aa  HIS8_METAC RecName: Full=Histidinol-phosphate aminotransferase;    
  213::405     3e-11  33%  568 aa  1A1L2_HUMAN RecName: Full=1-aminocyclopropane-1-carboxylate
   36::305     4e-11  26%  411 aa  DAPAT_CYAP4 RecName: Full=LL-diaminopimelate aminotransferase;     
   38::239     5e-11  31%  358 aa  PATR_MYCSS RecName: Full=Putative phenylalanine aminotransferase;  
   38::239     5e-11  31%  358 aa  PATR_MYCSK RecName: Full=Putative phenylalanine aminotransferase;  
   38::239     5e-11  31%  358 aa  PATR_MYCSJ RecName: Full=Putative phenylalanine aminotransferase;  
   58::230     5e-11  34%  360 aa  HIS8_CHLPD RecName: Full=Histidinol-phosphate aminotransferase;    
   20::281     5e-11  30%  410 aa  DAPAT_THEEB RecName: Full=LL-diaminopimelate aminotransferase;     
   31::251     5e-11  30%  399 aa  AAT2_BACSU RecName: Full=Probable aspartate aminotransferase;      
   97::243     6e-11  36%  382 aa  HIS8_MYCUA RecName: Full=Histidinol-phosphate aminotransferase;    
   36::304     6e-11  28%  408 aa  DAPAT_DESDA RecName: Full=LL-diaminopimelate aminotransferase;     
   32::232     8e-11  30%  368 aa  HIS8_RHORT RecName: Full=Histidinol-phosphate aminotransferase;    
   97::243     8e-11  36%  382 aa  HIS8_MYCMM RecName: Full=Histidinol-phosphate aminotransferase;    
    9::238     8e-11  30%  366 aa  HIS8_CORDI RecName: Full=Histidinol-phosphate aminotransferase;    
   36::319     8e-11  29%  411 aa  DAPAT_SYNP6 RecName: Full=LL-diaminopimelate aminotransferase;     
   36::319     8e-11  29%  411 aa  DAPAT_SYNE7 RecName: Full=LL-diaminopimelate aminotransferase;     
   36::305     8e-11  24%  408 aa  DAPAT_PROM3 RecName: Full=LL-diaminopimelate aminotransferase;     
   41::254     1e-10  29%  368 aa  HIS8_METMA RecName: Full=Histidinol-phosphate aminotransferase;    
   10::238     1e-10  29%  357 aa  HIS8_LEUMM RecName: Full=Histidinol-phosphate aminotransferase;    
   27::246     1e-10  29%  398 aa  DAPAT_CHLFF RecName: Full=LL-diaminopimelate aminotransferase;     
  117::288     1e-10  31%  496 aa  ALAT1_HUMAN RecName: Full=Alanine aminotransferase 1;       
  117::288     1e-10  29%  496 aa  ALAT1_BOVIN RecName: Full=Alanine aminotransferase 1;       
  101::326     1e-10  27%  455 aa  KAT3_MOUSE RecName: Full=Kynurenine--oxoglutarate transaminase 3;  
  100::325     1e-10  26%  455 aa  KAT3_BOVIN RecName: Full=Kynurenine--oxoglutarate transaminase 3;  
   39::252     1e-10  30%  366 aa  HIS8_METBF RecName: Full=Histidinol-phosphate aminotransferase;    
   36::317     1e-10  24%  408 aa  DAPAT_SYNPX RecName: Full=LL-diaminopimelate aminotransferase;     
   25::263     1e-10  28%  411 aa  DAPAT_PARUW RecName: Full=LL-diaminopimelate aminotransferase;     
   36::305     2e-10  24%  412 aa  DAPAT_SYNY3 RecName: Full=LL-diaminopimelate aminotransferase;     
   36::327     2e-10  30%  410 aa  DAPAT_GEOSF RecName: Full=LL-diaminopimelate aminotransferase;     
   78::245     2e-10  31%  380 aa  HIS8_RHOSR RecName: Full=Histidinol-phosphate aminotransferase;    
   72::235     2e-10  33%  357 aa  HIS8_PELLD RecName: Full=Histidinol-phosphate aminotransferase;    
   36::305     2e-10  26%  411 aa  DAPAT_TRIEI RecName: Full=LL-diaminopimelate aminotransferase;     
   36::317     2e-10  25%  416 aa  DAPAT_SYNJB RecName: Full=LL-diaminopimelate aminotransferase;     
   36::305     2e-10  26%  411 aa  DAPAT_SYNJA RecName: Full=LL-diaminopimelate aminotransferase;     
   20::215     2e-10  29%  392 aa  DAPAT_DESAP RecName: Full=LL-diaminopimelate aminotransferase;     
   35::305     2e-10  24%  409 aa  DAPAT_ACAM1 RecName: Full=LL-diaminopimelate aminotransferase;     
   36::305     3e-10  24%  408 aa  DAPAT_PROMM RecName: Full=LL-diaminopimelate aminotransferase;     
   38::213     3e-10  31%  213 aa  AAT_STRGR RecName: Full=Probable aspartate aminotransferase;       
   34::237     4e-10  31%  361 aa  HIS8_UNCMA RecName: Full=Histidinol-phosphate aminotransferase;    
   63::231     4e-10  34%  361 aa  HIS8_SYMTH RecName: Full=Histidinol-phosphate aminotransferase;    
   85::233     4e-10  35%  351 aa  HIS8_RUBXD RecName: Full=Histidinol-phosphate aminotransferase;    
   35::305     4e-10  24%  410 aa  DAPAT_SYNP2 RecName: Full=LL-diaminopimelate aminotransferase;     
  144::314     4e-10  34%  522 aa  ALAT2_MOUSE RecName: Full=Alanine aminotransferase 2;       
   36::303     5e-10  27%  408 aa  DAPAT_LEPBL RecName: Full=LL-diaminopimelate aminotransferase;     
   36::303     5e-10  27%  408 aa  DAPAT_LEPBJ RecName: Full=LL-diaminopimelate aminotransferase;     
  144::315     5e-10  34%  523 aa  ALAT2_HUMAN RecName: Full=Alanine aminotransferase 2;       
   38::226     7e-10  32%  347 aa  PATR_MYCA9 RecName: Full=Putative phenylalanine aminotransferase;  
   70::238     7e-10  33%  366 aa  HIS8_CORGL RecName: Full=Histidinol-phosphate aminotransferase;    
   18::301     7e-10  27%  404 aa  DAPAT_EUBR3 RecName: Full=LL-diaminopimelate aminotransferase;     
   35::255     7e-10  29%  394 aa  DAPAT_CHLTB RecName: Full=LL-diaminopimelate aminotransferase;     
   35::255     7e-10  29%  394 aa  DAPAT_CHLT2 RecName: Full=LL-diaminopimelate aminotransferase;     
   97::290     7e-10  32%  494 aa  1A12_CUCPE RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   70::238     9e-10  32%  366 aa  HIS8_CORGB RecName: Full=Histidinol-phosphate aminotransferase;    
   36::303     9e-10  27%  408 aa  DAPAT_LEPIC RecName: Full=LL-diaminopimelate aminotransferase;     
   35::255     9e-10  29%  394 aa  DAPAT_CHLTR RecName: Full=LL-diaminopimelate aminotransferase;     
   35::255     9e-10  29%  394 aa  DAPAT_CHLTA RecName: Full=LL-diaminopimelate aminotransferase;     
  117::288     9e-10  34%  496 aa  ALAT1_MOUSE RecName: Full=Alanine aminotransferase 1;       
   61::236     1e-09  33%  364 aa  HIS8_ACICJ RecName: Full=Histidinol-phosphate aminotransferase;    
   36::305     1e-09  25%  408 aa  DAPAT_SYNSC RecName: Full=LL-diaminopimelate aminotransferase;     
   27::246     1e-09  26%  398 aa  DAPAT_CHLAB RecName: Full=LL-diaminopimelate aminotransferase;     
   95::289     1e-09  31%  491 aa  1A1C_TOBAC RecName: Full=1-aminocyclopropane-1-carboxylate
   38::200     1e-09  38%  359 aa  PATR_THEFY RecName: Full=Putative phenylalanine aminotransferase;  
  215::383     1e-09  27%  592 aa  ALAM_YEAST RecName: Full=Probable alanine aminotransferase,
   32::231     2e-09  30%  360 aa  HIS8_DESHY RecName: Full=Histidinol-phosphate aminotransferase;    
   36::305     2e-09  24%  411 aa  DAPT1_ANAVT RecName: Full=LL-diaminopimelate aminotransferase 1;   
   36::303     2e-09  27%  408 aa  DAPAT_LEPIN RecName: Full=LL-diaminopimelate aminotransferase;     
   97::290     2e-09  35%  493 aa  1A11_CUCPE RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   82::293     3e-09  30%  416 aa  Y1527_METMP RecName: Full=Uncharacterized aminotransferase MMP1527;
   27::246     3e-09  25%  395 aa  DAPAT_CHLCV RecName: Full=LL-diaminopimelate aminotransferase;     
  117::288     3e-09  33%  496 aa  ALAT1_RAT RecName: Full=Alanine aminotransferase 1;       
  145::325     3e-09  26%  454 aa  KAT3_HUMAN RecName: Full=Kynurenine--oxoglutarate transaminase 3;  
   95::405     3e-09  24%  496 aa  1A12_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   26::252     4e-09  26%  398 aa  MTNE_BACSU RecName: Full=Transaminase mtnE;         EC=2.6.1.-;
   76::244     4e-09  32%  398 aa  HIS8_MYCPA RecName: Full=Histidinol-phosphate aminotransferase;    
   76::244     4e-09  32%  398 aa  HIS8_MYCA1 RecName: Full=Histidinol-phosphate aminotransferase;    
   81::230     4e-09  33%  355 aa  HIS8_CHLL2 RecName: Full=Histidinol-phosphate aminotransferase;    
   36::305     4e-09  24%  411 aa  DAPT1_ANASP RecName: Full=LL-diaminopimelate aminotransferase 1;   
  127::290     4e-09  25%  505 aa  ALAT_SCHPO RecName: Full=Putative alanine aminotransferase;        
  144::316     4e-09  31%  524 aa  ALAT2_XENTR RecName: Full=Alanine aminotransferase 2;       
  156::318     4e-09  26%  534 aa  ALAM_DICDI RecName: Full=Probable alanine aminotransferase,
   69::261     6e-09  28%  432 aa  Y1479_METJA RecName: Full=Uncharacterized aminotransferase MJ1479; 
   24::225     6e-09  28%  341 aa  PATR_CORGB RecName: Full=Putative phenylalanine aminotransferase;  
   36::327     6e-09  28%  410 aa  DAPAT_GEOMG RecName: Full=LL-diaminopimelate aminotransferase;     
  102::295     6e-09  30%  447 aa  1A17_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   36::220     7e-09  31%  362 aa  HIS8_RHOBA RecName: Full=Histidinol-phosphate aminotransferase;    
   36::327     7e-09  28%  410 aa  DAPAT_PELPD RecName: Full=LL-diaminopimelate aminotransferase;     
   36::327     7e-09  28%  410 aa  DAPAT_GEOUR RecName: Full=LL-diaminopimelate aminotransferase;     
  167::523     7e-09  26%  549 aa  ALAT2_DANRE RecName: Full=Alanine aminotransferase 2-like;       
   97::290     7e-09  31%  493 aa  1A11_CUCMA RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   69::223     1e-08  30%  348 aa  HIS8_CHLTE RecName: Full=Histidinol-phosphate aminotransferase;    
   40::244     1e-08  30%  378 aa  HIS8_AZOC5 RecName: Full=Histidinol-phosphate aminotransferase;    
   31::305     1e-08  24%  408 aa  DAPAT_PROM5 RecName: Full=LL-diaminopimelate aminotransferase;     
   36::327     1e-08  28%  410 aa  DAPAT_GEOLS RecName: Full=LL-diaminopimelate aminotransferase;     
   36::295     1e-08  24%  404 aa  DAPAT_CLOPH RecName: Full=LL-diaminopimelate aminotransferase;     
   98::291     1e-08  28%  495 aa  1A16_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   29::233     1e-08  31%  361 aa  HIS8_SILPO RecName: Full=Histidinol-phosphate aminotransferase;    
   36::327     1e-08  28%  410 aa  DAPAT_GEOSL RecName: Full=LL-diaminopimelate aminotransferase;     
   36::380     1e-08  24%  411 aa  DAPAT_CYAA5 RecName: Full=LL-diaminopimelate aminotransferase;     
   28::264     1e-08  25%  410 aa  DAPAT_CLOTH RecName: Full=LL-diaminopimelate aminotransferase;     
   46::241     1e-08  29%  368 aa  1A1C_PHAAU RecName: Full=1-aminocyclopropane-1-carboxylate
   94::289     1e-08  30%  485 aa  1A12_SOLLC RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   52::225     2e-08  30%  341 aa  PATR_CORGL RecName: Full=Probable phenylalanine aminotransferase;  
   63::233     2e-08  32%  370 aa  HIS8_METNO RecName: Full=Histidinol-phosphate aminotransferase;    
   20::313     2e-08  26%  409 aa  DAPAT_DESAH RecName: Full=LL-diaminopimelate aminotransferase;     
   27::251     2e-08  27%  397 aa  DAPAT_CHLPN RecName: Full=LL-diaminopimelate aminotransferase;     
  160::332     2e-08  31%  540 aa  ALAT2_XENLA RecName: Full=Alanine aminotransferase 2;       
   38::227     2e-08  29%  351 aa  PATR_MYCVP RecName: Full=Putative phenylalanine aminotransferase;  
   52::225     2e-08  30%  344 aa  PATR_CORDI RecName: Full=Putative phenylalanine aminotransferase;  
  100::325     2e-08  25%  454 aa  KAT3_RAT RecName: Full=Kynurenine--oxoglutarate transaminase 3;    
   72::230     2e-08  32%  360 aa  HIS8_PROVI RecName: Full=Histidinol-phosphate aminotransferase;    
   76::230     2e-08  33%  355 aa  HIS8_PELPB RecName: Full=Histidinol-phosphate aminotransferase;    
   56::258     2e-08  29%  386 aa  HIS8_MOOTA RecName: Full=Histidinol-phosphate aminotransferase;    
  108::239     2e-08  32%  361 aa  HIS8_LACF3 RecName: Full=Histidinol-phosphate aminotransferase;    
   68::265     2e-08  29%  393 aa  AAT3_BACSU RecName: Full=Putative aspartate aminotransferase yhdR; 
   96::288     2e-08  29%  517 aa  1A1C_DIACA RecName: Full=1-aminocyclopropane-1-carboxylate
  189::293     2e-08  33%  476 aa  1A14_SOLLC RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   96::288     2e-08  28%  492 aa  1A11_PRUMU RecName: Full=1-aminocyclopropane-1-carboxylate synthase
  103::310     3e-08  28%  435 aa  KAT_DICDI RecName: Full=Kynurenine--oxoglutarate transaminase;     
   29::233     3e-08  30%  370 aa  HIS8_METS4 RecName: Full=Histidinol-phosphate aminotransferase;    
   70::230     3e-08  31%  355 aa  HIS8_CHLP8 RecName: Full=Histidinol-phosphate aminotransferase;    
   36::305     3e-08  24%  411 aa  DAPAT_MICAN RecName: Full=LL-diaminopimelate aminotransferase;     
   36::308     3e-08  26%  409 aa  DAPAT_HELMI RecName: Full=LL-diaminopimelate aminotransferase;     
   30::250     3e-08  24%  387 aa  CBL_BACSU RecName: Full=Cystathionine beta-lyase patB;       
   95::290     3e-08  29%  484 aa  1A1C_SOYBN RecName: Full=1-aminocyclopropane-1-carboxylate
  191::402     3e-08  28%  557 aa  1A110_ARATH RecName: Full=Probable aminotransferase ACS10;       
   61::244     4e-08  32%  372 aa  HIS8_COREF RecName: Full=Histidinol-phosphate aminotransferase;    
   36::305     4e-08  25%  408 aa  DAPAT_PROMP RecName: Full=LL-diaminopimelate aminotransferase;     
   36::304     4e-08  26%  409 aa  DAPAT_BACV8 RecName: Full=LL-diaminopimelate aminotransferase;     
   56::229     5e-08  29%  352 aa  PATR_PROAC RecName: Full=Putative phenylalanine aminotransferase;  
   45::232     5e-08  30%  354 aa  HIS8_LEUCK RecName: Full=Histidinol-phosphate aminotransferase;    
   20::317     5e-08  24%  408 aa  DAPAT_PROMS RecName: Full=LL-diaminopimelate aminotransferase;     
   27::242     6e-08  29%  365 aa  HIS8_RHOPT RecName: Full=Histidinol-phosphate aminotransferase;    
   27::242     6e-08  29%  365 aa  HIS8_RHOPA RecName: Full=Histidinol-phosphate aminotransferase;    
   96::241     6e-08  31%  379 aa  HIS8_MYCS2 RecName: Full=Histidinol-phosphate aminotransferase;    
   36::308     6e-08  28%  411 aa  DAPAT_GEOBB RecName: Full=LL-diaminopimelate aminotransferase;     
   76::225     8e-08  28%  351 aa  HIS8_THEPX RecName: Full=Histidinol-phosphate aminotransferase;    
   78::228     8e-08  30%  361 aa  HIS8_DINSH RecName: Full=Histidinol-phosphate aminotransferase;    
   28::305     8e-08  24%  410 aa  DAPAT_METTH RecName: Full=LL-diaminopimelate aminotransferase;     
   36::305     8e-08  24%  411 aa  DAPAT_CYAP7 RecName: Full=LL-diaminopimelate aminotransferase;     
   38::227     1e-07  27%  361 aa  PATR_MYCS2 RecName: Full=Putative phenylalanine aminotransferase;  
   10::229     1e-07  30%  353 aa  PATR_MYCBT RecName: Full=Putative phenylalanine aminotransferase;  
   10::229     1e-07  30%  353 aa  PATR_MYCBP RecName: Full=Putative phenylalanine aminotransferase;  
   10::229     1e-07  30%  353 aa  PATR_MYCBO RecName: Full=Putative phenylalanine aminotransferase;  
   63::238     1e-07  28%  360 aa  HIS8_HALMA RecName: Full=Histidinol-phosphate aminotransferase;    
  142::334     1e-07  30%  502 aa  1A1L1_BOVIN RecName: Full=1-aminocyclopropane-1-carboxylate
   46::239     1e-07  26%  364 aa  HIS8_HALLT RecName: Full=Histidinol-phosphate aminotransferase;    
   36::317     1e-07  23%  408 aa  DAPAT_PROM9 RecName: Full=LL-diaminopimelate aminotransferase;     
   36::305     1e-07  24%  411 aa  DAPAT_CYAP8 RecName: Full=LL-diaminopimelate aminotransferase;     
   87::283     1e-07  27%  469 aa  1A18_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   76::225     2e-07  28%  351 aa  HIS8_THEP3 RecName: Full=Histidinol-phosphate aminotransferase;    
   36::317     2e-07  26%  408 aa  DAPAT_DESPS RecName: Full=LL-diaminopimelate aminotransferase;     
   27::270     2e-07  30%  365 aa  HIS8_RHOP2 RecName: Full=Histidinol-phosphate aminotransferase;    
   48::240     2e-07  28%  377 aa  HIS8_MYCLE RecName: Full=Histidinol-phosphate aminotransferase;    
   48::240     2e-07  28%  377 aa  HIS8_MYCLB RecName: Full=Histidinol-phosphate aminotransferase;    
   43::246     2e-07  29%  378 aa  HIS8_BEII9 RecName: Full=Histidinol-phosphate aminotransferase;    
   23::232     2e-07  26%  369 aa  HIS8_BACHD RecName: Full=Histidinol-phosphate aminotransferase;    
   36::304     2e-07  25%  408 aa  DAPAT_PROMT RecName: Full=LL-diaminopimelate aminotransferase;     
   36::304     2e-07  25%  408 aa  DAPAT_PROM1 RecName: Full=LL-diaminopimelate aminotransferase;     
   64::296     3e-07  27%  421 aa  YDT4_SCHPO RecName: Full=Uncharacterized aminotransferase
   10::229     3e-07  29%  353 aa  PATR_MYCTU RecName: Full=Putative phenylalanine aminotransferase;  
   10::229     3e-07  29%  353 aa  PATR_MYCTA RecName: Full=Putative phenylalanine aminotransferase;  
   10::229     3e-07  27%  355 aa  PATR_MYCPA RecName: Full=Putative phenylalanine aminotransferase;  
   10::229     3e-07  27%  355 aa  PATR_MYCA1 RecName: Full=Putative phenylalanine aminotransferase;  
   63::270     3e-07  29%  365 aa  HIS8_NITWN RecName: Full=Histidinol-phosphate aminotransferase;    
   36::304     3e-07  23%  409 aa  DAPAT_PARD8 RecName: Full=LL-diaminopimelate aminotransferase;     
   42::237     4e-07  32%  371 aa  HIS8_SPHAL RecName: Full=Histidinol-phosphate aminotransferase;    
  130::231     4e-07  36%  362 aa  HIS8_MARMM RecName: Full=Histidinol-phosphate aminotransferase;    
   23::232     4e-07  27%  364 aa  HIS8_BREBN RecName: Full=Histidinol-phosphate aminotransferase;    
   23::232     4e-07  28%  371 aa  HIS8_ANOFW RecName: Full=Histidinol-phosphate aminotransferase;    
   36::308     4e-07  27%  411 aa  DAPAT_GEOSM RecName: Full=LL-diaminopimelate aminotransferase;     
  177::282     4e-07  34%  475 aa  1A12_CUCMA RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   77::226     5e-07  30%  358 aa  PATR_RHOSR RecName: Full=Putative phenylalanine aminotransferase;  
   78::245     5e-07  29%  380 aa  HIS8_RHOOB RecName: Full=Histidinol-phosphate aminotransferase;    
   14::199     5e-07  28%  367 aa  HIS8_PARDP RecName: Full=Histidinol-phosphate aminotransferase;    
   35::285     5e-07  25%  393 aa  DAPAT_CHLMU RecName: Full=LL-diaminopimelate aminotransferase;     
  130::288     5e-07  25%  507 aa  ALAT_YEAST RecName: Full=Probable alanine aminotransferase;        
   37::238     7e-07  28%  392 aa  HIS82_NITMU RecName: Full=Histidinol-phosphate aminotransferase 2; 
   36::198     7e-07  33%  319 aa  HIS81_ARCFU RecName: Full=Histidinol-phosphate aminotransferase 1; 
  174::278     7e-07  33%  460 aa  1A111_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate
  141::323     9e-07  30%  470 aa  YJIR_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
   29::235     9e-07  28%  369 aa  HIS8_ZYMMO RecName: Full=Histidinol-phosphate aminotransferase;    
   63::248     9e-07  32%  366 aa  HIS8_HALSA RecName: Full=Histidinol-phosphate aminotransferase;    
   63::248     9e-07  32%  366 aa  HIS8_HALS3 RecName: Full=Histidinol-phosphate aminotransferase;    
   59::221     9e-07  31%  356 aa  HIS8_AERHH RecName: Full=Histidinol-phosphate aminotransferase;    
   36::306     9e-07  22%  410 aa  DAPAT_BACFR RecName: Full=LL-diaminopimelate aminotransferase;     
   36::306     9e-07  22%  410 aa  DAPAT_BACFN RecName: Full=LL-diaminopimelate aminotransferase;     
   57::223     9e-07  23%  367 aa  COBD_THETN RecName: Full=Putative threonine-phosphate
  177::283     9e-07  32%  473 aa  1A1C_MALDO RecName: Full=1-aminocyclopropane-1-carboxylate
   67::233     1e-06  32%  362 aa  HIS8_SILST RecName: Full=Histidinol-phosphate aminotransferase;    
   77::229     1e-06  30%  359 aa  HIS8_ROSDO RecName: Full=Histidinol-phosphate aminotransferase;    
   45::236     1e-06  32%  372 aa  HIS8_NOVAD RecName: Full=Histidinol-phosphate aminotransferase;    
   38::241     1e-06  27%  373 aa  HIS82_NITEU RecName: Full=Histidinol-phosphate aminotransferase 2; 
   36::317     1e-06  22%  408 aa  DAPAT_PROM0 RecName: Full=LL-diaminopimelate aminotransferase;     
   24::211     1e-06  28%  407 aa  CBL_MYCTU RecName: Full=Putative cystathionine beta-lyase;       
   24::211     1e-06  28%  407 aa  CBL_MYCBO RecName: Full=Putative cystathionine beta-lyase;       
   76::230     2e-06  33%  364 aa  HIS8_STRMK RecName: Full=Histidinol-phosphate aminotransferase;    
   93::243     2e-06  30%  371 aa  HIS8_ROSCS RecName: Full=Histidinol-phosphate aminotransferase;    
   27::242     2e-06  28%  365 aa  HIS8_NITHX RecName: Full=Histidinol-phosphate aminotransferase;    
   46::239     2e-06  27%  376 aa  HIS8_HALWD RecName: Full=Histidinol-phosphate aminotransferase;    
   53::247     2e-06  29%  376 aa  HIS81_RALEJ RecName: Full=Histidinol-phosphate aminotransferase 1; 
   36::263     2e-06  30%  410 aa  DAPAT_LAWIP RecName: Full=LL-diaminopimelate aminotransferase;     
   36::309     2e-06  22%  411 aa  DAPAT_DESHD RecName: Full=LL-diaminopimelate aminotransferase;     
   41::239     2e-06  29%  373 aa  HIS8_METTH RecName: Full=Histidinol-phosphate aminotransferase;    
   80::233     2e-06  24%  358 aa  HIS8_CALS8 RecName: Full=Histidinol-phosphate aminotransferase;    
   23::234     3e-06  26%  370 aa  HIS8_BACCN RecName: Full=Histidinol-phosphate aminotransferase;    
   59::221     3e-06  34%  355 aa  HIS8_AERS4 RecName: Full=Histidinol-phosphate aminotransferase;    
   36::327     3e-06  27%  410 aa  DAPAT_PELCD RecName: Full=LL-diaminopimelate aminotransferase;     
   31::305     3e-06  22%  408 aa  DAPAT_LEPBP RecName: Full=LL-diaminopimelate aminotransferase;     
   31::305     3e-06  22%  408 aa  DAPAT_LEPBA RecName: Full=LL-diaminopimelate aminotransferase;     
   36::309     3e-06  22%  411 aa  DAPAT_DESHY RecName: Full=LL-diaminopimelate aminotransferase;     
  177::291     3e-06  30%  474 aa  1A14_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase
  121::348     3e-06  28%  482 aa  YDFD_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   80::230     3e-06  33%  357 aa  HIS8_PROA2 RecName: Full=Histidinol-phosphate aminotransferase;    
   88::242     3e-06  28%  380 aa  HIS8_MYCTU RecName: Full=Histidinol-phosphate aminotransferase;    
   88::242     3e-06  28%  380 aa  HIS8_MYCTA RecName: Full=Histidinol-phosphate aminotransferase;    
   88::242     3e-06  28%  380 aa  HIS8_MYCBT RecName: Full=Histidinol-phosphate aminotransferase;    
   88::242     3e-06  28%  380 aa  HIS8_MYCBP RecName: Full=Histidinol-phosphate aminotransferase;    
   88::242     3e-06  28%  380 aa  HIS8_MYCBO RecName: Full=Histidinol-phosphate aminotransferase;    
   70::234     3e-06  30%  364 aa  HIS8_ANADF RecName: Full=Histidinol-phosphate aminotransferase;    
   99::296     3e-06  29%  487 aa  1A11_ORYSJ RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   99::296     3e-06  29%  487 aa  1A11_ORYSI RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   69::208     4e-06  31%  369 aa  HIS8_STRAW RecName: Full=Histidinol-phosphate aminotransferase;    
   75::233     4e-06  31%  368 aa  HIS8_RHISN RecName: Full=Histidinol-phosphate aminotransferase;    
   91::245     4e-06  28%  385 aa  HIS8_NOCFA RecName: Full=Histidinol-phosphate aminotransferase;    
   32::233     4e-06  31%  365 aa  HIS8_BRUSU RecName: Full=Histidinol-phosphate aminotransferase;    
   32::233     4e-06  31%  365 aa  HIS8_BRUO2 RecName: Full=Histidinol-phosphate aminotransferase;    
   32::233     4e-06  31%  365 aa  HIS8_BRUAB RecName: Full=Histidinol-phosphate aminotransferase;    
   32::233     4e-06  31%  365 aa  HIS8_BRUA2 RecName: Full=Histidinol-phosphate aminotransferase;    
   91::243     4e-06  28%  363 aa  HIS8_AKKM8 RecName: Full=Histidinol-phosphate aminotransferase;    
   10::233     6e-06  28%  361 aa  PATR_MYCUA RecName: Full=Putative phenylalanine aminotransferase;  
   10::233     6e-06  28%  361 aa  PATR_MYCMM RecName: Full=Putative phenylalanine aminotransferase;  
   67::193     6e-06  32%  373 aa  PATR_CORJK RecName: Full=Putative phenylalanine aminotransferase;  
   69::290     6e-06  25%  413 aa  HIS8_TOBAC RecName: Full=Histidinol-phosphate aminotransferase,
   11::195     6e-06  31%  361 aa  HIS8_RHOS5 RecName: Full=Histidinol-phosphate aminotransferase;    
   23::232     6e-06  26%  365 aa  HIS8_GEOKA RecName: Full=Histidinol-phosphate aminotransferase;    
   27::221     6e-06  28%  350 aa  HIS8_GEOBB RecName: Full=Histidinol-phosphate aminotransferase;    
   82::234     6e-06  31%  368 aa  HIS81_RHIME RecName: Full=Histidinol-phosphate aminotransferase 1; 
   36::306     6e-06  22%  410 aa  DAPAT_BACTN RecName: Full=LL-diaminopimelate aminotransferase;     
   28::294     6e-06  23%  401 aa  DAPAT_AZOPC RecName: Full=LL-diaminopimelate aminotransferase;     
   73::232     8e-06  32%  374 aa  HIS8_YERE8 RecName: Full=Histidinol-phosphate aminotransferase;    
   58::208     8e-06  32%  369 aa  HIS8_STRCO RecName: Full=Histidinol-phosphate aminotransferase;    
   69::290     8e-06  25%  413 aa  HIS8_NICPL RecName: Full=Histidinol-phosphate aminotransferase,
   27::221     8e-06  27%  350 aa  HIS8_GEOSM RecName: Full=Histidinol-phosphate aminotransferase;    
   63::240     8e-06  30%  370 aa  HIS8_ACIAC RecName: Full=Histidinol-phosphate aminotransferase;    
   63::220     8e-06  31%  351 aa  HIS81_PASMU RecName: Full=Histidinol-phosphate aminotransferase 1; 
   29::210     8e-06  28%  402 aa  CBL_MYCLE RecName: Full=Putative cystathionine beta-lyase;       
  249::350     8e-06  29%  618 aa  1A1L1_TAKRU RecName: Full=1-aminocyclopropane-1-carboxylate
  232::341     8e-06  27%  501 aa  1A1L1_HUMAN RecName: Full=1-aminocyclopropane-1-carboxylate
  107::300     1e-05  24%  484 aa  YISV_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
  142::219     1e-05  36%  346 aa  HIS8_VIBCM RecName: Full=Histidinol-phosphate aminotransferase;    
  142::219     1e-05  36%  346 aa  HIS8_VIBCH RecName: Full=Histidinol-phosphate aminotransferase;    
  142::219     1e-05  36%  346 aa  HIS8_VIBC3 RecName: Full=Histidinol-phosphate aminotransferase;    
   61::214     1e-05  31%  340 aa  HIS8_THEGJ RecName: Full=Histidinol-phosphate aminotransferase;    
   27::242     1e-05  29%  365 aa  HIS8_RHOP5 RecName: Full=Histidinol-phosphate aminotransferase;    
  156::279     1e-05  32%  355 aa  HIS8_NATPD RecName: Full=Histidinol-phosphate aminotransferase;    
   82::238     1e-05  29%  368 aa  HIS8_METFL RecName: Full=Histidinol-phosphate aminotransferase;    
   61::242     1e-05  30%  365 aa  HIS8_RHOPB RecName: Full=Histidinol-phosphate aminotransferase;    
  144::221     1e-05  37%  374 aa  HIS8_PHOPR RecName: Full=Histidinol-phosphate aminotransferase;    
   84::238     1e-05  22%  371 aa  HIS8_METVS RecName: Full=Histidinol-phosphate aminotransferase;    
   48::233     1e-05  30%  358 aa  HIS8_DEHE1 RecName: Full=Histidinol-phosphate aminotransferase;    
  155::244     1e-05  29%  372 aa  HIS8_BDEBA RecName: Full=Histidinol-phosphate aminotransferase;    
   75::243     1e-05  30%  370 aa  HIS83_BURS3 RecName: Full=Histidinol-phosphate aminotransferase 3; 
   36::221     1e-05  26%  352 aa  HIS81_HAEI8 RecName: Full=Histidinol-phosphate aminotransferase 1; 
  235::428     1e-05  26%  580 aa  1A1L2_MOUSE RecName: Full=1-aminocyclopropane-1-carboxylate
   11::195     2e-05  31%  361 aa  HIS8_RHOSK RecName: Full=Histidinol-phosphate aminotransferase;    
   11::195     2e-05  31%  361 aa  HIS8_RHOS4 RecName: Full=Histidinol-phosphate aminotransferase;    
   11::195     2e-05  31%  361 aa  HIS8_RHOS1 RecName: Full=Histidinol-phosphate aminotransferase;    
  136::222     2e-05  42%  357 aa  HIS8_PECCP RecName: Full=Histidinol-phosphate aminotransferase;    
   73::343     2e-05  28%  417 aa  HIS8_ARATH RecName: Full=Histidinol-phosphate aminotransferase,
   67::236     2e-05  31%  369 aa  HIS82_RHILO RecName: Full=Histidinol-phosphate aminotransferase 2; 
  142::335     2e-05  29%  502 aa  1A1L1_MOUSE RecName: Full=1-aminocyclopropane-1-carboxylate
  165::277     2e-05  32%  443 aa  YEY2_YEAST RecName: Full=Uncharacterized protein YER152C;
  137::219     2e-05  34%  346 aa  HIS8_VIBFM RecName: Full=Histidinol-phosphate aminotransferase;    
   89::238     2e-05  21%  371 aa  HIS8_METMP RecName: Full=Histidinol-phosphate aminotransferase;    
   36::221     2e-05  26%  352 aa  HIS8_HAEIG RecName: Full=Histidinol-phosphate aminotransferase;    
   32::233     2e-05  31%  365 aa  HIS8_BRUME RecName: Full=Histidinol-phosphate aminotransferase;    
   72::196     2e-05  33%  369 aa  HIS83_RHILO RecName: Full=Histidinol-phosphate aminotransferase 3; 
   56::227     2e-05  35%  357 aa  HIS82_THIDA RecName: Full=Histidinol-phosphate aminotransferase 2; 
   42::170     2e-05  28%  362 aa  HIS82_CARHZ RecName: Full=Histidinol-phosphate aminotransferase 2; 
   51::236     2e-05  26%  367 aa  HIS81_HAEIN RecName: Full=Histidinol-phosphate aminotransferase 1; 
   74::242     3e-05  30%  377 aa  HIS8_MYCSS RecName: Full=Histidinol-phosphate aminotransferase;    
   96::213     3e-05  32%  219 aa  HIS8_MYCSM RecName: Full=Histidinol-phosphate aminotransferase;    
   74::242     3e-05  30%  377 aa  HIS8_MYCSK RecName: Full=Histidinol-phosphate aminotransferase;    
   74::242     3e-05  30%  377 aa  HIS8_MYCSJ RecName: Full=Histidinol-phosphate aminotransferase;    
   85::238     3e-05  21%  371 aa  HIS8_METM5 RecName: Full=Histidinol-phosphate aminotransferase;    
   21::222     3e-05  32%  356 aa  HIS8_GLUDA RecName: Full=Histidinol-phosphate aminotransferase;    
   77::221     3e-05  32%  347 aa  HIS8_GEOUR RecName: Full=Histidinol-phosphate aminotransferase;    
   27::268     3e-05  28%  365 aa  HIS82_BRAJA RecName: Full=Histidinol-phosphate aminotransferase 2; 
  192::282     3e-05  33%  470 aa  1A19_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   98::224     4e-05  31%  358 aa  PATR_RHOOB RecName: Full=Putative phenylalanine aminotransferase;  
   94::257     4e-05  26%  392 aa  HIS8_XANP2 RecName: Full=Histidinol-phosphate aminotransferase;    
   93::243     4e-05  32%  370 aa  HIS8_ROSS1 RecName: Full=Histidinol-phosphate aminotransferase;    
   13::279     4e-05  26%  370 aa  HIS8_HELHP RecName: Full=Histidinol-phosphate aminotransferase;    
   45::221     4e-05  27%  352 aa  HIS8_HAEIE RecName: Full=Histidinol-phosphate aminotransferase;    
   76::236     4e-05  28%  368 aa  HIS8_COLP3 RecName: Full=Histidinol-phosphate aminotransferase;    
   58::221     4e-05  27%  358 aa  HIS8_BLOPB RecName: Full=Histidinol-phosphate aminotransferase;    
  137::219     5e-05  33%  346 aa  HIS8_VIBF1 RecName: Full=Histidinol-phosphate aminotransferase;    
  114::258     5e-05  38%  391 aa  HIS8_SHEON RecName: Full=Histidinol-phosphate aminotransferase;    
   67::202     5e-05  29%  365 aa  HIS8_POLNA RecName: Full=Histidinol-phosphate aminotransferase;    
   23::234     5e-05  26%  366 aa  HIS8_LYSSC RecName: Full=Histidinol-phosphate aminotransferase;    
   31::232     5e-05  25%  365 aa  HIS8_GEOTN RecName: Full=Histidinol-phosphate aminotransferase;    
   48::233     5e-05  27%  358 aa  HIS8_DEHSB RecName: Full=Histidinol-phosphate aminotransferase;    
  146::223     5e-05  31%  360 aa  HIS8_BAUCH RecName: Full=Histidinol-phosphate aminotransferase;    
  141::219     5e-05  34%  346 aa  HIS8_ALISL RecName: Full=Histidinol-phosphate aminotransferase;    
  105::233     5e-05  24%  364 aa  HIS82_OCEIH RecName: Full=Histidinol-phosphate aminotransferase 2; 
   63::226     5e-05  32%  357 aa  HIS81_BURS3 RecName: Full=Histidinol-phosphate aminotransferase 1; 
   51::247     6e-05  24%  373 aa  HIS8_MYCVP RecName: Full=Histidinol-phosphate aminotransferase;    
  146::222     6e-05  39%  357 aa  HIS8_ERWCT RecName: Full=Histidinol-phosphate aminotransferase;    
   84::248     6e-05  27%  360 aa  HIS8_BACSU RecName: Full=Histidinol-phosphate aminotransferase;    
  141::219     8e-05  34%  346 aa  HIS8_VIBPA RecName: Full=Histidinol-phosphate aminotransferase;    
  141::219     8e-05  34%  346 aa  HIS8_VIBHB RecName: Full=Histidinol-phosphate aminotransferase;    
   29::235     8e-05  29%  362 aa  HIS8_RHOCS RecName: Full=Histidinol-phosphate aminotransferase;    
   11::244     8e-05  29%  373 aa  HIS8_CORJK RecName: Full=Histidinol-phosphate aminotransferase;    
   99::220     8e-05  32%  350 aa  HIS82_MANSM RecName: Full=Histidinol-phosphate aminotransferase 2; 
   45::234     8e-05  25%  366 aa  HIS82_BACC1 RecName: Full=Histidinol-phosphate aminotransferase 2; 
   48::233     1e-04  26%  358 aa  HIS8_DEHSC RecName: Full=Histidinol-phosphate aminotransferase;    
   86::234     1e-04  28%  368 aa  HIS8_AGRT5 RecName: Full=Histidinol-phosphate aminotransferase;    
   62::139     1e-04  36%  478 aa  YDIU_SHISS RecName: Full=UPF0061 protein ydiU;
   62::139     1e-04  36%  478 aa  YDIU_SHIBS RecName: Full=UPF0061 protein ydiU;
   62::139     1e-04  36%  478 aa  YDIU_SHIB3 RecName: Full=UPF0061 protein ydiU;
   64::141     1e-04  36%  480 aa  YDIU_ESCF3 RecName: Full=UPF0061 protein ydiU;
   62::139     1e-04  36%  478 aa  YDIU_ECOUT RecName: Full=UPF0061 protein ydiU;
   62::139     1e-04  36%  478 aa  YDIU_ECOSE RecName: Full=UPF0061 protein ydiU;
   62::139     1e-04  36%  478 aa  YDIU_ECOLI RecName: Full=UPF0061 protein ydiU;
   62::139     1e-04  36%  478 aa  YDIU_ECOLC RecName: Full=UPF0061 protein ydiU;
   62::139     1e-04  36%  478 aa  YDIU_ECOL6 RecName: Full=UPF0061 protein ydiU;
   62::139     1e-04  36%  478 aa  YDIU_ECOL5 RecName: Full=UPF0061 protein ydiU;
   62::139     1e-04  36%  478 aa  YDIU_ECOK1 RecName: Full=UPF0061 protein ydiU;
   62::139     1e-04  36%  478 aa  YDIU_ECOHS RecName: Full=UPF0061 protein ydiU;
   62::139     1e-04  36%  478 aa  YDIU_ECODH RecName: Full=UPF0061 protein ydiU;
   62::139     1e-04  36%  478 aa  YDIU_ECOBW RecName: Full=UPF0061 protein ydiU;
   62::139     1e-04  36%  478 aa  YDIU_ECO81 RecName: Full=UPF0061 protein ydiU;
   62::139     1e-04  36%  478 aa  YDIU_ECO5E RecName: Full=UPF0061 protein ydiU;
   62::139     1e-04  36%  478 aa  YDIU_ECO57 RecName: Full=UPF0061 protein ydiU;
   62::139     1e-04  36%  478 aa  YDIU_ECO55 RecName: Full=UPF0061 protein ydiU;
   62::139     1e-04  36%  478 aa  YDIU_ECO45 RecName: Full=UPF0061 protein ydiU;
   62::139     1e-04  36%  478 aa  YDIU_ECO27 RecName: Full=UPF0061 protein ydiU;
   62::139     1e-04  36%  478 aa  YDIU_ECO24 RecName: Full=UPF0061 protein ydiU;
  138::221     1e-04  36%  360 aa  HIS8_SODGM RecName: Full=Histidinol-phosphate aminotransferase;    
   89::238     1e-04  20%  371 aa  HIS8_METM7 RecName: Full=Histidinol-phosphate aminotransferase;    
   35::233     1e-04  28%  366 aa  HIS8_MESSB RecName: Full=Histidinol-phosphate aminotransferase;    
   96::232     1e-04  25%  360 aa  HIS8_LISIN RecName: Full=Histidinol-phosphate aminotransferase;    
   95::221     1e-04  32%  353 aa  HIS8_KLEP3 RecName: Full=Histidinol-phosphate aminotransferase;    
   69::250     1e-04  29%  386 aa  HIS8_BIFLO RecName: Full=Histidinol-phosphate aminotransferase;    
  192::282     1e-04  32%  470 aa  1A15_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase
  151::313     2e-04  26%  462 aa  YDEF_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   27::270     2e-04  29%  365 aa  HIS8_RHOPS RecName: Full=Histidinol-phosphate aminotransferase;    
   78::207     2e-04  34%  371 aa  HIS8_METPP RecName: Full=Histidinol-phosphate aminotransferase;    
   96::232     2e-04  25%  360 aa  HIS8_LISMF RecName: Full=Histidinol-phosphate aminotransferase;    
   96::232     2e-04  25%  360 aa  HIS8_LISMC RecName: Full=Histidinol-phosphate aminotransferase;    
  106::257     2e-04  30%  397 aa  HIS8_FRASC RecName: Full=Histidinol-phosphate aminotransferase;    
  144::221     2e-04  36%  353 aa  HIS8_ENT38 RecName: Full=Histidinol-phosphate aminotransferase;    
  165::250     2e-04  37%  383 aa  HIS8_DESDG RecName: Full=Histidinol-phosphate aminotransferase;    
   36::194     2e-04  29%  367 aa  HIS81_RHILO RecName: Full=Histidinol-phosphate aminotransferase 1; 
  142::219     2e-04  33%  346 aa  HIS8_VIBVY RecName: Full=Histidinol-phosphate aminotransferase;    
  142::219     2e-04  33%  346 aa  HIS8_VIBVU RecName: Full=Histidinol-phosphate aminotransferase;    
   96::232     2e-04  25%  360 aa  HIS8_LISMH RecName: Full=Histidinol-phosphate aminotransferase;    
   72::221     2e-04  30%  353 aa  HIS8_KLEP7 RecName: Full=Histidinol-phosphate aminotransferase;    
   21::222     2e-04  32%  356 aa  HIS8_ACEPA RecName: Full=Histidinol-phosphate aminotransferase;    
   45::237     2e-04  30%  374 aa  HIS82_RALSO RecName: Full=Histidinol-phosphate aminotransferase 2; 
   70::203     2e-04  27%  367 aa  HIS81_IDILO RecName: Full=Histidinol-phosphate aminotransferase 1; 
   96::232     3e-04  24%  360 aa  HIS8_LISMO RecName: Full=Histidinol-phosphate aminotransferase;    
   79::223     3e-04  24%  351 aa  HIS8_CLOK5 RecName: Full=Histidinol-phosphate aminotransferase;    
   79::223     3e-04  24%  351 aa  HIS8_CLOK1 RecName: Full=Histidinol-phosphate aminotransferase;    
   70::233     3e-04  32%  364 aa  HIS8_BURM1 RecName: Full=Histidinol-phosphate aminotransferase;    
  111::248     3e-04  28%  360 aa  HIS8_BACNA RecName: Full=Histidinol-phosphate aminotransferase;    
  137::226     3e-04  28%  364 aa  COBD_SALTY RecName: Full=Threonine-phosphate decarboxylase;        
  137::226     3e-04  28%  364 aa  COBD_SALTI RecName: Full=Threonine-phosphate decarboxylase;        
  177::282     3e-04  31%  469 aa  1A13_SOLLC RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   64::141     4e-04  36%  480 aa  YDIU_SALTY RecName: Full=UPF0061 protein ydiU;
   64::141     4e-04  36%  480 aa  YDIU_SALSV RecName: Full=UPF0061 protein ydiU;
   64::141     4e-04  36%  480 aa  YDIU_SALPK RecName: Full=UPF0061 protein ydiU;
   64::141     4e-04  36%  480 aa  YDIU_SALPC RecName: Full=UPF0061 protein ydiU;
   64::141     4e-04  36%  480 aa  YDIU_SALPB RecName: Full=UPF0061 protein ydiU;
   64::141     4e-04  36%  480 aa  YDIU_SALPA RecName: Full=UPF0061 protein ydiU;
   64::141     4e-04  36%  480 aa  YDIU_SALNS RecName: Full=UPF0061 protein ydiU;
   64::141     4e-04  36%  480 aa  YDIU_SALHS RecName: Full=UPF0061 protein ydiU;
   64::141     4e-04  36%  480 aa  YDIU_SALEP RecName: Full=UPF0061 protein ydiU;
   64::141     4e-04  36%  480 aa  YDIU_SALDC RecName: Full=UPF0061 protein ydiU;
   64::141     4e-04  36%  480 aa  YDIU_SALAR RecName: Full=UPF0061 protein ydiU;
   64::141     4e-04  36%  480 aa  YDIU_SALA4 RecName: Full=UPF0061 protein ydiU;
   75::201     4e-04  29%  364 aa  HIS8_STRM5 RecName: Full=Histidinol-phosphate aminotransferase;    
   88::200     4e-04  30%  368 aa  HIS8_DIAST RecName: Full=Histidinol-phosphate aminotransferase;    
   88::200     4e-04  31%  368 aa  HIS8_ACISJ RecName: Full=Histidinol-phosphate aminotransferase;    
   78::192     4e-04  32%  360 aa  HIS82_NITOC RecName: Full=Histidinol-phosphate aminotransferase 2; 
   56::218     4e-04  29%  342 aa  HIS82_ARCFU RecName: Full=Histidinol-phosphate aminotransferase 2; 
   42::271     4e-04  29%  359 aa  HIS81_CAUCR RecName: Full=Histidinol-phosphate aminotransferase 1; 
   64::141     5e-04  35%  480 aa  YDIU_SALTI RecName: Full=UPF0061 protein ydiU;
  151::232     5e-04  36%  362 aa  HIS8_SHEAM RecName: Full=Histidinol-phosphate aminotransferase;    
   76::221     5e-04  30%  347 aa  HIS8_PELCD RecName: Full=Histidinol-phosphate aminotransferase;    
  156::239     5e-04  34%  374 aa  HIS8_METI4 RecName: Full=Histidinol-phosphate aminotransferase;    
   62::139     7e-04  35%  478 aa  YDIU_ECOSM RecName: Full=UPF0061 protein ydiU;
   62::139     7e-04  35%  478 aa  YDIU_ECOLU RecName: Full=UPF0061 protein ydiU;
   62::139     7e-04  35%  478 aa  YDIU_ECO7I RecName: Full=UPF0061 protein ydiU;
   73::232     7e-04  30%  382 aa  HIS8_YERPY RecName: Full=Histidinol-phosphate aminotransferase;    
   73::232     7e-04  30%  382 aa  HIS8_YERPS RecName: Full=Histidinol-phosphate aminotransferase;    
   73::232     7e-04  30%  382 aa  HIS8_YERPP RecName: Full=Histidinol-phosphate aminotransferase;    
   73::232     7e-04  30%  382 aa  HIS8_YERPN RecName: Full=Histidinol-phosphate aminotransferase;    
   73::232     7e-04  30%  382 aa  HIS8_YERPG RecName: Full=Histidinol-phosphate aminotransferase;    
   73::232     7e-04  30%  382 aa  HIS8_YERPE RecName: Full=Histidinol-phosphate aminotransferase;    
   73::232     7e-04  30%  382 aa  HIS8_YERPB RecName: Full=Histidinol-phosphate aminotransferase;    
   73::232     7e-04  30%  382 aa  HIS8_YERPA RecName: Full=Histidinol-phosphate aminotransferase;    
   73::232     7e-04  30%  382 aa  HIS8_YERP3 RecName: Full=Histidinol-phosphate aminotransferase;    
   90::241     7e-04  19%  373 aa  HIS8_METJA RecName: Full=Histidinol-phosphate aminotransferase;    
   23::232     7e-04  25%  365 aa  HIS8_GEOSW RecName: Full=Histidinol-phosphate aminotransferase;    
   79::224     7e-04  30%  350 aa  HIS8_GEOSL RecName: Full=Histidinol-phosphate aminotransferase;    
   85::234     7e-04  24%  361 aa  HIS8_BACLD RecName: Full=Histidinol-phosphate aminotransferase;    
  161::244     7e-04  35%  371 aa  HIS82_METCA RecName: Full=Histidinol-phosphate aminotransferase 2; 
   44::238     7e-04  26%  366 aa  HIS82_HAEIN RecName: Full=Histidinol-phosphate aminotransferase 2; 
   45::234     7e-04  24%  366 aa  HIS82_BACAN RecName: Full=Histidinol-phosphate aminotransferase 2; 
   51::171     7e-04  29%  456 aa  CR3L3_BOVIN RecName: Full=Cyclic AMP-responsive element-binding
   63::256     0.001  26%  361 aa  HIS8_HALVO RecName: Full=Histidinol-phosphate aminotransferase;    
  152::240     0.001  32%  377 aa  HIS82_PSYA2 RecName: Full=Histidinol-phosphate aminotransferase 2; 
   85::238     0.001  25%  365 aa  HIS82_PASMU RecName: Full=Histidinol-phosphate aminotransferase 2; 
    1::430

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSVAVSATLAVNEALARRRSQGLPVLPLGFGEAGLPVHPVMRDALSTGGDQNGYGPVAGIRELREAAAGY
AAT_THEAQ       -SMKPSATVAVNARALELRRKGVDLVALTAGEPDFDVKEAGRRALAQG--KTKYAPPAGIPELREAVAEK
AAT_THET8       -----SATVAVNAKALELRRQGVDLVALTAGEPDFDVKEAARRALAQG--KTKYAPPAGIPELREALAEK
AAT_BACY2       -----STTLAITAKAKEMKAQGIDVIGLGAGEPDFNTPQNIMDAAIDSMQQGKYTPSGGLPALKQAIIEK
AAT1_BACSU      -----STTLAITAKAKELKAAGHDVIGLGAGEPDFPQHIIDAAVRSMNEGHTKYTPSGGLAELKNSIAEK
AAT_AQUAE       -----SPTLTITAKAKELRAKGVDVIGFGAGEPDFDTPDFIKEACALREGKTKYAPSAGIPELREAIAEL
AAT_BACST       -SLTPSATLAITEKAKELKAAGHDVIGLGAGEPDFPQHILDAAIKAMNEGHTKYTPSGGLPALKEEIIKK
AATA_RHIME      --VKPSATIAVSQKARELKAKGRDVIGLGAGEPDFDTPDNIKDAIDRG--ETKYTPVSGIPELREAIAKK
AAT_SYNY3       --VVPSITLEITAKAKAMRTEGIDVLSFTAGEPDFPPHIVEAAKLALDEGKTRYGPAAGEPALRQAIAKK
AAT_PYRHO       --------------LFERASKMEDVISLGIGEPDFDTPKNIKEAAKRALDEGWYTPNAGIPELREAVVEY
AAT_PYRAB       ------------------------VISLGIGEPDFPQHEYAKEALDMG--LTHYGPNIGLPELREAIAEK
AAT_RHILP       --VKPSATIAVSQKARELKAKGRDVIGLGAGEPDFDTPDNIKDAINRG--ETKYTPVSGIPELRKAIAAK
AATB1_RHIME     -SIGVSEILKIGARAAAMKREGKPVIILGAGEPDFDVKQAASDAIHRG--ETKYTALDGTPELKKAIREK
AAT_SULSO       MSQVTGETTLLYKEIARNKTKKIKIIDFGIGQPDLPTFKRIRDAAKEALDQGFYTSAFGIDELREKIAQY
AAT_STRVG       ---------------------GRPVIGFGAGEPDFPTPDYIVEAACRNPKYHRYTPAGGLPELKAAIAAK
AAT_SULTO       -SISGESTLVYQDVARQQKTKGIRIINFGIGQPDLPTFARIREAAKKSLDEGGYTSAYGIDELRQKIAEH
AATB2_RHIME     -SIGVSEILKIGARAAAMKREGKPVIILGAGEPDFDVKQAASDAIHRG--ETKYTALDGTPELKKAIREK
AAT_MYCTU       ----------VHQHAARLEAEGHRILKLNIGNPGFEAPDVMRDIIQALPYAQGYSDSQGILSARRAVVTR
AAT_MYCBO       ----------VHQHAARLEAEGHRILKLNIGNPGFEAPDVMRDIIQALPYAQGYSDSQGILSARRAVVTR
AAT_THEMA       --IPISKTMELDAKAKALIKKGEDVINLTAGEPDFPTEPVVEEAVRLQKGEVKYTDPRGIYELREGIAKI
AAT1_METJA      ---------------------------LGIGEPDFPKHIIEAAKRALDEGKTHYSPNNGIPELREEISNK
AAT_RICCN       -SIKPSPTLAVVKKTLELKKAGVDIITLGAGEPDFDTPDNIKEAIKDGFTK--YTNVEGMPLLKQAIKDK
AAT_RICFE       -SIKPSPTLAVVKKTLELKKAGVDIIALGAGEPDFDTPDNIKEAAAIKDGFTKYTNVEGMPLLKQAIKDK
AAT_RICBR       -AIKPSPTLAVVRKTLELKRAGIDIIALGAGEPDFDTPDNIKEAAAIKDGFTKYTNVEGIPALKEAIQAK
AAT_SULAC       -ALAISGTTLLYQDIARQKEKGIKIVNFGIGQPDFPTFQKIRDEAKKAGGFTAYTSAYGIDELRAKIASF
DAPAT_NATTJ     ----------LDKMVQKEQAKGKEIIKLGIGDPGMPPEGIIKAATQEKGENHGYPAYDGIDKLKHAIKEY
AAT_RICTY       -SIKPSPTLAVVKKTLELKKAGVNIIALGAGEPDFDTPDNIKEVAITSIKDGKYTNVDGIPLLKQAIKNK
AAT_RICPR       -SIKPSPTLAVVKKTLELKKAGVNIIALGAGEPDFDTPDNIKEVAITSIKDGKYTNVDGIPLLKQAIKNK
AAT_PYRKO       -------------------------------DAGQPDIPVRREIIEEAVEETGYTSTGGIRELRERIA--
DAPT2_ANAVT     -------------------AQGVDIINIGVGDPDKPILQAMREAIDEASNHN-YPPYEGTQEFREAAVKW
DAPAT_MOOTA     ----------IEKKIAEARERGVDIISLGIGDPDMPTPSHVIDKLAHNPENHRYPTSEGLLAFRQAVADW
DAPT2_ANASP     -------------------AKGVDIINIGVGDPDKPILQAMREAIDDASNHN-YPPYEGTQEFREAAVEW
DAPAT_SYNFM     ----------IDRLKAELTAKGVDVINLGVGDPDLPTPDHIIARLKTAAEDHQYPSYSGMNDFKVSVAGW
DAPAT_GLOVI     -----------DEAVAR----GVDIINMGIGDPDKPTPPVVLEAMHAAIDDHNYPPYKGTKAYREXXXXW
YFBQ_SHIFL      ---------------------------------------ILVDVIRNLPTAQGYCDSKGLYSARKAIMQH
YFBQ_ECOLI      ---------------------------------------ILVDVIRNLPTAQGYCDSKGLYSARKAIMQH
YFBQ_ECOL6      ---------------------------------------ILVDVIRNLPTAQGYCDSKGLYSARKAIMQH
DAPAT_DESVV     ----------IDKVKAEVAARGVDIISLGIGDPDMAIIEAMKEAIARPANHQ-YPSYVGMLAFRQEVANW
DAPAT_DESVH     ----------IDKVKAEVAARGVDIISLGIGDPDMAIIEAMKEAIARPANHQ-YPSYVGMLAFRQEVANW
Y286_HAEIN      ----------VHKEALRLEEEGNKILKLNIGNPAPAPDEILVDVLRNLPSAQGYCDSKGLYSARKAIVQY
DAPAT_AQUAE     --------------------QGVDVIDLGVGDPDMPTKPIVEAAKKANPENHKYPSYVGKYEFRKAVADW
DAPAT_CARHZ     ----------IERLIAEKKEAGVDVISLGIGDPDTPTHIIEELYLAAQNPENHQYPSSGMLSYRQAVAAW
PATA_BACSU      ------------------------VISLTIGQPDFFTPHHVKAAAKKAIDENSYTPNAGYLELRQAVQLY
DAPAT_DESDG     ----------IDKVKAEVAARGVDIISLGIGDPDMPTPDFVIEALKKAAEKHQYPSYTGMLAFRQEVANW
1A112_ARATH     -----------------------------------------------------YKPFEGLLELRVAFADF
DAPAT_PROMA     ------------------------LIRLGIGDVTEPLPQACCKAMKTAIEERGYGPEQGYLWLREAIAND
ATTY_TRYCR      ---------------------------------------------------NGYFPTVGSPEAREAVATW
DAPAT_DESAD     ----------IDRLKAEVAAQGVDIISLGIGDPDLPTPDFIIEALHKAAKNHQYPSYVGLLTFRQAVADW
HIS8_GRABC      -------------------------------------------------------PDGGSHALREAIGRY
DAPAT_EUBE2     ------STIGKKVAAYQQANPDKEIIRLGIGDVTQPLAPAVIDALHKSVDEHGYAPDLGYEFLRSAIADH
PATR_STRCO      ---------------------------------GIPTYKPGKPAAADGSNENPYPPLPGVMETVTAAAAS
DAPAT_HALOH     ----------IDKMIARAKKEGVDVISFGIGDPDQPTPDIINKMIEAVKDPSSYPSYEGMYEYRKTVADW
DAPAT_SYNPW     ------------------------LIRLGIGDVTEPLPQACRDAMKTAIDAHGYGPEQGYGWLREAIATH
AAT2_METJA      -------------ALAQKESEGKKVIHLEIGEPDFNTKPIVDEGISLKEGKTHYTDSRGILELREKISEY
DAPAT_SYNS9     ------------------------LIRLGIGDVTEPLPLACREAMKTAIDAHGYGPEQGYAWLREAIAQQ
DAPAT_DESVM     ----------IDKVKAEVAARGVDIISLGIGDPDMPTPDFIIEAMKKAVERHQYPSYVGMLEFRQEVANW
YFDZ_ECOLI      ---------------ARRRGEDIIDFSMGNPDGATPPHIVEKCTVAQRPDTHGYSTSRGIPRLRRAISRY
DAPAT_DEHSC     ----------ISKKIAEKRAKGEEVISFAIGDPDLPTPKILAELCKAAEDPSNYPETEGLPVLRKAMAEW
DAPAT_DEHSB     ----------ISKKIAEKRAKGEDVISFAIGDPDLPTPKILAELCKAAEDPSNYPETEGLPVLRKAMAEW
PATR_STRAW      -----------------------------------PLPGVLESVASSVGSFNRYPDMACSGLMSELS---
ATTY_MOUSE      --------------------------PTVFGN--LPTDPAMKDALDSG-KYNGYAPSIGYLSSREEVASY
DAPAT_SYNR3     ------------------------LIRLGIGDVTEPLPQACRDAMKNAIDEHGYGPEQGYAWLREAIAKH
DAPAT_DEHE1     ----------ISKKIAEKRAKGEEVISFAIGDPDLPTPKHILAELCKAAEDHRYPETEGLPVLRKAMAEW
YBDL_ECOLI      -------------------------LSQGFPDFDGPRYLQERLAHHVAQGANQYAPMTGVQALREAIAQK
KAT3_DANRE      ------------------------IVNLGQGYPDIPPPSYVKEGLAQAAMVDGFGHPTLVKALSKVYGKV
DAPAT_ARATH     --------------IARRRSAHLQVISLGIGDTTEPIPEVITSALSTIEGYSGYGAEQGAKPLRAAIAKT
ATTY_RAT        --------------------------PTVFGN--LPTDPAMKDALDSG-KYNGYAPSIGYLSSREEVASY
KAT1_HUMAN      ----------------------------------------------------GYPPLTKI-----LASFF
PATR_STRGG      -----------------------------------PLPGVLESALAAAGSFNRYPDMACTGLMNELA---
KAT1_MOUSE      ----------------------------GFPDFSPPDFAVQAFQQATTGNLNQYTSAFGYPPLTKILASF
DAPAT_PROM4     ------------------------LIRLGIGDVTEPLPKACCNAMSTEAGFHGYGPEQGYSWLREAIAKF
ATTY_HUMAN      --------------------------PTVFGN--LPTDPAMKDALDSG-KYNGYAPSIGFLSSREEIASY
Y1391_METJA     ---------------AMKRHPDMELIDMGVGEPDEMADPEVIRVLCEEAENRGYAD-NGIQELKDAVPPY
AATC_RHIME      ----------VNRLKASARAAGADIIDLGMGNPDLPTPQSIVDKLCEVVQDHRYSSSKGIPGLXXXXXXX
ALA2_HORVU      -------------------------------------------AMIPGRATGAYSHSQGIKGLRDAASGI
DAPAT_SYNS3     ------------------------LIRLGIGDVTEPLPQACRDAMKSAIDEHGYGPEQGYAWLREAIADD
BNA3_YEAST      ----------------------------------------------------------------------
KAT1_RAT        ----------------------------------------------------GYPPLTNV-----LASFF
HIS8_LACPL      --------------------------------------------------QSNRYPDADAQELRQAVA--
HIS8_ARTAT      -------------------------------------------------------------ELREALAEY
DAPAT_NOSP7     ------------------------IIRLGIGDVTEPLPEACRTAMIKAGDRNGYGPEQGYAWLREKAAQD
HIS8_MAGSA      ------------------------ILKLSSNEGALGPSPKAMEALRAMAPEMHRYPDGGAEDLRKAIGA-
ATTY_DICDI      ---------------------------------------------------NGYPPSTGYEIAREAVAKY
ATTY_BOVIN      --------------------------PTVFGN--LPTDPAMKDALDSG-KFNGYVPSIGYLSSREEVASY
ALA2_PANMI      -----------------------------------------KQILSTGRATGAYSHSQGIKGLRDAAAGI
DAPAT_DESOH     ------------------------IIKLGIGDATQPLCPACLDAMGTASSFRGYGPEQGYAFLREAAAND
Y104_SULSO      -----------------------------------------------------YTATAGISEFRRELVNL
PATR_LEIXX      -----------------------------------PLASVVAAVGATLGGLNRY-PDAGGADLRDKLA--
HIS8_METAC      ------------------------IIKLGSNENPLGPSPAVRALVETAPGANIY-PSADARELREVLSKY
1A1L2_HUMAN     --------------------------------------------------------------LREEVARY
DAPAT_CYAP4     ------------------------IIRLGIGDVTEPLPAACRTAMIKAGDRSGYGPEQGYEWLRQSIAEH
PATR_MYCSS      --------------------------------------PSVRAAIEKATDQLNRYPDNGYLELREHLASH
PATR_MYCSK      --------------------------------------PSVRAAIEKATDQLNRYPDNGYLELREHLASH
PATR_MYCSJ      --------------------------------------PSVRAAIEKATDQLNRYPDNGYLELREHLASH
HIS8_CHLPD      ---------------------------------------------------NRYPDILPFRGMRSYASFV
DAPAT_THEEB     --------------IARRVNQFLPLIRLGIGDVTEPLPAACREAMIKAGDRKGYGPEQGYPWLREKIAAH
AAT2_BACSU      ---------------------GAHIINLGQGNPDLPTPPHIVEALSLNPSFHGYGPFRGYPFLKEAIAAF
HIS8_MYCUA      ----------------------------------------------------------------------
DAPAT_DESDA     ------------------------VISLGIGDVTRPLPPAVIQALHKAVDERGYGPEQGYAFLRDVIMQY
HIS8_RHORT      ------------------------IIKLSSNEGALGASPRVRDALASAGEAHRY-PDGNATALREALG--
HIS8_MYCMM      ----------------------------------------------------------------------
HIS8_CORDI      --------LPIREELRGQSAYGAPQLDLNTNENPYPVEELARVVAEQASNLNRY-PERDAVELRTELARY
DAPAT_SYNP6     ------------------------IIRLGIGDVTEPLPVACRQAMDMGQRENGYGPEQGYAWLREKIAAH
DAPAT_SYNE7     ------------------------IIRLGIGDVTEPLPVACRQAMDMGQRENGYGPEQGYAWLREKIAAH
DAPAT_PROM3     ------------------------LIRLGIGDVTEPLPLACRNAMKVAIDEHGYGPEQGYDWLREAIAKH
HIS8_METMA      ------------------------IIKLGSNENPLGPSPKAVKALIEAAPGANIYPSADAHELREALSKY
HIS8_LEUMM      ---AYQAELPVETVKAKYGLQHLARLSANESVYG-PSPKVAQAVRAVSDDILGYYPDGQATELREAVAKL
DAPAT_CHLFF     ----------------REKHPEISIIDLSIGDTTQPLHASVIDTFSTSVRKRGYGPELGLPALKEKLSEV
ALAT1_HUMAN     -----------------------------------------------GHSLGAYSVSSGIQLIREDVARY
ALAT1_BOVIN     -----------------------------------------------GHSLGAYSISAGVQMIREDVARY
KAT3_MOUSE      ----------------------------------------------------GFGHPALVKALSCLYGKI
KAT3_BOVIN      ----------------------------------------------------GFGHPSLVKALSCLYEKF
HIS8_METBF      ------------------------IIKLGSNENPLGPSPKAVQAMMDTAPFANIYPSADAIELREALSRY
DAPAT_SYNPX     ------------------------LIRLGIGDVTEPLPLACREAMKTAIDAHGYGPEQGYGWLREAIAKH
DAPAT_PARUW     -----------NEFLKKHPSAQL--INLGIGDTTQPIPLYISEAMQNFAKQRGYGTEQGSILLREAIAEQ
DAPAT_SYNY3     ------------------------VIKLGIGDVTEPLPLACRQAMAKAIDDKGYGPEQGYAWLREKIAQH
DAPAT_GEOSF     ------------------------VIRLGIGDVTRPLAPAVLDDLATTDKFAGYGPEQGYDWLINAIIDK
HIS8_RHOSR      --------------------------------------------------------------LRTDLAAY
HIS8_PELLD      ---------------------------------------------------------------------Y
DAPAT_TRIEI     ------------------------IIKLGIGDVTEPLPKAMTKAVAEMGDRSGYGPEQGYAWLREKAAQD
DAPAT_SYNJB     ------------------------IIKMGIGDVTEPLPEACRTAMIRAVEERGYGPEQGYEWLRQAIARH
DAPAT_SYNJA     ------------------------IIKMGIGDVTEPLPEACRTAMIRAVEERGYGPEQGYEWLRQAIARH
DAPAT_DESAP     ----------IEQLIADKKAQGVDVISLGIGDPDVPTPDHIIEAAEKEPANHQYPSSAGMPAYRRAVADW
DAPAT_ACAM1     -----------------------PIIKLGIGDVTEPLPEACRSAMVTAVEDKGYGPEQGYGWLREKIAAH
DAPAT_PROMM     ------------------------LIRLGIGDVTEPLPLACRNAMKVAIDEHGYGPEQGYDWLRKAIAKH
AAT_STRGR       ---------------------GRPVIGFGAGEPDFPTPDYIVDAAVEACRNPKYHRYTPQRELKAAIAEK
HIS8_UNCMA      ------------------------IIKLASNESCLGASPLAIEAIRKAACDAHVYPSVDAIELREALA--
HIS8_SYMTH      -------------------------------------------------------PEGTARRLRERLAQM
HIS8_RUBXD      ----------------------------------------------------------------------
DAPAT_SYNP2     -----------------------PIIKLGIGDVTEPLPAACREAMAKAIDDKGYGPEQGYAWLREKIAAH
ALAT2_MOUSE     -----------------------------------------------GNSLGSYSASQGVNCIREDVAAF
DAPAT_LEPBL     ------------------------IIRLGIGDVTLPIVPSVVDAMGTAGGFHGYGPEQGYSFLLKSIANN
DAPAT_LEPBJ     ------------------------IIRLGIGDVTLPIVPSVVDAMGTAGGFHGYGPEQGYSFLLKSIANN
ALAT2_HUMAN     -----------------------------------------------GNSLGSYSASQGVNCIREDVAAY
PATR_MYCA9      --------------------------------------PSVRAALAEAGSLINRYPDNGYAELRSHLAKH
HIS8_CORGL      -------------------------------------------------------------ELRDELAAY
DAPAT_EUBR3     ------STIAKKVAAYQEANPDKEIIRLGIGDVTQPLAPAIIDALHKAVDEHGYAPDLGYEFLRKAISND
DAPAT_CHLTB     ------------------------VINLSIGDTTQPLNASVAEALSSPTTCRGYGPDFGLPALRQKLSED
DAPAT_CHLT2     ------------------------VINLSIGDTTQPLNASVAEALSSPTTCRGYGPDFGLPALRQKLSED
1A12_CUCPE      ----------------------------------------------------------GLQEFRKAMASF
HIS8_CORGB      -------------------------------------------------------------ELRDELAAY
DAPAT_LEPIC     ------------------------IIRLGIGDVTLPIVPSVVDAMGTVGGFHGYGPEQGYSFLLKSIADH
DAPAT_CHLTR     ------------------------VINLSIGDTTQPLNASVAEALSSPTTCRGYGPDFGLPALRQKLSED
DAPAT_CHLTA     ------------------------VINLSIGDTTQPLNASVAEALSSPTTCRGYGPDFGLPALRQKLSED
ALAT1_MOUSE     -----------------------------------------------GHSLGAYSISSGIQPIREDVAQY
HIS8_ACICJ      -------------------------------------------------------PDGGATSLRAAIG--
DAPAT_SYNSC     ------------------------LIRLGIGDVTEPLPLACREAMKTAIDAHGYGPEQGYGWLREAIAND
DAPAT_CHLAB     ----------------RKQHPEASIIDLSIGDTSYPLHTSVIHTFTQSVEKRGYGPELGLPALREKLSEV
1A1C_TOBAC      ----------------------------------------------------------GLPEFRSAIAKF
PATR_THEFY      -------------------------------------------------NESPFGPLPSVRQAIADAAAD
ALAM_YEAST      -----------------------------------------------GGSVGAYSSSQGVEGIRKSVAEF
HIS8_DESHY      ---------------------------LDANENPLPWPPGMIEQLLGSDIAFNRYPDGGAQELKEALSRY
DAPT1_ANAVT     ------------------------IIRLGIGDVTEPLPEACRTAMIQAGDRSGYGPEQGYAWLREKIATQ
DAPAT_LEPIN     ------------------------IIRLGIGDVTLPIVPSVVDAMGTVGGFHGYGPEQGYSFLLKSIADH
1A11_CUCPE      ----------------------------------------------------------GLPEFRNAIANF
Y1527_METMP     ----------------------------------------------------------GVQALKDEIPIY
DAPAT_CHLCV     ----------------REAHPDVSIIDLSIGDTTQPLHTAVMDTFTKSVQKRGYGPELGLSTLREKLSEV
ALAT1_RAT       -----------------------------------------------GHSLGAYSISSGIQPIREDVAQY
KAT3_HUMAN      ----------------------------------------------------------------------
1A12_ARATH      ----------------------------------------------------------GLKKFRQAIAHF
MTNE_BACSU      ----------------RKLAEGHDVINLGQGNPDQPTHIVEEMKRAVADPENHYSSFRGSYRLKSAAAAF
HIS8_MYCPA      -------------------------------------------------------------QLRSDLARY
HIS8_MYCA1      -------------------------------------------------------------QLRSDLARY
HIS8_CHLL2      ----------------------------------------------------------------------
DAPT1_ANASP     ------------------------IIRLGIGDVTEPLPAACRSAMIQAGDRSGYGPEQGYAWLREKIATQ
ALAT_SCHPO      --------------------------------------------LKESGSLGAYSASQGIPLVRRHVADF
ALAT2_XENTR     -----------------------------------------------GGHSIGYSASQGIEVIRQDVAKY
ALAM_DICDI      ---------------------------------------------SINNTTGAYSNSQGIGLVLRSVADF
Y1479_METJA     -----------------------------------------------------YCPTKGLLETREFLAEQ
PATR_CORGB      ---------------------------LSSNEVSFSPLPAAVDAVTEATQGANRYPDMGAVELREALAEH
DAPAT_GEOMG     ------------------------VIRLGIGDVTRPLAPAIIDDLATIDNFAGYGPEQGYDWLINAIIEK
1A17_ARATH      ----------------------------------------------------------GLKTFRQAMASF
HIS8_RHOBA      -----------------------------------PPAPVVSAIQSAAGPLNRY-PDPMATSFRRAAAN-
DAPAT_PELPD     ------------------------VIRLGIGDVTRPLPPAILKAFHDAVDDAGYGPEQGYDWLNSVIEKS
DAPAT_GEOUR     ------------------------VIRLGIGDVTRPLAPAVLDDLGTTDNFAGYGPEQGYDWLINAIIEK
ALAT2_DANRE     ---------------------------------------------SCGGNSIGYTTSQGIDCVRQDVAKY
1A11_CUCMA      ----------------------------------------------------------GLPEFRNGIASF
HIS8_CHLTE      ----------------------------------------------------------------------
HIS8_AZOC5      ------------------------VFKLSSNETPLGPSPKAIAAFQSAGTNLQDYPDGSSTALREAIG--
DAPAT_PROM5     -------------------NQGSEVIKLGIGDVTEPLPNACINAMSKALNEKGYGPEQGYEWLREKISND
DAPAT_GEOLS     ------------------------VIRLGIGDVTRPLAPTVLDDLATTDQFAGYGPEQGYDWLINAIIEK
DAPAT_CLOPH     ------------------------VISLGIGDVTLPLAPSIISALHKATDEKGYSPDLGYEFLRSAIAKH
1A16_ARATH      ----------------------------------------------------------GLPEFRQAVAKF
HIS8_SILPO      ------------------------VIKLSSNENPLGPSPAAVEAIRATAAQAHRYPSTDHAELRAAIGAV
DAPAT_GEOSL     ------------------------VIRLGIGDVTRPLAPAVIDDLATTENFAGYGPEQGYDWLINAIIEK
DAPAT_CYAA5     ------------------------IIKLGIGDVTEPLPEACRTAMIKAGDRSGYGPEQGYGWLREKAAQD
DAPAT_CLOTH     ----------------RKENPNAKIIRLGIGDVTKPLAPAVIDALHKAVDEKGYGPEQGYSFLVSKIIEY
1A1C_PHAAU      ----------------------------------------------------------GLAEFRNAVAKF
1A12_SOLLC      ----------------------------------------------------------GLPEFRKAIAKF
PATR_CORGL      -------------------------------------------------------PDMGAVELREALAEH
HIS8_METNO      -------------------------------------------------------PDGSATDLRRAIAGK
DAPAT_DESAH     --------IAKRVAAHQESHPGVDIIRLGIGDVTHALPDACVAAFHRGVDERGYGPEQGYAFLREKIASE
DAPAT_CHLPN     ----------------RKENPEISVIDLSIGDTTQPLCRSITQAIKEQETYRGYGPETGLEKLRKIASEV
ALAT2_XENLA     -----------------------------------------------GGHSIGYSASQGIEVIRQDVAKY
PATR_MYCVP      --------------------------------------PSVRAAIEKAIDGINRYPDNGYVELRERLAKH
PATR_CORDI      -------------------------------------------------------PDMGVTELRGALS--
KAT3_RAT        ----------------------------------------------------GFGHPSLVKALSCLYGKI
HIS8_PROVI      ---------------------------------------------------------------------Y
HIS8_PELPB      ----------------------------------------------------------------------
HIS8_MOOTA      ------------------------VIKLASNENPLGPSPDAVQALQEASDRIFLYPDGNCYYLKEALAAK
HIS8_LACF3      ----------------------------------------------------------------------
AAT3_BACSU      ---------------------------------------------------HGYIQNQGLLAAREKVAQF
1A1C_DIACA      ----------------------------------------------------------GLPEFRSAVAKF
1A14_SOLLC      ----------------------------------------------------------------------
1A11_PRUMU      ----------------------------------------------------------GFPEFRKAVAMF
KAT_DICDI       ----------------------------------------------------------------------
HIS8_METS4      ---------------------GVKLHKLSSNETPLGPSPAAVAAMRETASHLELYPDGSAAALRRAIAGK
HIS8_CHLP8      -------------------------------------------------------------------ATY
DAPAT_MICAN     ------------------------IIRLGIGDVTEPLPLACREAMIKAGDRSGYGPEQGYAWLREKIAVH
DAPAT_HELMI     ------------------------IIRLGIGDVTRPLVPAVVEAMKKAVDERGYGPEQGYDFLGQIIEND
CBL_BACSU       -------------------------LPMWVADMDFRAPEAITEALKERLDHGIFGYTTPDQKTKDAVCGW
1A1C_SOYBN      ----------------------------------------------------------GLPEFRNAVAKF
1A110_ARATH     -----------------------------------------KEAISDGLSISGYEPSDGLLELKMAVAGF
HIS8_COREF      ---------------------------------------------ATATELNRY-PERDSVELRDALADY
DAPAT_PROMP     ------------------------VIKLGIGDVTEPLPKAMGEALNEMGTNNGYGPEQGYGWLREKSVND
DAPAT_BACV8     ------------------------LIRLGIGDVTRPLPQTSIEAMYKAVDEHGYGPEQGYDFLIDAVIND
PATR_PROAC      -------------------------------------------------------PLMSAEEVRSTIAGH
HIS8_LEUCK      ------------------------------------VGPAIRDV---SDDVLGFYPDGQATALRQAVAKL
DAPAT_PROMS     --------IAKRVKLYSQSNKNAEIIKLGIGDVTEPLPRACIEAMGKALDDRGYGPEQGYAWLREKISEH
HIS8_RHOPT      ---------------------GRKVFKLSANETPFGPSPHAIAAYKSAADHLEDYPEGTSRILREAIG--
HIS8_RHOPA      ---------------------GRKVFKLSANETPFGPSPHAIAAYKSAADHLEDYPEGTSRILREAIG--
HIS8_MYCS2      ----------------------------------------------------------------------
DAPAT_GEOBB     ------------------------VIRLGIGDVTQPLTPTIHDAVDDLASENGYGPEQGYDFLIDAII--
HIS8_THEPX      ----------------------------------------------------------------------
HIS8_DINSH      ----------------------------------------------------------------------
DAPAT_METTH     ----------------QRKNPDADIIRMGIGDVTRPLPEAVVEAFHRAVDERGYGPEQGYPFLREAIAND
DAPAT_CYAP7     ------------------------IIKLGIGDVTEPLPQACRQAMIKAGDRKGYGPEQGYNWLREKIAND
PATR_MYCS2      --------------------------------------PSVREAILKATDLINRYPDNGYLDLRERLAKH
PATR_MYCBT      --------------------------------AGLPVYKTVPGAIKLASNETVFGPLPSVRAAIDRATDT
PATR_MYCBP      --------------------------------AGLPVYKTVPGAIKLASNETVFGPLPSVRAAIDRATDT
PATR_MYCBO      --------------------------------AGLPVYKTVPGAIKLASNETVFGPLPSVRAAIDRATDT
HIS8_HALMA      -------------------------------------------------------PKASHADLVDELADM
1A1L1_BOVIN     --------------------------------------------------------------LREEVASF
HIS8_HALLT      --------------------------------------PAAVDAIREHADRVHQYPKSSHTDLTAKLAEK
DAPAT_PROM9     ------------------------IIKLGIGDVTEPLPRACIDAMSKALDDRGYGPEQGYSWLREKISEH
DAPAT_CYAP8     ------------------------IIKLGIGDVTEPLPEACRTAMIKAGTFKGYGPEQGYEWLREKIATH
1A18_ARATH      ----------------------------------------------------------GLPSFKNAMADF
HIS8_THEP3      ----------------------------------------------------------------------
DAPAT_DESPS     ------------------------VIKLGIGDVTRGLTPSVIAAFHQAVDEHGYGPEQGYAFLREAIAND
HIS8_RHOP2      ---------------------GRKVFKLSANETPFGPSPHAIAAYKSAADHLEDYPEGTSRVLREAIG--
HIS8_MYCLE      ------------------------------------VDDVVRSVQKVAVDLHRYPDRDAVALRQDLASYL
HIS8_MYCLB      ------------------------------------VDDVVRSVQKVAVDLHRYPDRDAVALRQDLASYL
HIS8_BEII9      ---------------------------LSSNETPLGPSPEAQKAFAASAEKLALYPDGAATLLRTAIAS-
HIS8_BACHD      -----------------KRELGLEVVKLASNENPFGASPKVAEAIQEALHHTAIYPDGYARTLRDKVAHY
DAPAT_PROMT     ------------------------LIRLGIGDVTEPLPLACREAMKAAIEERGYGPEQGYKWLREIISND
DAPAT_PROM1     ------------------------LIRLGIGDVTEPLPLACREAMKAAIEERGYGPEQGYKWLREIISND
YDT4_SCHPO      ---------------------------------------------------NQYSHTRGRPSLRKALSEA
PATR_MYCTU      --------------------------------AGLPVYKTVPGAIKLASNETVFGPLPSVRAAIDRATDT
PATR_MYCTA      --------------------------------AGLPVYKTVPGAIKLASNETVFGPLPSVRAAIDRATDT
PATR_MYCPA      --------------------------------AGLPVYVPGKNSIKLASNETVYGPLPSVHAAIERAVAV
PATR_MYCA1      --------------------------------AGLPVYVPGKNSIKLASNETVYGPLPSVHAAIERAVAI
HIS8_NITWN      ----------------------------------------------------------GTSRVLRAAIG-
DAPAT_PARD8     ------------------------IIRMGIGDVTQPLAPAVIEAMHKAVEEHGYGPEQGYPFLIDAIIND
HIS8_SPHAL      --------------------------PLGTGEKARAAFAAVQSA----PDALSRYPDPGSVELRAAIAAK
HIS8_MARMM      ----------------------------------------------------------------------
HIS8_BREBN      -----------------KREFGLTVIKLASNENPFGSSPKAKAAISEQLDNLALYPDGASLNLRWDLADF
HIS8_ANOFW      ----------------KREYQLETVIKLASNENPYGCSPLVRQAVMNELDDLALYPDGYSRTLREALAAH
DAPAT_GEOSM     ------------------------VIRLGIGDVTQPLTPTILDDLASENSFMGYGPEQGYDFLIDAIV--
1A12_CUCMA      ----------------------------------------------------------------------
PATR_RHOSR      ----------------------------------------------------------------------
HIS8_RHOOB      --------------------------------------------------------------LRTDLAAY
HIS8_PARDP      ------------------------IMEISLYEGGASKVAGVENVVKLSSNENPFGPSDKAREAMIRAAHG
DAPAT_CHLMU     ------------------------VINLSIGDTTQPLDTSVAEAFSQASTYCGYGPDFGLPSLRQKLSEK
ALAT_YEAST      -----------------------------------------------GGSIGAYSHSQGVPGIRQTVADF
HIS82_NITMU     ------------------------IIKLASNENPLGTSPMALNAMSKALDEVSLYPDGSGFELKAALS--
HIS81_ARCFU     ------------------------------------------------------------RELREKISDY
1A111_ARATH     ----------------------------------------------------------------------
YJIR_ECOLI      ----------------------------------------------------GYDLLAGQRVLREQIARL
HIS8_ZYMMO      ---------------------GRPAVKLSSNENPLGTSLKAKEAYREAIDSLSLYPDSGATALREAIGAC
HIS8_HALSA      -------------------------------------------------------PKAVHADLTGALADR
HIS8_HALS3      -------------------------------------------------------PKAVHADLTGALADR
HIS8_AERHH      ----------------------------------------------------------------EVVNGY
DAPAT_BACFR     ------------------------IIRLGIGDVTRPLPKACIEAMHKAVEERGYGPEQGYDFLIEAIIND
DAPAT_BACFN     ------------------------IIRLGIGDVTRPLPKACIEAMHKAVEERGYGPEQGYDFLIEAIIND
COBD_THETN      ------------------------------------------------------------RRLKEAIAEY
1A1C_MALDO      ----------------------------------------------------------------------
HIS8_SILST      --------------------------------------------------------------LRAAIA--
HIS8_ROSDO      ----------------------------------------------------------------------
HIS8_NOVAD      --------------------------PLGTSAAAL-------EARAHAGDPARY-PDPDSKDLRAAIG--
HIS82_NITEU     ------------------------VVKLASNENPLGTSPLAKEAMIQALNESARYPDGSGFELKAALS--
DAPAT_PROM0     ------------------------IIKLGIGDVTEPLPRACIEAMGKALDEKGYGPEQGYSWLREKISEH
CBL_MYCTU       ------------------RAHPADVLPLWVAEMDVKLPPTVADALRRAIDDGDTGYPYGTEAVREFACQR
CBL_MYCBO       ------------------RAHPADVLPLWVAEMDVKLPPTVADALRRAIDDGDTGYPYGTEAVREFACQR
HIS8_STRMK      ----------------------------------------------------------------------
HIS8_ROSCS      ----------------------------------------------------------------------
HIS8_NITHX      ---------------------GRKVFKLSANETPFGPSPKAMDAYRNAVAHLQDYPEGTSRVLREAIG--
HIS8_HALWD      --------------------------------------PAAVDAIADTAETVNTYPKSSHTDLTARIADY
HIS81_RALEJ     --------------------------PLGMPESXXXXXXXXXXELGRYPDSNGF----------ELKAAL
DAPAT_LAWIP     ------------------------IIRLSIGDVTRPLVPAVIKALHDATDEHGYGPEHGYEFLGEIIAND
DAPAT_DESHD     ------------------------IIRLGIGDVTRPLAPVVVEAMKQAVEERGYGPEQGYDFLIEKIAND
HIS8_METTH      ------------------------IIKLGSNENPLGPSPAAVEAMERELESVHRYPESALTDLREAIADY
HIS8_CALS8      ----------------------------------------------------------------------
HIS8_BACCN      -----------------KREYGLSIVKLASNENPFGCSKRVKEALALLNEQYALYPDGAAFELRQKVANH
HIS8_AERS4      ----------------------------------------------------------------EVVNGY
DAPAT_PELCD     ------------------------IIRLGIGDVTQPLAPAVLKAFHDGVDDMGYGPEQGYEFLIDTLIEK
DAPAT_LEPBP     -------------------NQNAKIIRLGIGDVTLPLAPTIVNAMGSAGGFHGYGPEQGYSFLQKIIAHD
DAPAT_LEPBA     -------------------NQNAKIIRLGIGDVTLPLAPTIVNAMGSAGGFHGYGPEQGYSFLQKIIAHD
DAPAT_DESHY     ------------------------IIRLGIGDVTRPLAPVVVEAMKQAVEERGYGPEQGYDFLIEKIAND
1A14_ARATH      ----------------------------------------------------------------------
YDFD_BACSU      ------------------------LIQLSKGELSAEIFPLMMGKVSQHMEAFGYEEPKGYLPLREALSNY
HIS8_PROA2      ----------------------------------------------------------------------
HIS8_MYCTU      ----------------------------------------------------------------------
HIS8_MYCTA      ----------------------------------------------------------------------
HIS8_MYCBT      ----------------------------------------------------------------------
HIS8_MYCBP      ----------------------------------------------------------------------
HIS8_MYCBO      ----------------------------------------------------------------------
HIS8_ANADF      --------------------------------------------------------------LRNAIAA-
1A11_ORYSJ      ----------------------------------------------------------GLPAFKNALARF
1A11_ORYSI      ----------------------------------------------------------GLPAFKNALARF
HIS8_STRAW      -------------------------------------------------------------ELRTELATY
HIS8_RHISN      --------------------------------------------------------------LREAAAAS
HIS8_NOCFA      ----------------------------------------------------------------------
HIS8_BRUSU      ------------------------VYKLSSNETPLGPSPHAREAYRHAGEKLELYPDGQALALRQAIA--
HIS8_BRUO2      ------------------------VYKLSSNETPLGPSPHAREAYRHAGEKLELYPDGQALALRQAIA--
HIS8_BRUAB      ------------------------VYKLSSNETPLGPSPHAREAYRHAGEKLELYPDGQALALRQAIA--
HIS8_BRUA2      ------------------------VYKLSSNETPLGPSPHAREAYRHAGEKLELYPDGQALALRQAIA--
HIS8_AKKM8      ----------------------------------------------------------------------
PATR_MYCUA      --------------------------------AGLPVYKTVPGAIKLASNETVFGPLPSVRAAIEHATQS
PATR_MYCMM      --------------------------------AGLPVYKTVPGAIKLASNETVFGPLPSVRAAIEHATQS
PATR_CORJK      ----------------------------------------------------------------------
HIS8_TOBAC      -----------------------PILPFEVLSTRLGRKP--EDIVKLDANENPYGPPPEVIEARTLRAAL
HIS8_RHOS5      ------------------------ILDIALYEGGKSHVAGIQNALKLSSNENPFGPSPKAKELRQAIA--
HIS8_GEOKA      -----------------KRQYGLPIIKLASNENPYGSSPSAKAAIAAELDRLAVYPDGCARTLREKVAKH
HIS8_GEOBB      -------------------------IKLNTNENPYPPSPKVLEAIAKAGEGLRRYPDAASRLAREEAAKV
HIS81_RHIME     ----------------------------------------------------------------------
DAPAT_BACTN     ------------------------IIRLGIGDVTQPLPKACIEAMHKAVEERGYGPEQGYDFLIEAIIND
DAPAT_AZOPC     ----------------KQNNKNREVISLGIGDVTQAIAPAVVEAIHKATNERGYAPYEGYDFLIQAILND
HIS8_YERE8      ----------------------------------------------------------------------
HIS8_STRCO      -------------------------------------------------DLNRY-PDRDAVELRTQLARY
HIS8_NICPL      -----------------------PILPFEVLSTRLGRKP--EDIVKLDANENPYGPPPEVIEARTLRAAL
HIS8_GEOSM      -------------------------IKLNTNENPYPPSPKVLEAIAAGEGLRRYPDAASVLAREEAAKVY
HIS8_ACIAC      -------------------------------------------------------PGARLTDLKSALAAH
HIS81_PASMU     --------------------------------------------------------------------GY
CBL_MYCLE       ------------------------VLPLWVAEMDVLLAPTVAEAVHRAVDNGDTGYPYGTEAISEFASQR
1A1L1_TAKRU     ----------------------------------------------------------------------
1A1L1_HUMAN     ----------------------------------------------------------------------
YISV_BACSU      -----------NSSIIQAINQNEPIIRLGTGELSPDLVPAMFQQINPGVLSLGYEQPKGNRQLREAVADH
HIS8_VIBCM      ----------------------------------------------------------------------
HIS8_VIBCH      ----------------------------------------------------------------------
HIS8_VIBC3      ----------------------------------------------------------------------
HIS8_THEGJ      ---------------------------------------------------------------REAIADF
HIS8_RHOP5      ---------------------GRKVFKLSANETPFGPSPHAIAAYQSAADHLEDYPEGTSRVLREAIG--
HIS8_NATPD      ----------------------------------------------------------------------
HIS8_METFL      ----------------------------------------------------------------------
HIS8_RHOPB      -------------------------------------------------------PEGTSRVLREAIG--
HIS8_PHOPR      ----------------------------------------------------------------------
HIS8_METVS      ----------------------------------------------------------------------
HIS8_DEHE1      --------------------------------------PTVQKAMSTF-DQYHIYPDATQFEIRRLLAEY
HIS8_BDEBA      ----------------------------------------------------------------------
HIS83_BURS3     --------------------------------------------------------------LRSHLAAY
HIS81_HAEI8     -------------------------------------YPTSPEFQLSGKDLNRY-PEPQPQRVVQAYANY
1A1L2_MOUSE     --------------------------------------------------------------LREELASF
HIS8_RHOSK      ------------------------ILDIALYEGGKSHVAGIQNALKLSSNENPFGPSPKAKELRHAIA--
HIS8_RHOS4      ------------------------ILDIALYEGGKSHVAGIQNALKLSSNENPFGPSPKAKELRHAIA--
HIS8_RHOS1      ------------------------ILDIALYEGGKSHVAGIQNALKLSSNENPFGPSPKAKELRHAIA--
HIS8_PECCP      ----------------------------------------------------------------------
HIS8_ARATH      -----------------------PILPFEVLSAQLGRKP--EDIVKLDANENPYGPPPEVRRLRDALA--
HIS82_RHILO     -------------------------------------------------------PDGTARRLREAIA--
1A1L1_MOUSE     --------------------------------------------------------------LREEVASF
YEY2_YEAST      ----------------------------------------------------------------------
HIS8_VIBFM      ----------------------------------------------------------------------
HIS8_METMP      ----------------------------------------------------------------------
HIS8_HAEIG      -------------------------------------YPTSPEFQLSGKDLNRY-PEPQPQRVVQAYANY
HIS8_BRUME      ------------------------VYKLSSNETPLGPSPHAREAYRHAGEKLELYPDGQALALRQAIA--
HIS83_RHILO     --------------------------------------------------------------LREAAANA
HIS82_THIDA     ------------------------------------------------GDTLRLYPDPNSDRLRAAIAAY
HIS82_CARHZ     ------------------------------------ISPKVAAAIKEAVDKVNYYPDGGAFRLKEKIAAK
HIS81_HAEIN     -------------------------------------YPTSPEFQLSGKDLNRY-PEPQPQRVVQAYANY
HIS8_MYCSS      --------------------------------------------------------------LRSDLADY
HIS8_MYCSM      ----------------------------------------------------------------------
HIS8_MYCSK      --------------------------------------------------------------LRSDLADY
HIS8_MYCSJ      --------------------------------------------------------------LRSDLADY
HIS8_METM5      ----------------------------------------------------------------------
HIS8_GLUDA      --------------------------------------PKLTNLIKLNTNESPYGPPPGALEAIRAAAD-
HIS8_GEOUR      ----------------------------------------------------------------------
HIS82_BRAJA     ---------------------GRKVFKLSANETPFGPSPKAIEAFKKVADHLEDYPEGTSRVLREAIG--
1A19_ARATH      ----------------------------------------------------------------------
PATR_RHOOB      ----------------------------------------------------------------------
HIS8_XANP2      ----------------------------------------------------------------------
HIS8_ROSS1      ----------------------------------------------------------------------
HIS8_HELHP      -------------------------------EAGKPIELVVRDIIKLGSNENPYGPDDSMYELKNALASH
HIS8_HAEIE      ----------------------------------------------SGKDLNRY-PEPQPQRVVQAYANY
HIS8_COLP3      ----------------------------------------------------------------------
HIS8_BLOPB      ---------------------------------------------------------------QEVINNY
HIS8_VIBF1      ----------------------------------------------------------------------
HIS8_SHEON      ----------------------------------------------------------------------
HIS8_POLNA      -------------------------------------------------------PDGRVNDLRRALADY
HIS8_LYSSC      -----------------QREYGLKVIKLASNENPFGCSPKVTAYLQNNAVNHALYPDGYAQNLRTAVANH
HIS8_GEOTN      ------------------------IIKLASNENPYGSSPTVKSAIAAELDRLAVYPDGYARALREKVANH
HIS8_DEHSB      --------------------------------------PTVRQAMSEFNQYHIY-PDATQSEIRRLLSEY
HIS8_BAUCH      ----------------------------------------------------------------------
HIS8_ALISL      ----------------------------------------------------------------------
HIS82_OCEIH     ----------------------------------------------------------------------
HIS81_BURS3     -------------------------------------------------------PAALLDKLRHAM---
HIS8_MYCVP      ------------------------------------IDDVAQSVREVAGELHRYPDRDAVALRTDLAAYL
HIS8_ERWCT      ----------------------------------------------------------------------
HIS8_BACSU      ----------------------------------------------------------------------
HIS8_VIBPA      ----------------------------------------------------------------------
HIS8_VIBHB      ----------------------------------------------------------------------
HIS8_RHOCS      ------------------------LLRLASNEGALGPSPRAVEAFRAVGPEIHRYPDGGSTRLREAIG--
HIS8_CORJK      ------ADLPLREELRGKSAYGAPQLSLNTNENPYPPSPIARRVAELGKQLNRY-PDRDAVGLREALAAY
HIS82_MANSM     ----------------------------------------------------------------------
HIS82_BACC1     --------------------------------------PRVLDELQKSWLDHALYPDGGATTLRQTIANK
HIS8_DEHSC      --------------------------------------PTVRQAMAEFNQYHIY-PDATQSEIRRLLSEY
HIS8_AGRT5      ----------------------------------------------------------------------
YDIU_SHISS      ----------------------------------------------------------------------
YDIU_SHIBS      ----------------------------------------------------------------------
YDIU_SHIB3      ----------------------------------------------------------------------
YDIU_ESCF3      ----------------------------------------------------------------------
YDIU_ECOUT      ----------------------------------------------------------------------
YDIU_ECOSE      ----------------------------------------------------------------------
YDIU_ECOLI      ----------------------------------------------------------------------
YDIU_ECOLC      ----------------------------------------------------------------------
YDIU_ECOL6      ----------------------------------------------------------------------
YDIU_ECOL5      ----------------------------------------------------------------------
YDIU_ECOK1      ----------------------------------------------------------------------
YDIU_ECOHS      ----------------------------------------------------------------------
YDIU_ECODH      ----------------------------------------------------------------------
YDIU_ECOBW      ----------------------------------------------------------------------
YDIU_ECO81      ----------------------------------------------------------------------
YDIU_ECO5E      ----------------------------------------------------------------------
YDIU_ECO57      ----------------------------------------------------------------------
YDIU_ECO55      ----------------------------------------------------------------------
YDIU_ECO45      ----------------------------------------------------------------------
YDIU_ECO27      ----------------------------------------------------------------------
YDIU_ECO24      ----------------------------------------------------------------------
HIS8_SODGM      ----------------------------------------------------------------------
HIS8_METM7      ----------------------------------------------------------------------
HIS8_MESSB      ---------------------------LSSNETPLGPSPAALEAVREASQHLEIYPDGSASKLRDAIA--
HIS8_LISIN      ----------------------------------------------------------------------
HIS8_KLEP3      ----------------------------------------------------------------------
HIS8_BIFLO      -------------------------------------------------------------ELRQAFSDY
1A15_ARATH      ----------------------------------------------------------------------
YDEF_BACSU      ---------------------------------------------------------------KDAAVKL
HIS8_RHOPS      ---------------------GRKVFKLSANETPFGPSPHAIAAYKSAADHLEDYPEGTSRVLREAIG--
HIS8_METPP      -------------------------------------------------------------ELRAALARH
HIS8_LISMF      ----------------------------------------------------------------------
HIS8_LISMC      ----------------------------------------------------------------------
HIS8_FRASC      ----------------------------------------------------------------------
HIS8_ENT38      ----------------------------------------------------------------------
HIS8_DESDG      ----------------------------------------------------------------------
HIS81_RHILO     ------------------------IAKLGSNENPLGPSPTLATMLQAGAEMFRLYPDPAGRELRQAIAGF
HIS8_VIBVY      ----------------------------------------------------------------------
HIS8_VIBVU      ----------------------------------------------------------------------
HIS8_LISMH      ----------------------------------------------------------------------
HIS8_KLEP7      ----------------------------------------------------------------------
HIS8_ACEPA      --------------------------------------PKMTDLIKLNTNESPYGPSPRALEAIRAA---
HIS82_RALSO     --------------------------PLGMPASARVAMTAAIDGLARYPDANGFSLKAALHA--------
HIS81_IDILO     -------------------------------------------------DANGYYLKSRLAELNEVGT--
HIS8_LISMO      ----------------------------------------------------------------------
HIS8_CLOK5      ----------------------------------------------------------------------
HIS8_CLOK1      ----------------------------------------------------------------------
HIS8_BURM1      -------------------------------------------------------PAALLDKLRHAM---
HIS8_BACNA      ----------------------------------------------------------------------
COBD_SALTY      ----------------------------------------------------------------------
COBD_SALTI      ----------------------------------------------------------------------
1A13_SOLLC      ----------------------------------------------------------------------
YDIU_SALTY      ----------------------------------------------------------------------
YDIU_SALSV      ----------------------------------------------------------------------
YDIU_SALPK      ----------------------------------------------------------------------
YDIU_SALPC      ----------------------------------------------------------------------
YDIU_SALPB      ----------------------------------------------------------------------
YDIU_SALPA      ----------------------------------------------------------------------
YDIU_SALNS      ----------------------------------------------------------------------
YDIU_SALHS      ----------------------------------------------------------------------
YDIU_SALEP      ----------------------------------------------------------------------
YDIU_SALDC      ----------------------------------------------------------------------
YDIU_SALAR      ----------------------------------------------------------------------
YDIU_SALA4      ----------------------------------------------------------------------
HIS8_STRM5      ----------------------------------------------------------------------
HIS8_DIAST      ----------------------------------------------------------------------
HIS8_ACISJ      ----------------------------------------------------------------------
HIS82_NITOC     ----------------------------------------------------------------------
HIS82_ARCFU     -------------------------------------------------------PKADYARLKKALAEY
HIS81_CAUCR     -----------------------------------------KDAYRNAVDRLHIYPDGKANFLRAAVA--
YDIU_SALTI      ----------------------------------------------------------------------
HIS8_SHEAM      ----------------------------------------------------------------------
HIS8_PELCD      ----------------------------------------------------------------------
HIS8_METI4      ----------------------------------------------------------------------
YDIU_ECOSM      ----------------------------------------------------------------------
YDIU_ECOLU      ----------------------------------------------------------------------
YDIU_ECO7I      ----------------------------------------------------------------------
HIS8_YERPY      ----------------------------------------------------------------------
HIS8_YERPS      ----------------------------------------------------------------------
HIS8_YERPP      ----------------------------------------------------------------------
HIS8_YERPN      ----------------------------------------------------------------------
HIS8_YERPG      ----------------------------------------------------------------------
HIS8_YERPE      ----------------------------------------------------------------------
HIS8_YERPB      ----------------------------------------------------------------------
HIS8_YERPA      ----------------------------------------------------------------------
HIS8_YERP3      ----------------------------------------------------------------------
HIS8_METJA      ----------------------------------------------------------------------
HIS8_GEOSW      -----------------KREYGLTIIKLASNENPYGCSPAVKEAVMKQLDHLAIYPDGYARLLREKVATH
HIS8_GEOSL      ----------------------------------------------------------------------
HIS8_BACLD      ----------------------------------------------------------------------
HIS82_METCA     ----------------------------------------------------------------------
HIS82_HAEIN     --------------------------PFGFPESAKKAIFEQLDKLTRYPDANGF-------ELKQTIA--
HIS82_BACAN     --------------------------------------PRVLDELQKSWLDHALYPDGGATTLRQTIANK
CR3L3_BOVIN     ----------------------------------------------------------------------
HIS8_HALVO      -------------------------------------------------------PKTAHTDLTERLADK
HIS82_PSYA2     ----------------------------------------------------------------------
HIS82_PASMU     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           WERRGLPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAAPSWVSYAAQSHLSGGQPLFVPTAPAQGGVPEP
AAT_THEAQ       FRREGLEVTPEETIVTVGGKQALFNLFQAIGDEVIVLAPYWVSYPEMVRFAGGVPVEVPTLPEEGFVPDP
AAT_THET8       FRREGLSVTPEETIVTVGGKQALFNLFQAIGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDP
AAT_BACY2       FKRDNLEYKPNEIIVGVGAKHVLYTLFQVIGDEVIIPIPYWVSYPEQVKLAGGVPVYIEATSEQNYKITA
AAT1_BACSU      FKRQNIEYKPSQIIVCTGAKHALYTLFQVIEDEVIIPTPYWVSYPEQVKLAGGKPVYVEGLEENHFKISP
AAT_AQUAE       LKENKVEYKPSEIVVSAGAKMVLFLIFMAIGDEVLLPSPYWVTYPEQIRFFGGVPVEVPLKKEKGFQLSL
AAT_BACST       FARQGLDYEPAEVIVCVGAKHALYTLLLDEGDEVIIPTPYWVSYPEQVKLAGGVPVYVEGLEQNHFKITP
AATA_RHIME      FKRENLDYTAAQTIVGTGGKQILFNAFMATGDEVVIPAPYWVSYPEMVALCGGTPVFVPTRQENNFKLKA
AAT_SYNY3       LEKNNLPYEAANILVTNGGKHSLFNLMLAMGDEVIIPAPYWLSYPEMVRLAEGTPVIVNTTAATDYKITP
AAT_PYRHO       YKKYGIDIEVENVIITAGAYELAFESLLERGDEVIIPDPAFVSYAEDAKVAEAKPVRIPLREENNFLPDP
AAT_PYRAB       LKKQNIEADPNMVLVGANQAFLMLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEENEFRLNV
AAT_RHILP       FKREGLDYSWEQTIVGTGGKQILFNAFMATGDEVSIPAPYWVSYPEMVALCGGTRFFV------SATQEH
AATB1_RHIME     FQREGLAYELDEITVATGAKQILFNAMMASGDEVIIPTPYWTSYSDIVHICEGKPVLIACDASSGFRLTA
AAT_SULSO       LNTRGTDVKKEEVIVTPGAKPLVFILYINPSDEVILPDPSFYSYAEVVKLLGGKPIYLKWSREEGFSIDV
AAT_STRVG       TLRSGYEVEASQVLVTNGGKQAIYEAFAAIGDEVIVPAPYWTTYPESIRLAGGVPVDVVADETTGYRVSV
AAT_SULTO       LSSKYESVRKEEVIVTPGAKTALYAFLLYIGDEVIIFDPSFYSYAEVVKMLGGVPVYVKMK-----FNES
AATB2_RHIME     FQREGLAYELDEITVATGAKQILFNAMMASGDEVVIPTPYWTSYSDIVQICEGKPILIACDASSGFRLTA
AAT_MYCTU       YELPGFPRDVDDVYLGNGVSELITMTLQALGDQVLIPSPDYPLWTASTSLAGGTPVHYLCDETQGWQPDI
AAT_MYCBO       YELPGFPRDVDDVYLGNGVSELITMTLQALGDQVLIPSPDYPLWTASTSLAGGTPVHYLCDETQGWQPDI
AAT_THEMA       GERYKKDISPDQVVVTNGAKQALFNAFMALGDEVIVFSPVWVSYIPQIILAGGTVNVVETFMSKNFQPSL
AAT1_METJA      LDDYNLDVDKDNIIVTCGASEALMLSIMTLGDEVLIPNPSFVSYFSLTEFAEGKIKNIDLD--ENFNIDL
AAT_RICCN       FKRENIDYELDEIIVSTGGKQVIYNLFMASGDEVIIPAPYWVSYPDMVALSTGTPVFVNCGIENNFKLSA
AAT_RICFE       FKRENIDYELDEIIVSTGGKQVIYNLFMASGDKVIIPAPYWVSYPDMVALSTGTPVFVNCGIENNFKLSA
AAT_RICBR       FKRENIDYDLEEIIVSTGGKQVIYNLFMASGDEVIIPAPYWVSYPDMVLLAEGTPVFANCGIESNFKLSG
AAT_SULAC       LSSKNTNISSKEVIITPGAKVSLYAFLLYVGDEVIIFDPSYYSYPEVVKMLGGKPVYVKMKWREGFSLNL
DAPAT_NATTJ     YQSRGVELNPDRILTLIGSKEGIANISQAIPGDINIPDPSYPVYKNGTILAGGTPHSMPLKQDNGFIPEL
AAT_RICTY       FKRENIDYELDEIIVSTGGKQVIYNLFMASGDEVIIPVPYWVSYPDMVALSTGTPIFVNCGIENNFKLTV
AAT_RICPR       FKRENIDYELDEIIVSTGGKQVIYNLFMASGDEVIIPVPYWVSYPDMVALSTGTPVFVNCGIENNFKLSV
AAT_PYRKO       -EFEGVSADE--VIVAPGAK-ILIAAEIASAKKVAVVSPRWNAYSLIARQFWREVEVIKTTLDERWIPR-
DAPT2_ANAVT     MERRFGVVDPNTVVSSIGSKEAIHNTFLAFGDYTLIPDPGYPVYRTSTIFAGGEPFTMPLKAENKFLPDL
DAPAT_MOOTA     YQRLGVDLDPRRVVTLIGSKEGIAHISLCYPGDINLVPPGYPVYNIGTLLAGGESYFMPLTAANGFLPDL
DAPT2_ANASP     MERRFMDLNPNTVVSSIGSKEAIHNTFLAFGDYTLIPDPGYPVYRTSTIFAGGEAFSMPLKAENKFLPDL
DAPAT_SYNFM     YKRRGVELDPSEVLTLIGSKEGLAHFPLAVPGDLALVTPAYPVYHVATMFAGGESYFMPLVRENGFLPDL
DAPAT_GLOVI     FERRGFHPDTE-VISSIGSKEAIHNTFLAFGDYTLIPDPAYPVYRTSTIFAGGEFFAMPLLPENQLLPDL
YFBQ_SHIFL      YQARGMRTVEDIYIGNGVSELIVQAMLLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDL
YFBQ_ECOLI      YQARGMRTVEDIYIGNGVSELIVQAMLLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDL
YFBQ_ECOL6      YQARGMRTVEDIYIGNGVSELIVQAMLLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDL
DAPAT_DESVV     YDRRGVSLDPATEVIGLGSKEGIAHFPFAFGDLVLVCTPNYPVYHIATGFAGGEVQFVPLLEENDFLPDL
DAPAT_DESVH     YDRRGVSLDPATEVIGLGSKEGIAHFPFAFGDLVLVCTPNYPVYHIATGFAGGEVQFVPLLEENDFLPDL
Y286_HAEIN      YQSKGIATVNDVYIGNGVSELITMAMLLNDGDEVLVPMPDYPLWTAAVTLSGGKAVHYLCDEDANWFPTI
DAPAT_AQUAE     YKRRDVDLDPNTVITLIGSKEGIFPLAFVNPGDIVLCPPAYPVYRIGAIFAGGTPYTVPLKEENNFLPDL
DAPAT_CARHZ     YARRGVELDPKTVVSLLGSKEGIAHISWCYGDLVLVPDPGYPVYEGGTILAGGTTYKMPLKPENGFLPDL
PATA_BACSU      MKKKAYDAESEIIITTGASQAIAFRTILSPGDEVXXXXXXXXXXXXXXNLCGAKPVIVDTT-SHGFKLTA
DAPAT_DESDG     YKRRAVELDPKTVLTLIGSKEGIAHFPTAFGDLVLVCPPCYPVYAIASRFMGGVVQELPLLEENDFLPDL
1A112_ARATH     MSRGNVSFDPSNMVITAGGTPAIEVLAFCLGNAFLIPTPYYPGFDRDIKFRTGVELIVHCRSSDNFTVTV
DAPAT_PROMA     FQSRGCQISADEIFVSDGSKCDSSNILLGTGNKIAVTDPVYPVYVDSNVMAGQTGIAASSGHYEGLVYIP
ATTY_TRYCR      WELKSTIVKDNVVLCSGGSHGILMAITICDAGDYALVPPGFPHYETVCKAYGIGMHFYNCRPENDWEADL
DAPAT_DESAD     YKER---FDVELVVSLIGSKEGIAHFPLAFGDLVLVASPNYPVYPVASGFAGGEVEIVPLLEENDFLPNL
HIS8_GRABC      F---GL--DPARIVCGVGSDEMIAHLCMAYSNELIMSVHGFSVYEMYGHYAGAK---VVKVPEQALTTDV
DAPAT_EUBE2     YKKRGCDISADEIFVSDGAKSDSGNIIFSVDNKIAVCDPVYPVYVDTNAMAGRTGDYIPEKQAWSNVVYM
PATR_STRCO      FDRFGVPLAH--LATGTGSVGVAQQLIQATSGEVIYAWRSFEAYPIITQISGARSVQVPLTP--GEVHDL
DAPAT_HALOH     YKNNGRELDPDKVVSLIGSKEGIAHLPFCYPGDIALVPPGYPVYKTSVLLAGGKPVQVPLVEENNFLPDL
DAPAT_SYNPW     FKARGCDISAEEIFVSDGSKCDSSNILLGEGNRVAVTDPVYPVYV-DSNVMAGRTGDAGDEGRYAGLTYL
AAT2_METJA      KDKYKADIIPDNIIITXXXXXXXXXXXXXIGDEVLIQNPCYPCYKNFIRFLGAKPVFC------------
DAPAT_SYNS9     FQSRGCEINADEIFVSDGSKCDSSNILLGEGNRVAVTDPVYPVYVDSNVMAGR----TGDAGAEGGLTYL
DAPAT_DESVM     YGRRGVSLDPKTEVIGLGSKEGIAHFPLAFGDLVLVCTPNYPVYHIATGFVGGEVQFIPLVEENDYLPDL
YFDZ_ECOLI      QDRYDVEIDPESAIVTIGSKEGLAHLMLATGDTVLVPNPSYPIHIYGAVIAGAQ---VRSVPLVEGVDFF
DAPAT_DEHSC     YQKRGVKLNPDTVLPLIGSKEGIAAWCFLDPGDIALVPPAYPVYAISSQLAGAEVFNLPLNKGNNFLPNL
DAPAT_DEHSB     YQKRGVKLNPDTVLPLIGSKEGIAAWCFLDPGDIALVPPAYPVYAISSQLAGAEVFNLPLNKGNNFLPNL
PATR_STRAW      -ERFGVPLSH--LATGTGSVGVAQQLLQATSGEVIYAWRSFEAYPIITQVSGATSVQVPLTP--GDVHDL
ATTY_MOUSE      YHCPEAPLEAKDVILTSGCSQLCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLLPEKSWEIDL
DAPAT_SYNR3     FQSRGCDISAEEIFVSDGSKCDSSNILLGEGNRIAVTDPVYPVYV-DSNVMAGRTGDANEGGQYGGLSYL
DAPAT_DEHE1     YEKRGVKLNPDTVLPLIGSKEGIAAWCFLDPGDVALVPPAYPVYAISSQLAGAEVFYMPLNKENNFLPDF
YBDL_ECOLI      TERLGYQPDADSITVTAGATEALYAAITALGDEVICFDPSYDSYAPAIALSGGIVKRMALQPPHFRVDWQ
KAT3_DANRE      YDRQLDPFKEILVVGGYGSLFSTMQALVEEGDEVIIIEPFFDCYVPMVKMAGAKPVLIPLSTATTGISSA
DAPAT_ARATH     FYG-GLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVPSYPAYVDSSVIMGQTGQFNTDVQKYGNIPEN
ATTY_RAT        YHCHEAPLEAKDVILTSGCSQLCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLLPEKSWEIDL
KAT1_HUMAN      GELLGQEIDPLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGQNGELGS
PATR_STRGG      -DRFGVPLGH--LATGTGSVGVAQQLLQATSGEVIYAWRSFEAYPIITQVSGATSVKVPLT--DGEVHDL
KAT1_MOUSE      FGKLGQEMDPVLVTVGAGALFTAFQALVDEGDEVIIIEPAFNCYEPMTMMAGGRPVFVPAPKGQLGSSND
DAPAT_PROM4     YQARNCEITPEEIFVSDGSKCDSSNILDILGDNIAVTDPVYPVYVDSNVMVGRTGLAEKSGRYQGLSYIP
ATTY_HUMAN      YHCPEAPLEAKDVILTSGCSQLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLLPEKSWEIDL
Y1391_METJA     MEKVYGVKDIDPVIHSIGSKPALAYITSAFPGDVCLTVPGYPVTATHTKWYGGEVYNLPLLEENDFLPDL
AATC_RHIME      XXXXGVKLNPETVVATLGSKEGFANMAQAITGDVVLCPPTYPIHAFGFLMAGGVIRSISVEPDESFFPP-
ALA2_HORVU      ASRDGFPANADDIFLTDGASPLMMQLLIRNEKDILVPIPQYPLYSASIALHGGALVPYYLNESTGWGLET
DAPAT_SYNS3     FQARGCEISAEEIFVSDGSKCDSSNILLGSGNRIAVTDPVYPVYV-DSNVMAGRTGESGDDGRYGGLTYL
BNA3_YEAST      --------------------------LLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINP-------P
KAT1_RAT        GKLLGQEMDPVLVTVGAGALFTRFQALVDEGDEVIIMEPAFDCYEPMTMMAGGCPVFVTLKPSPAGASND
HIS8_LACPL      -QQQGI--DPNSIVFSVGLDEMIVMLFLATNDQVLVSAPTFSEYGLHAEIEGGQLISVPTLP--NDHVNF
HIS8_ARTAT      L---GHGLSPDNIWAANGSNEVLQQILQAFGGPGRKALGFPPTYSMYPLLASG----TDTEYVRGVRADD
DAPAT_NOSP7     FQARGANIDASEIFISDGSKCDTGNILEIFGHDIAVTDPVYPVYVDTNVMVGNTGDANDKGEFEGLVYLP
HIS8_MAGSA      --RFGL--DASRIVCGAGSDELLGILCRAYAGEVLYSAHGFLMYAIAAKACGATPVTAPEVDLTANV---
ATTY_DICDI      VETTSKLTSKDIIVASSGAIELAIGVLLNEGDNILVPKPGFPLYECTSKTKFINVKHYNLLEKQGFNVDL
ATTY_BOVIN      YHCPEAPLEAKDVILTSGCSQLCLAVLANPGQNILVPRPGFSLYRTLAESMGIEVKLYNLLPEKNWEIDL
ALA2_PANMI      ASRDGFPANADDIFVTDGASPMMMQLLIRNEKDILCPIPQYPLYSASIALHGGTLVPYYLDEKTGWGLEI
DAPAT_DESOH     YQARGADIQPDEVFISDGAKCDTFQELFATDIRVAIPDPVYPVYLDTNVMAGRTGAF--ENGRYGNIVYM
Y104_SULSO      SRLRGISIDERNVFVTVGSQEALFMILLDPGDNVVVEAPTYL--AALNAMRTRKPNFISITVTEMG-PDL
PATR_LEIXX      -ERHGV--DVDQVHLGSGSVALLAQLIRAVAGAGDEVVYSWRSFEAYPGLAGATSVQVPNR-ADGGHDLP
HIS8_METAC      ---TGFPVS-NIVASGPGMDGLLDGLCRIIGDEVIVPTPTFAYYELPARACGGKPVFVRRNPDFS--LDP
1A1L2_HUMAN     YCRAPTRLDPENVVVLNGCCSVFCALAMVLGEAFLVPAPFYGGFASSSHLES-EVTVTNTHPFQLTV---
DAPAT_CYAP4     FQRRGCEIDASEIFVSDGSKCDTGNILDIFGDNIAVTDPVYPVYVDTNVMAGHTGAANEQGEYAGLVYLP
PATR_MYCSS      LDKNGAFT-PEQIAVGCGSVSLCQQLIQSVGDEVIFAWRSFEIYPLQVRTAGATPVQVPL---RDHTHDL
PATR_MYCSK      LDKNGAFT-PEQIAVGCGSVSLCQQLIQSVGDEVIFAWRSFEIYPLQVRTAGATPVQVPL---RDHTHDL
PATR_MYCSJ      LDKNGAFT-PEQIAVGCGSVSLCQQLIQSVGDEVIFAWRSFEIYPLQVRTAGATPVQVPL---RDHTHDL
HIS8_CHLPD      ----GVPADA--VMMSNGSNEMLYTIFLACGKKILIPEPSFSLYEKIARLLHTEVVFVPMLP--GLAFDA
DAPAT_THEEB     FQARGCDIDASEIFISDGSK-CDTGNILDIFGDIAVTDPVYPVYVDTNVMAGHTGEANERGEYAGLVYLP
AAT2_BACSU      YKREGVTINPETEVAFGGGKAGLYVLCLLNPGDIALVPPGYPEYLSGITMARAELYEMPLYEENGYLPDF
HIS8_MYCUA      ------------VWAANGSNEILQQLLQAFGGPGRTAIGFVPSYSMHPIISDGTHTWVETARADGFGLDI
DAPAT_DESDA     YKVRGVTLAPDEIFVSDGAKPDVFQELFAQDSIVAVTDPVYPVYVDSNVMAGSRIVYLPCIKENDFVPDF
HIS8_RHORT      -RTHGL--DPARIVCGAGSDELIGLLCRAYAGSIVQSAYGFLMYGIYARGVGAEPILAPESDLTADI---
HIS8_MYCMM      ------------VWAANGSNEILQQLLQAFGGPGRTAIGFVPSYSMHPIISDGTHTWVETARADGFGLDI
HIS8_CORDI      ITKTGVPVTYEQLWAANGSNEVLQQLLQAFGGPGRTVLGFQPSYSMHPILAQGQTTFINCPRDKEFRIDV
DAPAT_SYNP6     FQSRGCEVDASEIFISDGSKCDCGNILDIFGNNIAVTDPVYPVYVDTNVMAGHTGDANDRGEYDGLVYLP
DAPAT_SYNE7     FQSRGCEVDASEIFISDGSKCDCGNILDIFGNNIAVTDPVYPVYVDTNVMAGHTGDANDRGEYDGLVYLP
DAPAT_PROM3     FQNKGCQINAEEIFVSDGSKCDSSNILDILGSSIAVTDPVYPVYV-DSNVMAGRTGEANQSGRYAGLSYL
HIS8_METMA      ---TGFPVS-NIVASGPGMDGLLDGLCRIIGDEVIVPIPTFSYYELPARACGAEPVFIRRN--QDFSLNP
HIS8_LEUMM      NH-----VDPQHLVFGAGADELIELLVLEPGSNIIIPNPTFGEYAMHAQIEQSTTKKIPVNVDNGNV-DF
DAPAT_CHLFF     CYRGKV--SPEEIFISDGAKTDIFRLLFGPGKTIAVQDPSYPAYIDAAILAGARKIFFPVIPQEENI---
ALAT1_HUMAN     IERRGIPADPNNVFLSTGASDAIVTVLLLVAGEVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDV
ALAT1_BOVIN     IERRGIPADPNNIFLSTGASDAIVTVLLLVTGEVLIPIPQYPLYSAALAEFNAVQVDYYLDEERAWALDV
KAT3_MOUSE      YQRQIDPNEEILVAVGAGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPSKPTDGWTSSD
KAT3_BOVIN      YHNKINPNEEILVTVGAGSLFNAIQGLIDEGDEVIVIVPFFDCYESMVRMAGATPVFVPLRPVDGKCSSS
HIS8_METBF      ---TGFPVS-NLIASGPGMDGLLDGLCRLVGDEVIVPTPTFAYYELPARACGGKPVFV--RRSQDFSIDP
DAPAT_SYNPX     FQARGCDISAEEIFVSDGSKCDSSNILLGEGNRIAVTDPVYPVYV-DTNVMXXXXXXXXXXXXXXXLTYL
DAPAT_PARUW     YYQGKI--DPQEVFVSDGSKCDVGRLQILFGSDATIAVPTYPAYVDTGVINGQASFFQTSTKQYQRITYM
DAPAT_SYNY3     FQARGCEVNAEEIFISDGSKCDTGNILDIFGKDIAVTDPVYPVYV-DTNVMAGHTGDANEKGEYGGLVYL
DAPAT_GEOSF     YKPLGVSLKTEEIFISDGSKCDCANILFAMDNVVAIGDPVYPVYNDTNVMIGGEAVYMPCNEANGFIPE-
HIS8_RHOSR      LVRQGVPVTVDNVWAANGSNEILQQLLQAFGGPGRSAMGFVPSYSMHPIIADGETEWLPIFRRADFALDV
HIS8_PELLD      AEFLGVPAGR--VIMGNGSNELLYTIFMACGRRILIPEPSFSLYEKIALLMQAD---IVSVPMRRGL---
DAPAT_TRIEI     FQGRGCDIDASEIFISDGSKCDSGNILDIIGNNIAVTDPVYPVYVDTNVMAGNTGAVNEKGEYEGLVYLP
DAPAT_SYNJB     FQARNCDIDASEIFVSDGSKCDCGNILDILGHDIAITDPVYPVYVDTNVMAGHTGPANERGEYEGLVYLP
DAPAT_SYNJA     FQARGCDIDASEIFISDGSKCDCGNILDILGHDIAITDPVYPVYVDTNVMAGHTGPANERGEYEGLVYLP
DAPAT_DESAP     YARRGVELDPQRVVSLIGSKEGIAHLFXXXXXXXXXXXXXXXXXAGGTILAGGIPHPVPLTAGNGFLPDL
DAPAT_ACAM1     FQARGCDVDAGEIFISDGSKCDCGNILDIFGDNIAVTDPVYPVYVDTNVMAGHTGPCNDQGEYEGLTYLP
DAPAT_PROMM     FQTKGCQINAEEIFVSDGSKCDSSNILDILGSSIAVTDPVYPVYV-DSNVMAGRTGDANQSGRYAGLSYL
AAT_STRGR       TLRSGYEVDAGQILVTNGGKQAIYEAFAAIGDEVIVPAPYWTTYPESIRLAGGVPVEVVADETTGYRVSV
HIS8_UNCMA      -MRHGVPVRN--IVCGNGMDAVIETLLRAFGDEVVIPLPAFSYYENVTRFCGATPKYC--ARRADFSLDV
HIS8_SYMTH      WN---LPADWFLI--GNGSDELLAEVYLEPGDRVVVPEPSFAAYRFVAELMGAEVVAVPLA---GWTMDL
HIS8_RUBXD      ------------VLVGNGSSEVLQNLLMLVEGEVLFPWPTFTLYPSIAGTLGLRARRVPLTEEHR--VKP
DAPAT_SYNP2     FQARGCDIDASEIFVSDGAKCDTGNILDIFGKDIAVTDPVYPVYV-DTNVMAGHTGEADESGKYGGLTYI
ALAT2_MOUSE     ITRRGVPADPDNIYLTTGASDTILKLLVSGGGKVMIPIPQYPLYSAVSELDAVQVNYY--------LDEE
DAPAT_LEPBL     YGSLGIKIDESEIFVSDGSKCDCGNIIFSTDAKIAVSDPVYPVYVDTNVMAGSNLIYMPATKENGFQPE-
DAPAT_LEPBJ     YGSLGIKIDESEIFVSDGSKCDCGNIIFSTDAKIAVSDPVYPVYVDTNVMAGSNLIYMPATKENGFQPE-
ALAT2_HUMAN     ITRRGVPADPDNIYLTTGASDGISTILLVSGGGVMIPIPQYPLYSAVSELDAIQVNYY--------LDEE
PATR_MYCA9      -----VDMPPEHIAVGCGSVSLLVQITATVGDEVLFGWRSFETYPLVVRVAGATPVQVPLVDHTYDLA--
HIS8_CORGL      ITKQGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTFIAVSRGADFRIDM
DAPAT_EUBR3     YKARGCDISADEIFVSDGAKSDSANILFSANSRIAVTDPVYPVYVDSNVMAGSNVIYMPSTADNGFVPE-
DAPAT_CHLTB     FYRGCV--DAKEIFISDGAKADLFRLLSFFGPNVAIQDPSYPAYLDIARLTGAKEIILPCLQENAFFPEP
DAPAT_CHLT2     FYRGCV--DAKEIFISDGAKADLFRLLSFFGPNVAIQDPSYPAYLDIARLTGAKEIILPCLQENAFFPEP
1A12_CUCPE      MGKRGVKFDPSRIVMGGGATGASETVILADPGD-AFLVPSPYYAAFDRDLTRAQIIPVHCNSSNNFQVTE
HIS8_CORGB      ITKQGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTFIAVSRGADFRIDM
DAPAT_LEPIC     YGSLGIKIDESEIFVSDGSKCDCGNIIFSTDSKIAVADPVYPVYVDTNVMAGSNLIYMPATKENGFQPE-
DAPAT_CHLTR     FYRGFV--DAKEIFISDGAKVDLFRLLSFFGPNVAIQDPSYPAYLDIARLTGAKEIILPCLQENAFFPEP
DAPAT_CHLTA     FYRGFV--DAKEIFISDGAKVDLFRLLSFFGPNVAIQDPSYPAYLDIARLTGAKEIILPCLQENAFFPEP
ALAT1_MOUSE     IERRGIPADPNNIFLSTGASDAIVTMLLLVAGEVLIPIPQYPLYAALAELDAVQVDYY--------LDEE
HIS8_ACICJ      ---RRFCLDPARIVCGNGSDDLIALLIQSYGGELVMSRHGFLIYEIAARLAG---MNVRKAPERNLTADI
DAPAT_SYNSC     FQARGCDISAEEIFVSDGSKCDSSNILLGEGNKVAVTDPVYPVYV-DSNVMAGRTGEAGEIGRYAGLTYL
DAPAT_CHLAB     FYHGQV--SPEEIFISEGAKMDIFRILFGPGKTIAVQDPSYPVYIDTALLTGSRKIILPCTKETHFFPE-
1A1C_TOBAC      MEKRGVTFDPERVVMAGGATGANETIILADTGD-AFLVPSPYYPAFNRDLTGVQLIPIPCDSSNNFQITT
PATR_THEFY      LNRRRFHVPEEHVALGAGSVGLLQQLLEATGAEVVYAWRSFEAYPLLTGLAGATPIHVPLREETHDL---
ALAM_YEAST      ITKRDISYPEDIFLTAGASAAVNYLLSIFCRGPVLIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNP
HIS8_DESHY      ---TGVPAEG--ILTGNGSDELIQLLMTTFGGEVVIHPPTFSMYEAAARVTGTGVLEVPLLLTETGRDDV
DAPT1_ANAVT     FQARGADVDASEIFISDGSKCDTGNILDIFGDNIAVTDPVYPVYVDTNVMAGHTGVANDKGEFEGLVYLP
DAPAT_LEPIN     YGSLGIKIDESEIFVSDGSKCDCGNIIFSTDSKIAVADPVYPVYVDTNVMAGSNLIYMPATKENGFQPE-
1A11_CUCPE      MGKRGVKFDPSRIVMGGGATGASETVILADPGD-AFLVPSWRTRAQRVHCNGSNNFQVTKA---------
Y1527_METMP     LEKIFGVKDLDPVVHSIGSKPALYITSVFINGDVTLTVPGYPVTATHTKWYGGSVETLPLLEKNNFLPEL
DAPAT_CHLCV     FYQGKV--SPEEIFISDGAKMDIFRLLSLFGPGIAVQDPSYPVYIDTALLAGAKKVI--KLPCRKETDFF
ALAT1_RAT       IERRGIPADPNNIFLSTGASDAIVTMLLLVSGEVLIPIPQYPLYAALAELDAVQVDYY--------LDEE
KAT3_HUMAN      --------------------------LIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPSKPVYGKRWSS
1A12_ARATH      MGKRGVTFDPERVVMSGGATGANETIMLADPGDVLIPSPYYAAFDRDLRWRTGVEIIVPCSSSDNFKLTV
MTNE_BACSU      YKREGIDLDPETEVAGKAGLVELPQCLLNPGDTILVPDPGYPDYWSGVTLAKAKMEMMPLVKDRAFLPDY
HIS8_MYCPA      LTAQGVQLGVENLWAANGSNEILQQLLQAFGGPGRSAIGFVPSYSMHPIISDGRTEWLQAARADDFSLDV
HIS8_MYCA1      LTAQGVQLGVENLWAANGSNEILQQLLQAFGGPGRSAIGFVPSYSMHPIISDGRTEWLQAARADDFSLDV
HIS8_CHLL2      ----------DSVIMSNGSNEMLYTIFLACGKKILIPEPSFSLYEKIALLLQADIVSVPMQPSL------
DAPT1_ANASP     FQARGADVDAAEIFISDGSKCDTGNILDIFGDNIAVTDPVYPVYVDTNVMAGHTGAANEKGEFEGLVYLP
ALAT_SCHPO      IRARDEPSDIYLTSGASHAARLIMTLIIARPTDVMVPAPQYPLYGAQIDLMSGSMVSYSLSEENNWDIDF
ALAT2_XENTR     IERRGIQSDPNNIYLSTGASDSIVTMLLLVSGQVLIPIPQYPLYAALAELNAVQVNYYLDEENCWAL-DI
ALAM_DICDI      IERRGHKSDPSEIFASVGVQRILKLLIKDRSDGILIPIPQYPLYSATIELYNGSQLGYLLNEEKGWSLEI
Y1479_METJA     VNKRGITAEDIIFFNGLGDAIAKIYGLLKRQVRVINPSPSYSTHSAEASHAGSPPVTYFLDPYNYWYPDI
PATR_CORGB      LE-----VEFDQVTVGCGSSALCQQLVQATGDEVIFPWRSFEAYPIFAQVAGATPVAIPLTADQNH--DL
DAPAT_GEOMG     YKPLGVSLKTEEMFISDGSKCDCANILFALDNVVAIGDPVYPVYNDTNVMIGRTGVYMPCTEANGFIPSL
1A17_ARATH      MEQRGGKADPDRIVAGATAANELLTFILADPNDLLVPTPYYPGFDRDLRWRTGVKIVPIHCDSSNHFQTP
HIS8_RHOBA      --ALGLP-GPEWVLAGNGSDEILTLLVRGFVGELRLPYPSYILYRTLADIQGANWEQVP-------FNDP
DAPAT_PELPD     YNKLGVELKTSEIFVSDGSKCDCANILFAMDNVVAIGDPVYPVYNDTNVMIGGEAVYMPCTEANGFIPTL
DAPAT_GEOUR     YKPLGVSLKTDEMFISDGSKCDCANILFALDNVVAIGDPVYPVYNDTNVMIGRTGEADDKGYYKGIVYMP
ALAT2_DANRE     IERRGIPSDPDNIYLTTGASDGIVTILLLTAGEVMISIPQYPLYSASIAELGAVQINYYLNEEKCWSLDI
1A11_CUCMA      MGKRGVQFDPSRIVMGGGATGASETVILADPGD-AFLVPSPYYAAFDRDLTRAQIIRVHCNSSNNFQVTK
HIS8_CHLTE      -----LGVKPELVIMSNGSNEMLYTIFMACGRKVLIPEPSFSLYDKLARLQQAGVVEVPMHDDLSF--DV
HIS8_AZOC5      ---KAMGIDPDRIICGAGSDEILNLIAHAVGGDEAICAHGFLVYKIATLGAGGVPVVVPDR--EDLQMDV
DAPAT_PROM5     FISRGCQITPEEIFVSDGSKCDSSNILDILGHDIAVTDPVYPVYVDSNVMTGRTGETLKNGTYQGAINED
DAPAT_GEOLS     YKPLGVDLKTEEMFISDGSKCDCANILFALDNVVAIGDPVYPVYNDTNVMIGGEAVYLPCNEANNFIPSL
DAPAT_CLOPH     YEARGVQIALDEIFISDGAKSDSGNIIFAENNKIAVCDPVYPVYVDTNVMAGRTGEFNYTTGKWSNVIYM
1A16_ARATH      MEKNKVKFDPDRIVMSGGATGATVAFCLANPGDFLVPTPYYPGFDRDLRWRTGVNLVPVTCHSSNGFKTV
HIS8_SILPO      ---HGL--DPDRIICGVGSDEVLQFVAQAYGDEVIHTEHGFSMYPILARMAGATPVQVPERQR---VVDV
DAPAT_GEOSL     YKPLGVDLKTEEMFISDGSKCDCANILFALDNVVAIGDPVYPVYNDTNVMIGGEAVYMPCTEENGFIPSL
DAPAT_CYAA5     FQARGCDIDASEIFVSDGAKCDTGNILDIFGKNIAVTDPVYPVYVDTNVMAGHTGETNEKGEYEGLVYLP
DAPAT_CLOTH     YMPRGIRLDEDEVFVSDGAKSDTFQEIFGLDNKVAVTDPVYPVYVDSNVMAGRTGKYLANGYFENITYLP
1A1C_PHAAU      MARRGITFDPDRIVMSGGATGAVTAFCLADPGEALVPIPYYPGFDRDLRWRTGVKLVVMCDSSNNFVLTK
1A12_SOLLC      MEKRGVRFDPERVVMAGGATGANETIILADPGD-AFLVPSPYYPAFNRDLTGVQLIPIHCESSNNFKITS
PATR_CORGL      LE-----VEFDQVTVGCGSSALCQQLVQATGDEVIFPWRSFEAYPIFAQVAGATPVAIPLTADQNH--DL
HIS8_METNO      Y---GL--DPERIVCGAGSDELLSLLTYAYGDEGVYSQYGFLVYRIAILAAGGTPV---VAPERDHTADV
DAPAT_DESAH     FKARGADIDSDEIFVSDGAKCDTGNFQELFSTDIRIAIPDPVYYLDTNVMAGRTGEFKDGR--YGGVSYM
DAPAT_CHLPN     YENR---ISPEEIFISDGAKPDIFRLFSFFGSELGLQDPVYPAYRDIAHITGIRDI-IPLACRKGFIPE-
ALAT2_XENLA     IERRGILSDPNNIYLSTGASDSIVTMLLLVSGQVMIPIPQYPLYAALAELDAVQVNYYLDEENCWAL-DI
PATR_MYCVP      -----VNFAPEYISVGCGSVSLCQQLIQTVGDEVLFGWRSFEIYPLQVRTAGATPVQVPLTDHTFDL---
PATR_CORDI      -EHLGVPAEQ--IAVGCGSSALLVQITCTPGDEVVFPWRSFEAYPIFVQVVGATPVAVPLT--SDGFNDL
KAT3_RAT        YQKQIDPNEEILVTVG-GYGSLFNAILVDPGDEVIIMVPFYDCYEPMVKMAGAVPVFIPLRSKRTDTSSD
HIS8_PROVI      ADFLGVPAEG--VMMGNGSNELLYTIFLACGRKILVPDPSFSLYEKLALLLQASLVRVPLKASLDF--DV
HIS8_PELPB      -----LGISPDSVMMSNGSNEMLYTIFLACGRKVLIPDPSFSLYEKIALLLQSQIVTVPM------LPDL
HIS8_MOOTA      -----LGVKQENLIIGNGTDEILKMLAINPGDEIVVADPTFSEYEFAAQVMGGRAIKVPTRNFRHDLA--
HIS8_LACF3      ---------------------------------VVVAKPAFSEYALHATVEGAAVKEVPVNPATGHFDFA
AAT3_BACSU      LGSREADFSAERIVMTVGAGGALNVALKSIGEEVIILAPYFAEYKLYIENYGGKAVSCPTSRFEIDI---
1A1C_DIACA      MGKEKVIFNPDRIVMSGGSETLLFCL--ANPGDALIPSPYYPAFNRDLRWRTGVNLIPFTCSSSNNFKTK
1A14_SOLLC      ----------------------------------------------------------------------
1A11_PRUMU      MSKRGVTFDPNRVVGATGANELVMFCLADPGDAFLVPSPYYPAFFRDGWRTGVQIVPVDCDSSNNFKITK
KAT_DICDI       ------------IMVGVGASESLFAAISSIGDEVILIEPFFDIYIGPILMAGGIPKFVTLKESQAGSSDK
HIS8_METS4      Y---GL--DPARIVCGAGSDELLSLLTYAFGDEGIYSEYGFLVYRIAILAAGGTPV---VAPERDHTADV
HIS8_CHLP8      ASFLGVPAES--VIMSNGSNEMLYTIFMACGRKVLIPEPSFSLYDKLAVLLQGEIVSVPLNPDLSF--DV
DAPAT_MICAN     FQARGCEISADEIFISDGSKCDTGNILDIFGDNIAVTDPVYPVYVDTNVMAGHTGEANDRGEYEGLIYLP
DAPAT_HELMI     YKPRGIDLGMDEVFVSDGSKTANFQEILGIGNIVAVTDPVYPVYVDSNVMAGRSGAFNEKGQFDDIVYLP
CBL_BACSU       MQNRGWKVNPESITFSPG---VVTALSMAVGDQVVVQPPVYTPFYHMVEKNGRHILHNPLLEKDGAY---
1A1C_SOYBN      MGRRGVTFDPDRIVMSGGATGAVTTFCLADPGDALVPIPYYPGFDRDLRWRTGIKLVPVMCDSSNNFKTK
1A110_ARATH     MTKNSVTFDPSQLVLTSGASSAIEILSFCLGNAFLVPTPCSPGYDRDKWRTGVDIIHVPCRSADNFNMSM
HIS8_COREF      THQTGVQVTRENLWAANGSNEVLQQLLQAFGGPGRKALGFQPSYSMHPILSKGQTEFIAIPRGADFRIDM
DAPAT_PROMP     FISRGCQISSEEIFVSDGSKCDSSNILDILGSDIAVTDPVYPVYVDTNVMTGRTGETLQNGTYQGAINEE
DAPAT_BACV8     YAPRGVYLEPGEVFISDGAKSDTGNIILRHDNSIGVTDPIYPVYIDSNVMCGSNVVYLPCLSENNFVPEP
PATR_PROAC      FG-----VDVSQVAVGAGSTEVASQLMHALAGEIIFPWRSFEAYPILTKVAGATPIPVPTVDLRHDL---
HIS8_LEUCK      EQ-----VNPDSLVFGAGADELIELLILTPNDNVIVPNPTFGEYAMHAQIEQATTKSIPVNQDTGHV-DF
DAPAT_PROMS     FISRGCQISPEEIFVSDGSKCDSSNILDILGKDIAVTDPVYPVYVDSNVMTGRTGDALENGTYQGAINEA
HIS8_RHOPT      ---KAYGLDPDRIICGAGSDEILNLLALAPGDEAISSQHGFLVYPIATLANGAKNV---VAPEKNLTTDV
HIS8_RHOPA      ---KAYGLDPDRIICGAGSDEILNLLALAPGDEAISSQHGFLVYPIATLANGAKNV---VAPEKNLTTDV
HIS8_MYCS2      --------------AANGSNEILQQLLQAFGGPGRTAIGFVPSYSMHPIISDGQTEWLQASRAEDFGLDI
DAPAT_GEOBB     -EKSYKPLGVDLMFISDGSKCDCANILFALDNTVAIGDPVYPVYNDTNVMIGRTGDADDKGYYKGLVYMP
HIS8_THEPX      ---------PTNIFVGNGSDEIIHLIMLAFGDVVAYPHPSFAMYSVYSKIAGA--VEIPVRLREDYNYDV
HIS8_DINSH      --------DPERIICGAGSDEIIAFLCQAYGDEVIHTEHGFAMYRISTLAAGGTPVEVPERER---VTDV
DAPAT_METTH     YASRGVDITADEIFISDGAKCDTGNIQEIFGLDVAVTDPVYPVYVESNVMAGRAGPADDDGRYSGLVTEE
DAPAT_CYAP7     FQARGCDIDASEIFISDGSKCDTGNILDIFGKNIAVTDPVYPVYVDTNVMAGHTGDANDKGEYLGLVYLP
PATR_MYCS2      -----VNFAPENISVGCGSVSLCQQLIQSVGDEVLFAWRSFEIYPLQVRTAGATPVAVAL---RDHTHDL
PATR_MYCBT      VNRRHLGPDPEHVAVGCGSVSLCQQLVASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLTDHTFDLY--
PATR_MYCBP      VNRRHLGPDPEHVAVGCGSVSLCQQLVASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLTDHTFDLY--
PATR_MYCBO      VNRRHLGPDPEHVAVGCGSVSLCQQLVASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLTDHTFDLY--
HIS8_HALMA      WDVT--PEQVWLSNGGDGALDCLARAMLDPGQDVLVPSPGFAYYAMSARYHHGEVNEYTLSKA-------
1A1L1_BOVIN     YCRSPAPLKPENVVVLNGCASLFSALLCEAGEAFLIPAPYYGAITQHVYLYGNVRLVLETRPFQLTV---
HIS8_HALLT      WD---VSTEQVWVSPGAGSIDYLSRAALEPGDEVLVPEPGFAYYAMSARYHHGEVSEYALSP-------D
DAPAT_PROM9     FISRGCQILPEEIFVSDGSKCDSSNILDILGKDIAVTDPVYPVYVDSNVMTGRTGDALENGTYQGAINEG
DAPAT_CYAP8     FQARNCDVDASEIFVSDGAKCDTGNILDIFGKNIAVTDPVYPVYVDTNVMAGHTGEVNDKGEYEGLVYLP
1A18_ARATH      MENRGVSFNPNKLVLTAGATPANETLMFCLGDAFLLPTPYYPGFDRDKWRTGAEIVPIQCKSANGFRITK
HIS8_THEP3      ---------PTNIFVGNGSDEIIHLIMLAFGDVVAYPHPSFAMYSVYSKIAGA--VEIPVRLREDYNYDV
DAPAT_DESPS     FQSRGAGIVADEIFVSDGAKCDTSNIIFSAETKIAIPDPVYPVYLDTNVMAGRTGLFADGRYQNDSTKEN
HIS8_RHOP2      ---RAYGLDPDRIICGAGSDEILNLLAHTYPGDEAISSQHGFLVYPIATLANGATNVV--APEKDLTTDV
HIS8_MYCLE      TAQTGIRLGVENIWAANGSNEILQQLLQAFGGPGRSAIGFVPSYSMHPIIADGTHTWLETVRADDFSLDV
HIS8_MYCLB      TAQTGIRLGVENIWAANGSNEILQQLLQAFGGPGRSAIGFVPSYSMHPIIADGTHTWLETVRADDFSLDV
HIS8_BEII9      --RHGL--DPARIVCGAGSDELLSAVYLGPGEEGIFTEHGFLVYKIAILTAGGTPIVVPEKDLTTDV---
HIS8_BACHD      -----VGVAPEELIFGNGSDEVIQILCRAFLNETVMAEPTFSQYKLNAVIEGAE---LREVPLKDGVHDL
DAPAT_PROMT     YISRGCEISAEEIFVSDGSKCDSSNILDILGKEIAVTDPVYPVYVDTNVMTGGEANSVGEYKGLSYIP--
DAPAT_PROM1     YISRGCEISAEEIFVSDGSKCDSSNILDILGKEIAVTDPVYPVYVDTNVMTGGEANSVGEYTGLSYIP--
YDT4_SCHPO      YSKRTLNPDTEIVVTAGANEGFVFAAFLNPGDEVIVMEPFFDQYISNITMNXXXXXXXXVKPVSAGAWKL
PATR_MYCTU      VNRRHLGPDPEHVAVGCGSVSLCQQLVASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLTDHTFDLY--
PATR_MYCTA      VNRRHLGPDPEHVAVGCGSVSLCQQLVASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLTDHTFDLY--
PATR_MYCPA      VNRYGSDVAPEQIAVGSGSVTLLVQITSAAGDEVMMGWRSFECYLPIVQVAGAIAVKVPL---REHTYDL
PATR_MYCA1      VNRYGSDVAPEQIAVGSGSVTLLVQITSAAGDEVMMGWRSFECYLPIVQVAGAIAVKVPL---REHTYDL
HIS8_NITWN      ---RAYGLDPDRIICGAGSDEILNLLFLSHGDEAISTTHAFLVYPIATMANGATNI---VAPETGYTADI
DAPAT_PARD8     YASRGVFIEPSEVFISDGAKSDCGNIMLRHDNSIGVTDPVYPVYIDSNVMSGSDVVYIPCTAENNFVPD-
HIS8_SPHAL      Y---GL--DPDRVICGNGSDELLHGTYAGPGDEILYVRYGFAVYEIAARRVGAVPV---EADDRDFATDV
HIS8_MARMM      -------------------------------------------------------------------PER
HIS8_BREBN      -----LGVKPSQLFFGNGSDEILLMIFLSEGTNAVMATQTFSQYRSNGIIEGADLIEVPL---KDGVHDL
HIS8_ANOFW      -----IGISEKQLIFGNGSDEVVQIICRAFGTNTVMATPTFPQYRHNAIIEGAE---VREIPLQDGHHHL
DAPAT_GEOSM     -EKSYKPLGVDLMFISDGSKCDCANILFALDNTVAIGDPVYPVYNDTNVMIGRTGDADDKGYYKGLVYMP
1A12_CUCMA      ----------------------------------------------------------------------
PATR_RHOSR      ------------IAAGCGSVSLCQELVQATGDEVIFAWRSFEAYPVVTQVAGATPVKVPLTADHGH--DL
HIS8_RHOOB      LVRQGVPVTVDNVWAANGSNEILQQLLQAFGGPGRSAMGFVPSYSMHPIIADGETEWLPIFRRXXXXXXX
HIS8_PARDP      LHRRGAGLDPDRIICGVGSDEIIHFLCQAYAGEVLFTEHGFLMYRISAHAAGAIPVQVAE---RDRVTDI
DAPAT_CHLMU     LYHGCVNAEE--IFISDGAKVDLFRLLSFFGPNVAVQDPSYPAYIDIARLTGAKEI----------VSLP
ALAT_YEAST      ITRRGEPATPEDIYXXXXXXXXXXXXXXXXCKDLLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNS
HIS82_NITMU     -ERYGVTSDQ--IVLGNGSNDVLELVFLKPGASTVYSQHAFAVYPLVTKAVGGIGISVP---ARNYGHDL
HIS81_ARCFU     W-------DADRVVVGAGIDGILFRILIDEGDEVVIPIPTFPYYHILTKLSCGKEVLVRRGE---NYRID
1A111_ARATH     ----------------------------------------------------------------------
YJIR_ECOLI      MLDSGSVVTADDIIITSGCHNSMSLALMAVGDIVAVESPCYYGSMQMLRGMGVKVIEIPTDPETGISVE-
HIS8_ZYMMO      YN-----LDPARIIHGTGSDEILHLAAGAYAGEVLYPRYSFSVYPLAARRVGATPVEAPDDDYRCSV---
HIS8_HALSA      WD----VGDDQVWVAGDGALDYLARATLDPGDSVLVPSPGFTYYGMSARFHHGNVAEYDVAEGADGF---
HIS8_HALS3      WD----VGDDQVWVAGDGALDYLARATLDPGDSVLVPSPGFTYYGMSARFHHGNVAEYDVAEGADGF---
HIS8_AERHH      AAYAGVNPDQVLVSRGADEAELLIRTFCEAGEDILICPPTYGMYAISAETCGVGIVEQPLTTSRQ--PDW
DAPAT_BACFR     YAPRGIHLSPTEVFVNDGAKSDTGNIILRHDNSVGVTDPIYPVYIDSNVMCGRAGVLDTESGKWSNVTYM
DAPAT_BACFN     YAPRGIHLSPTEVFVNDGAKSDTGNIILRHDNSVGVTDPIYPVYIDSNVMCGRAGVLDTESGKWSNVTYM
COBD_THETN      -----VGCDRENIIVGNGAAELIHLFARAFKKKPLIPSPSFLEYERAVKLNGGEPVYLKLEEEEGFRVNF
1A1C_MALDO      ----------------------------------------------------------------------
HIS8_SILST      -ETHGL--DAERIICGAGSDEIIAFLCQCYAGEVLYTEHGFAMYRISALAAGATPVEVKERER---VTDV
HIS8_ROSDO      --------DAGRIICGVGSDELLTLLAMAFAGEVLYTEHGFSMYRIFALSAGATPV---VAPEKDRTVDI
HIS8_NOVAD      -EVHGI--DPSRIVMGTGSDELLNLAAQAYAGEVLYVRYGFSVYDIAARRCGAVPVVAPDADYGTDV---
HIS82_NITEU     -ERLGMPADQ--IVLGNGSNDVLELATRIFLHPDSTAIYSQYAFAIYPLLAQAVGARGIAVPARNYGHDL
DAPAT_PROM0     FISRGCQISSEEIFVSDGSKCDSSNILDILGKDIAVTDPVYPVYVDSNVMTGRTGDSLENGTYKGAINED
CBL_MYCTU       WQWHDLEVSRTAIVPDVMLGIVEVLRLITDRGDVIVNSPVYAPFYAFVSHDGRR---VIPAPLRGGRIDL
CBL_MYCBO       WQWHDLEVSRTAIVPDVMLGIVEVLRLITDRGDVIVNSPVYAPFYAFVSHDGRR---VIPAPLRGGRIDL
HIS8_STRMK      ---------PQQLLIGRGSDEAIDLLVRALGRDVLVTPPVFGMYAVCARLQGAALIEVPLVDSEDGLRAD
HIS8_ROSCS      ---------PERIICGAGSDELIDLIMRAVPGDVMVCPPTFAMYSFDAALYGARIVAVPRT-------EQ
HIS8_NITHX      ---RAYGLDPDRIICGAGSDEILNLLALSHGDEAVSTTHSFLVYPIATTANGAENVVAPEVDYTADV---
HIS8_HALWD      W---GL--SPEQIWLSPGADGAIDYLFLTPGDTMLISDPGFSYYPMSARYHHGSIRTYPVSKEQD-----
HIS81_RALEJ     STKLGVPQD--WLTLGNGSNDILELAAHALGQSIVYAEYSFAVYALATQEIGARAIVVK---ARDYGHDL
DAPAT_LAWIP     YTSRNVHIEADEIFVSDGTKCDIANILFDPSDTVAIIDPVYPVYIDSNVMSGSKLIYLPCTIENNFIPEP
DAPAT_DESHD     YAPRGVQLGMDEVFVSDGAKSANFQEIFGVDNIMAVTDPVYPVYVDSNVMAGRTGNYDTEKGQYGRIIYL
HIS8_METTH      ---AGVGMD-QVIVGGDGADEIIDVLFLEPGESFVVPMPSYMEYTLQAHDARA-------VHARWDVNEN
HIS8_CALS8      ---------PTQIIFGAGSDELIASIFINPGDNSIMARPSFPRYETVTKVMGGIPIEI---PLKNYTHDL
HIS8_BACCN      -----LKVQPEQLLFGSGLDEVIQMILLHKGTNVVMARPTFSQYRHHAIIEGAE---VREVPLKDGIHDL
HIS8_AERS4      AAYAGVNPDQVLVSRGADEAELLIRTFCEAGEDILICPPTYGMYAISAETCGEQPL---TACRQ---PDW
DAPAT_PELCD     YKPLGVELKTSEIFISDGSKCDCANILFALDNKVAICDPVYPVYNDTNVMVGRTGEADDKGYYEGACTEE
DAPAT_LEPBP     YTARGVQIAEDEVFVSDGSKCDCGNIQEIFSLDSKIAXXXXXXXXXXTNVMAGRTGEVGPDGRYANIVYM
DAPAT_LEPBA     YTARGVQIAEDEVFVSDGSKCDCGNIQEIFSLDSKIAXXXXXXXXXXTNVMAGRTGEVGPDGRYANIVYM
DAPAT_DESHY     YAPRGVQLGMDEVFVSDGAKSANFQEIFGVDNIMAVTDPVYPVYVDSNVMAGRTGNYDIEKGQYGRIIYL
1A14_ARATH      ----------------------------------------------------------------------
YDFD_BACSU      LKTXXXXXXXXXXXXXXXALQALQLILLQRGSTVYLDQPSYL-YSLHVFQSAGMKLTGLPMDNEGLLPEN
HIS8_PROA2      ---------PESVMMSNGSNEMLYTIFLACGRKVVIPEPSFSLYEKLAVLLQADIVDVPMHDDL--TFDV
HIS8_MYCTU      ----GIQLGVENIWAANGSNEILQQLLQAFGGPGRSAIGFVPSYSMHPIISDG----THTEWIEASRAND
HIS8_MYCTA      ----GIQLGVENIWAANGSNEILQQLLQAFGGPGRSAIGFVPSYSMHPIISDG----THTEWIEASRAND
HIS8_MYCBT      ----GIQLGVENIWAANGSNEILQQLLQAFGGPGRSAIGFVPSYSMHPIISDG----THTEWIEASRAND
HIS8_MYCBP      ----GIQLGVENIWAANGSNEILQQLLQAFGGPGRSAIGFVPSYSMHPIISDG----THTEWIEASRAND
HIS8_MYCBO      ----GIQLGVENIWAANGSNEILQQLLQAFGGPGRSAIGFVPSYSMHPIISDG----THTEWIEASRAND
HIS8_ANADF      --KLGVP--PEEVMVGNGSNELIELLVRTFGEEVLTSAQSFVAYKLAAHEHGRT---LVEAPMKGRFHDL
1A11_ORYSJ      MEQRGYKVDPSNIVLTAGATSANEALMFCLGDAFLIPTPYYPGFDRDKWRTGAEIVPVHCASANGFRVTR
1A11_ORYSI      MEQRGYKVDPSNIVLTAGATSANEALMFCLGDAFLIPTPYYPGFDRDKWRTGAEIVPVHCASANGFRVTR
HIS8_STRAW      LTNTGKPVGIENVWAANGSNEVIQQLLQTFGGPGRTAIGFEPSYSMHALIARGTGTAWISGPGEDFTIDL
HIS8_RHISN      YD-----LSADQVIAGNGSSELLYKAFLGPGDSVAMLSPGFAYNRKLAQLQGARLLEIKWGESSL-LPIH
HIS8_NOCFA      ----GIAVDTANVWAANGSNEILQQLLQAFGGPGRRALGFVPSYSMHPIISEG----IDTEWVEARRNAD
HIS8_BRUSU      -ETQGLNISN--ILCGNGSDELLGLLCLAPGDETIITEHGFAVYKIQTLAAGATPVTVKEKNERIDV---
HIS8_BRUO2      -ETQGLNISN--ILCGNGSDELLGLLCLAPGDETIITEHGFAVYKIQTLAAGATPVTVKEKNERIDV---
HIS8_BRUAB      -ETQGLNISN--ILCGNGSDELLGLLCLAPGDETIITEHGFAVYKIQTLAAGATPVTVKEKNERIDV---
HIS8_BRUA2      -ETQGLNISN--ILCGNGSDELLGLLCLAPGDETIITEHGFAVYKIQTLAAGATPVTVKEKNERIDV---
HIS8_AKKM8      -------------VVGTGSSEVIELILLNPRAEVVAAKHAFSMYPIMSKLFGAAYVEVPNK--EDWTHDL
PATR_MYCUA      INRSAADFGPEHIAVGCGSVSLLVQITASVGDEVIFGWRSFELYPPQVQVAGATAIQVPLT---NHTFDL
PATR_MYCMM      INRSAADFGPEHIAVGCGSVSLLVQITASVGDEVIFGWRSFELYPPQVQVAGATAIQVPLT---NHTFDL
PATR_CORJK      -----LGVDLDNVAVGNGSSALCQQLVQATCKDGDEVVYAWRSFEAY-------PILCKIAGAVGGVPLK
HIS8_TOBAC      AEDSGL--ESEYILAGCGADELIDLIMRCVGDMIVDCPPTFTMYEFDAAVNGAHVIKVPRNPDFS--LDV
HIS8_RHOS5      -EVHGL--DPARVICGVGSDEIITFLCQAYAGDVIFTEHGFLMYRISALAVGANPVEVPERERTTDV---
HIS8_GEOKA      -----LGVKETQLLFGNGSDEVVQILCRAFGANTVMAAPTFPQYRHNAIIERAE---VREVPLVDGRHDL
HIS8_GEOBB      YG-----FDPSWIIMANGSDEVLNNLIRACAGEIAFINPSYSYYGTLAEVQGARVRTFGLSESF----EP
HIS81_RHIME     --------NPANILCGNGSDELLGLLCLGPGDEGIVTEHGFLVYKIQITASGGTPVTVKERQERVDV---
DAPAT_BACTN     FAPRGIHFSPSEIFVNDGAKSDTGNIILRHDNSVGVTDPIYPVYIDSNVMCGRAGVLEEGTGKWSNVTYM
DAPAT_AZOPC     FTDKGISIEADEIFVNDGAKSDTGNIGDILGQDIAITDPAYPVYVDTNRMAGRTIELLPCTPENYFVPN-
HIS8_YERE8      ----GLATDQVLVSRGAGIELLIRAFCEPAQDAILFCPPTYGMYAVSAETFGVELRTVPTADWQLDLPA-
HIS8_STRCO      LDTSGHPLDVSNVWAANGSNEVIQQLLQTFGGPGRTAIGFEPSYSMHGLIARGTGTGWISGPRHEDFTDV
HIS8_NICPL      AEDSGL--ESEYILAGCGADELIDLIMRCVGDMIVDCPPTFTMYEFDAAVNGAHVIKVPRNPDFS--LDV
HIS8_GEOSM      G------FDPSWIIMANGSDEVLNNLIRACAGEIAFINPSYSYYGTLAEVQGARVRTFGLTESF----EP
HIS8_ACIAC      I---GMPEGFSMVL-GNGSDEIITLLALACGERAAMLAPGFVMYPMSAQLQGLDFVAVPLT-ADFELDEP
HIS81_PASMU     ANYVGVTPENVLVSGGDESIELIIRAFCEAEDSILYCPPTYGMYAVSAETCGIALKTVPTADFQLNLPE-
CBL_MYCLE       WQWHDLDVSRTAIVPDVMLGVVEMLRLITDRGDGVIVSPPVYPYAFVTH-DGRRVLEAPLG--RDGRLDL
1A1L1_TAKRU     ----------------------------------------------------------------------
1A1L1_HUMAN     ----------------------------------------------------------------------
YISV_BACSU      LKGKKIHVSPSAILIVSGALQALQLISIGLLKRDSVILTEKPSYLQSLHV------FQSAGMRLRGLPMD
HIS8_VIBCM      ----------------------------------------------------------------------
HIS8_VIBCH      ----------------------------------------------------------------------
HIS8_VIBC3      ----------------------------------------------------------------------
HIS8_THEGJ      YG-----VSPDNVAVGNGSDELLYLVRLFEGNHIVITPPTFGMYSFYAKLNGVPVVEVPLR--EDFTLDG
HIS8_RHOP5      ---KTFGLDPDRIICGAGSDEILNLLAYLAPGDEAIATTYGFLVYPIATMANGAKLVI--AEEKNLTCDV
HIS8_NATPD      ----------------------------------------------------------------------
HIS8_METFL      ---RKFKLQPDQLVFGNGSNDILELAARAFGTEAVYAQHAFAVYALVTQATGASGISVP---ARDFGHDL
HIS8_RHOPB      ---RAYGLDPDRIICGAGSDEILNLLAHTYPGDEAIATTYGFLVYPIATMANGAKLVI--AEEKNLTCDV
HIS8_PHOPR      ----------------------------------------------------------------------
HIS8_METVS      ----GVPCE-NIIIGGDGADEVIMRILIDEGDEVIIPIPTFTQYAISAKIHGAKIKWAKFDKEKDFKLDV
HIS8_DEHE1      -----TGVNMEQIICGAGSDQLIDLLLRLFGDEVINCPPTFAMYKFYTDLNRGTVVNVPRDAGYGGIKN-
HIS8_BDEBA      ----------------------------------------------------------------------
HIS83_BURS3     LTHTGVTVDASSVWAANGSNEVIQQILQAFGGPGRSALAFTPAYPMYDEYCRTTFTRLHTLPRTEDFALD
HIS81_HAEI8     ---AGVSTENVLVTRGEGIELIIHTFCEPKQDAILFCPPTYGMYAVSAETAG---------VLSKSVPLT
1A1L2_MOUSE     YCKAPTPLDPENVVVLNGCSSVFASLAMVLGDALLIPTPCYNGFVFSSHLYSKIELIVPRSNLDSFQLTV
HIS8_RHOSK      -EVHGL--DPARVICGVGSDEIITFLCQAYAGDVVFTEHGFLMYRISALAVGANPVEVPERERTTDV---
HIS8_RHOS4      -EVHGL--DPARVICGVGSDEIITFLCQAYAGDVVFTEHGFLMYRISALAVGANPVEVPERERTTDV---
HIS8_RHOS1      -EVHGL--DPARVICGVGSDEIITFLCQAYAGDVVFTEHGFLMYRISALAVGANPVEVPERERTTDV---
HIS8_PECCP      ----------------------------------------------------------------------
HIS8_ARATH      -QDSGL--ESEYILVGCGADELIDLIMRCVGEKIIDCPPTFSMYVFDAAVNGAGVIKVPRNPDFS--LNV
HIS82_RHILO     -EVHGLTAQN--IICSNGSDEILGLLALAPGDEAIFTEHAFMVYKIYIQSAGAAPIAVKETDERADI---
1A1L1_MOUSE     YCKSPAPLKPENVVVLNGCASLFSALLCEAGEALLIPTPYYGAITQHIYLYGNVRLALNTRPFQLTVEKL
YEY2_YEAST      -------------------------------------------------------------------PQP
HIS8_VIBFM      ----------------------------------------------------------------------
HIS8_METMP      ----------NIIVGGDGADEVIMRILIDEGDEVIIPIPTFTQYAISAKIHGANIKWAKFDEENGFKLDV
HIS8_HAEIG      ---AGVSTENVLVTRGEGIELIIHTFCEPKQDAILFCPPTYGMYAVSAETAGVLSKTVPLT---------
HIS8_BRUME      -ETQGLNISN--ILCGNGSDELLGLLCLAPGDETIITEHGFAVYKIQTLAAGATPVTVKEKNERIDV---
HIS83_RHILO     YS-----VSMDQVIAGNGSSELLYRAFLTPGDSVAMMSPGFSFNRKLATLQGAQFVEIEFSKDHSLPMEQ
HIS82_THIDA     HA-----VSPDQVFVGNGSDEVLAHTFLAL-------------------LKHERPVFFPDITAHRAIPLD
HIS82_CARHZ     YG-----VTPDNIILGNGSDELVMFLAMALGDEAIMPVPSFPRY---------EPVVTMMNGIAREIPLK
HIS81_HAEIN     ---AGVSTENVLVTRGEGIELIIHTFCEPKQDAILFCPPTYGMYAVSAETAGVLSKTVPLT---------
HIS8_MYCSS      LNRTGVELSVENLWAANGSNEVLQQLLQAFGGPGRSAIGFVPSYSMHPIIADARTEWLQALRADDFGLDV
HIS8_MYCSM      --------------AANGSNEILQQLLQAFGGPGRTAIGFVPSYSMHPIISDGQTEWLQASRAEDFGLDI
HIS8_MYCSK      LNRTGVELSVENLWAANGSNEVLQQLLQAFGGPGRSAIGFVPSYSMHPIIADARTEWLQALRADDFGLDV
HIS8_MYCSJ      LNRTGVELSVENLWAANGSNEVLQQLLQAFGGPGRSAIGFVPSYSMHPIIADARTEWLQALRADDFGLDV
HIS8_METM5      -----MPTE-NIIVGGDGADEVIMRILIDEGDEVIIPIPTFTQYAISAKIHGANIKWAKFDEENGFKLDV
HIS8_GLUDA      --------DTLRLYSDPTSERLRAAIAQAVGMDVGNGSDEVLAHAFHALLQHDAPLLTPDITAHQPVPLD
HIS8_GEOUR      ---------PEWIVMANGSDEVLNNLIRAFGDEIAYVYPSYSYYATLAEIQGAR---VKTY----GLTDD
HIS82_BRAJA     ---RTFGLDPNRIICGAGSDEILNLLALGQGDEAISTTHGFLVYPIATMAVGARNVI---AQEKNLTCDV
1A19_ARATH      ----------------------------------------------------------------------
PATR_RHOOB      ------------------------------GDEVMFAWRSFEAYPVVTRVAGAVPVTVPTADYRHDL---
HIS8_XANP2      --------DPARIICGAGSDEILNLVAVGPGDEVIFSEHGFLVYKIATLASGGTPV---VARERDLTADV
HIS8_ROSS1      ---------PERIICGAGSDELIDLLMRATPGDTMICPPTFAMYSFDAALYGAR--VVP-------VPRT
HIS8_HELHP      FD-----VESKHIIIGAGSDQIIEFCMQALNAQVLMAKTTFAMYEVYAKLAGVE---ISKTPSDEHILEE
HIS8_HAEIE      ---AGVSTENVLVTRGEGIELIIHTFCEPKQDAILFCPPTYGMYAVSAETAGVLSKTVPLT---------
HIS8_COLP3      -----LPVDNILATRGAGIELIIRSFCRAYQDSVLICPPTYGMYAISAENHGAGIISVPL------VNTP
HIS8_BLOPB      AYYAGVRSDQILVSRGADSIELLMKVFCNPGKDVIICPPTYGMYKTTAEILGINYRIIP---------KK
HIS8_VIBF1      ----------------------------------------------------------------------
HIS8_SHEON      ------------IVASRGADEAIELLIRAFGIDIATFGPTYGMYAAQTFNVGVKAL---SLSAEYGLP--
HIS8_POLNA      AQ---MPEGFDIML-GNGSDELIALLALACGGSVLAPLPGFVMYAMSAQLQGLKFIGVDLTP-------D
HIS8_LYSSC      -----LGVQETQLLFGNGSDDIIAIITRALGVNTIMADLSFSQYWHNAEIEGAE---IRKIPCVEGAHDL
HIS8_GEOTN      -----LGVKETQLLFGNGSDEVVQIFCRAFGTNTVMATPTFPQYRHNAIIERAE---VREVPLVDGRHDL
HIS8_DEHSB      ---TGVAVEQ--IVCGAGSDQLIDLLLRLFGDEVINCPPTFAMYKFYTELNRGKIVNVPRDASYXXXXXX
HIS8_BAUCH      ----------------------------------------------------------------------
HIS8_ALISL      ----------------------------------------------------------------------
HIS82_OCEIH     ------------------------------GSNVVMATPTFPQYKHYSLIENAEIKEIPTD--KEGYHQL
HIS81_BURS3     ----GVPAGCE-VLLGNGSDEIISMMSMACGAKVLAPVPGFVMYELSAKLA--QLEFVGVPLKADLTLDV
HIS8_MYCVP      SAQTGTAVGVENVWAANGSNEILQQLLQAFGGPGRSALGFVPSYSMHPIISDG----TQTRWLVANRGDD
HIS8_ERWCT      ----------------------------------------------------------------------
HIS8_BACSU      ------------LIFGNGSDEIIQIICRAFLNDTVTAAPTFPQYKHNAVIEGAEVREIALRP--DGSHDL
HIS8_VIBPA      ----------------------------------------------------------------------
HIS8_VIBHB      ----------------------------------------------------------------------
HIS8_RHOCS      -HRFGL--DPARVLCFNGSDEVLHLLAQAYAGPGGEVLYSRHGFLVYXXXXXXXXXXXXXXXERNLTTDV
HIS8_CORJK      VSQQGVGVTKEQVWAANGSNEVLQQLLQAFGGPGRSAMGFVPSYSMHPILAAGQTEFVTVAENRFDIDVD
HIS82_MANSM     ---------------------------------VLYCPPTYGMYAVSAETLGIATKTVPTEDFQLDLPE-
HIS82_BACC1     -----LQVQMEQVLCGSGLDEVIQIIALKAGDNIVTAGATFPQYRHHAIIEGCE---VKEVPLNNGVYDL
HIS8_DEHSC      ---TGVAVEQ--IVCGAGSDQLIDLLLRLFGDEVINCPPTFAMYKFYTELNRGKIVNVPRDASYXXXXXX
HIS8_AGRT5      ------------ILCGNGSDELLGLLCLGAGDEAIITEHGFLVYKIQIMGAGATPV---TVKEKDCVVDV
YDIU_SHISS      ----------------------------------------------------------------------
YDIU_SHIBS      ----------------------------------------------------------------------
YDIU_SHIB3      ----------------------------------------------------------------------
YDIU_ESCF3      ----------------------------------------------------------------------
YDIU_ECOUT      ----------------------------------------------------------------------
YDIU_ECOSE      ----------------------------------------------------------------------
YDIU_ECOLI      ----------------------------------------------------------------------
YDIU_ECOLC      ----------------------------------------------------------------------
YDIU_ECOL6      ----------------------------------------------------------------------
YDIU_ECOL5      ----------------------------------------------------------------------
YDIU_ECOK1      ----------------------------------------------------------------------
YDIU_ECOHS      ----------------------------------------------------------------------
YDIU_ECODH      ----------------------------------------------------------------------
YDIU_ECOBW      ----------------------------------------------------------------------
YDIU_ECO81      ----------------------------------------------------------------------
YDIU_ECO5E      ----------------------------------------------------------------------
YDIU_ECO57      ----------------------------------------------------------------------
YDIU_ECO55      ----------------------------------------------------------------------
YDIU_ECO45      ----------------------------------------------------------------------
YDIU_ECO27      ----------------------------------------------------------------------
YDIU_ECO24      ----------------------------------------------------------------------
HIS8_SODGM      ----------------------------------------------------------------------
HIS8_METM7      ----------NIIVGGDGADEVIMRILIDEGDEVIIPIPTFTQYAISAKIHGANIKWAKFDEENEFKLDI
HIS8_MESSB      -KAHGL--NPANILCSNGSDELLALLALMPGDEGIYTEHGFLVYRIQILAAGATPVVAREKDERADV---
HIS8_LISIN      ---------------------LLTRVLLDTTTNTVMATPTFVQYRQNALIEGAEVREIPL--LQDGEHDL
HIS8_KLEP3      ----------------PGKDALLYC------------PPTYGMYSVSAETIGVECRTVPTADWQLDLPGI
HIS8_BIFLO      LAREGTRLDVDELWGANGSNEIMLQLFQAFGGPGRTALGADPTYSMYPEYARGWKLAHRNADFTLNV---
1A15_ARATH      ----------------------------------------------------------------------
YDEF_BACSU      IQRGGFETSVDHILFANGGQNAIAATLASLGDRIGVDHHTYPGLKTVASL-----LSVQIVPIKS---EN
HIS8_RHOPS      ---RAYGLDPDRIICGAGSDEILNLLAHTYLGDEAISTTGFLVYPIATLANGARNVVAEEKDLTCNV---
HIS8_METPP      ---AGLPPGCALML-GNGSDELISLLSMACGATVLAPLPGFVMYEMSARLQGLRFVGVPLTADF----EL
HIS8_LISMF      ---------------------LLTRVLLDTTKNTVMATPTFVQYRQNALIEGAEVREIPL--LVDGAHDL
HIS8_LISMC      ---------------------LLTRVLLDTTKNTVMATPTFVQYRQNALIEGAEVREIPL--LVDGAHDL
HIS8_FRASC      ------------VWAANGSNEILQQLLQAFGGPGRVALGFEPSYSMHRLIA----LATATEWVAGQRAED
HIS8_ENT38      ----------------------------------------------------------------------
HIS8_DESDG      ----------------------------------------------------------------------
HIS81_RHILO     GE--------DQIILGNGSEDLLSVISRAVGDSVVTLYPSFPLHEDYATLMGASVKRVTV--NDDLTINA
HIS8_VIBVY      ----------------------------------------------------------------------
HIS8_VIBVU      ----------------------------------------------------------------------
HIS8_LISMH      ---------------------LLTRVLLDTTKNTVMATPTFVQYRQNALIEGAEVREIPL--LVDGAHDL
HIS8_KLEP7      ---------PEQVLVSRGADEGIELLIRAFGEDAVLCPPTYGMYSVSAETIGVECRTVPTADWQLDLPG-
HIS8_ACEPA      --------DNDTLRLYPDPEAL--ALRKALGARIGLG-PEYVAHAFQAFFAHGEPLLFPDVTYSRNVPLT
HIS82_RALSO     --KFGVPEA--WITLGNGSNDILELALVAPGQGVIYAQHAFAVYALAAQEVGARAVEVP---ARDYGHDL
HIS81_IDILO     ----------QQITLGNGSNDVLEILARTFVSDVIFSQHAFVVYPLVTQAIGAKPVAVPAVDYGHDL---
HIS8_LISMO      ---------------------LLTRVLLDTTKNTVMATPTFVQYRQNALIEGAEVREIPL--LTDGAHDL
HIS8_CLOK5      ------------IMAGNGSDELIQIIIAALNENIMTVEPDFSMYGNYSEIGGGKALIFQLDEEFN--LDV
HIS8_CLOK1      ------------IMAGNGSDELIQIIIAALNENIMTVEPDFSMYGNYSEIGGGKALIFQLDEEFN--LDV
HIS8_BURM1      ----GVPGTCD-VLLGNGSDEIISMISVACGAKVLAPVPGFVMYELSARFA--QLDFVGVPLKADLTLDV
HIS8_BACNA      ------------------------------------AAPTFPQYKHNAVIEGAEVREIALRP--DGSHDL
COBD_SALTY      ----------------------------------------------------------------------
COBD_SALTI      ----------------------------------------------------------------------
1A13_SOLLC      ----------------------------------------------------------------------
YDIU_SALTY      ----------------------------------------------------------------------
YDIU_SALSV      ----------------------------------------------------------------------
YDIU_SALPK      ----------------------------------------------------------------------
YDIU_SALPC      ----------------------------------------------------------------------
YDIU_SALPB      ----------------------------------------------------------------------
YDIU_SALPA      ----------------------------------------------------------------------
YDIU_SALNS      ----------------------------------------------------------------------
YDIU_SALHS      ----------------------------------------------------------------------
YDIU_SALEP      ----------------------------------------------------------------------
YDIU_SALDC      ----------------------------------------------------------------------
YDIU_SALAR      ----------------------------------------------------------------------
YDIU_SALA4      ----------------------------------------------------------------------
HIS8_STRM5      -------TPPQLLI-GRGSDEAIDLLVRALGRDVLVTPPVFGMYAVCARLQGAALIEVPLVDTEDGLR--
HIS8_DIAST      ------------VLLGNGSDELISLVALACAATVLAPVPGFVMYAMSAQLQGLGFVGVPLT-ADFELDEA
HIS8_ACISJ      ------------VLLGNGSDELISLVALACAATVLAPVPGFVMYAMSAQLQGLGFVGVPLT-ADFELDEA
HIS82_NITOC     -----LPEDMEMIL-GNGSDELIQMVLLAVAGSVVAPEPTFVMYRQIAALLGLQ--YQGVALREDFSLDL
HIS82_ARCFU     -----TGFEVENIAVGCGASELISCILLEELDRVVIPMPSYTLYSIYAMLRSASPVF------EGYRVDP
HIS81_CAUCR     -ERYKL--EPERLTFGDGSDEI-FALLCQVGDNIVQGEHGFAAYAIGARACQGE---VRMAKEVNHRVDI
YDIU_SALTI      ----------------------------------------------------------------------
HIS8_SHEAM      ----------------------------------------------------------------------
HIS8_PELCD      --------DPDWVIMANGSDEVLNNLIRAFAGEIAYVHPSYSYYSTLAEIQGARTFLLDEGWALKDFPE-
HIS8_METI4      ----------------------------------------------------------------------
YDIU_ECOSM      ----------------------------------------------------------------------
YDIU_ECOLU      ----------------------------------------------------------------------
YDIU_ECO7I      ----------------------------------------------------------------------
HIS8_YERPY      ----GLPPEQVLVSRGAGIELLIRAFCEPGQDAILFCPPTYGMYAVSAETFGVERRTVP-AQADWQLDLP
HIS8_YERPS      ----GLPPEQVLVSRGAGIELLIRAFCEPGQDAILFCPPTYGMYAVSAETFGVERRTVP-AQADWQLDLP
HIS8_YERPP      ----GLPPEQVLVSRGAGIELLIRAFCEPGQDAILFCPPTYGMYAVSAETFGVERRTVP-AQADWQLDLP
HIS8_YERPN      ----GLPPEQVLVSRGAGIELLIRAFCEPGQDAILFCPPTYGMYAVSAETFGVERRTVP-AQADWQLDLP
HIS8_YERPG      ----GLPPEQVLVSRGAGIELLIRAFCEPGQDAILFCPPTYGMYAVSAETFGVERRTVP-AQADWQLDLP
HIS8_YERPE      ----GLPPEQVLVSRGAGIELLIRAFCEPGQDAILFCPPTYGMYAVSAETFGVERRTVP-AQADWQLDLP
HIS8_YERPB      ----GLPPEQVLVSRGAGIELLIRAFCEPGQDAILFCPPTYGMYAVSAETFGVERRTVP-AQADWQLDLP
HIS8_YERPA      ----GLPPEQVLVSRGAGIELLIRAFCEPGQDAILFCPPTYGMYAVSAETFGVERRTVP-AQADWQLDLP
HIS8_YERP3      ----GLPPEQVLVSRGAGIELLIRAFCEPGQDAILFCPPTYGMYAVSAETFGVERRTVP-AQADWQLDLP
HIS8_METJA      --------EENIIVGGDGADEIIDTIFRTFGDEVIIPIPTFTQYRVSATIHNAKIKYAKYDKEKDFKLNV
HIS8_GEOSW      -----LGVNETQLIFGNGSDEVVQIIFLSPNTNTVMAAPTFPQYRHNAVIEGAE---IREIPLVDGRHDL
HIS8_GEOSL      --------DPAWIIMANGSDEVLNNLIRAFAGEIGYVHPSYSYYATLAEIQGARVRTFGLT---------
HIS8_BACLD      ------------IILGNGTDEVIQIILLDPASNTVMANPTFSQYKHNAVIEGAEVREVGLL--ENGCHDL
HIS82_METCA     ----------------------------------------------------------------------
HIS82_HAEIN     ---KKFGVQPNQITLGNGSNDLLFAHTFATEGDEIMY--SQYAFIVYPLVTKAINAIVKEIPAKNWGHDL
HIS82_BACAN     -----LHVKMEQVLCGSGLDEVIQMISRAVGDNIVTAGATFPQYRHHAIIEGCE---VKEVALNNGVYDL
CR3L3_BOVIN     ----------DQVLPGADSDDFLNSILGSGDSD----SPTWSPAASDSGISEDLPSDTQDTPPHGGVPAT
HIS8_HALVO      W---GLAPEQVWVSPGAGSIDYLTRAVLEPDDRILEPAPGFSYYSMSARYHHGDAV-------QYEVSKD
HIS82_PSYA2     ----------------------------------------------------------------------
HIS82_PASMU     ---------PEQITLGNGSNDLLELVAHTFANEILFSQYAFIVYPLVTQAINAKKVEIP---AKNYGADL


                         +         .         .         .         .         *         .:210
query           DALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDLVHDPTTVVH
AAT_THEAQ       ERVRRAITPR------TKALVVNSPNNPTGVVYPEEVLRALAEMALQHDFYLVSDEIYEHLIYEGAH--F
AAT_THET8       ERVRRAITPR------TKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEH--F
AAT_BACY2       EQLKNAITDKT------KAVIINSPSNPTGMVYTREELEDIAKIALENNILIVSDEIYEKLLYNGAESIA
AAT1_BACSU      EQLKNAITEKT------KAIVINSPSNPTGVMYTEEELSALGEVCLEHDILIVSDEIYEKLTYKKHVSIA
AAT_AQUAE       EDVKEKVTERT------KAIVINSPNNPTGAVYEEEELKKIAEFCVERGIFIISDECYEYFVYGDAKFV-
AAT_BACST       EQLKQAITPRT------KAVIINSPSNPTGMIYTAEELKALGEVCLAHGVLIVSDEIYEKLTYGGAKHV-
AATA_RHIME      EDLDRAITP------KTKWFVFNSPSNPSGAAYSHEELKALTDVLMKHPHVVLTDDMYEHLTYGDFRFA-
AAT_SYNY3       EQLRQAITSKS------KLFVLNSPSNPTGAVYTPAEIRALAAVILEYDLYVVSDEIYERILYDGTEHLS
AAT_PYRHO       NELLEKIS------KNTRMIVINYPNNPTGATLDKELAKTIADIAEDYNIYILSDEPYEHFIYEDAK--H
AAT_PYRAB       DELKKYVTEKT------KALIINSPCNPTGSVLKKKDLEEIADFAVEHDLIVISDEVYEHFIYDDVSIAS
AAT_RHILP       NFKLQAADLEKAITPKTKWFIFNSPSNPTGAAYTHDELKALTDVLMKNPQVVLTDDMYEHLTYGDFKFV-
AATB1_RHIME     EKLEAAITPR------TRWVLLNSPSNPSGAAYSAADYRPLLEVLRHPHVWLLVDDMYEHIVYDGFRFV-
AAT_SULSO       DDLQSKISKRT------KMIVFNNPHNPTGTLFSPNDVKKIVDISRDNKIILLSDEIYDNFVYEGK--MR
AAT_STRVG       EQLEAARTERT------KVVLFVSPSNPTGSVYSEADAKAIGEWAAEHGLWVLTDEIYEHLVYGEAKFTS
AAT_SULTO       TGFSLNLSELESKNKKTKMIVLNNPHNPTGMVFDPIEIEKLMEITKEKKVLLLSDEIYDYFIYEMKSVLE
AATB2_RHIME     QKLEAAITPRT------RWVLLNSPSNPSGAAYSAADYRPLLDVLLKHPHVLLVDDMYEHIVYDAFRFV-
AAT_MYCTU       ADLESKITERT------KALVVINPNNPTGAVYSCEILTQMVDLARKHQLLLLADEIYDKILYDDAKHI-
AAT_MYCBO       ADLESKITERT------KALVVINPNNPTGAVYSCEILTQMVDLARKHQLLLLADEIYDKILYDDAKHI-
AAT_THEMA       EEV-----EGLLVGKT-KAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYDEFTSIL
AAT1_METJA      EKVKESIT------KKTKLIIFNSPSNPTGKVYDKETIKGLAEIAEDYNLIIVSDEVYDKIIYDKKH--Y
AAT_RICCN       EALERSITD------KTKWLIINSPSNPTGASYNFEELENIAKVLRKYSHVVMSDDIYEHITFDDFK-FY
AAT_RICFE       EALERSITD------KTKWLIINSPSNPTGASYNFEELENIAKVLRKYPHVVMSDDIYEHITFDDFK-FY
AAT_RICBR       EALEQLITP------KTKWLIINSPSNPTGASYSHSELKNIAEVLRKHPYVVMSDDIYEHITFDGFK-FY
AAT_SULAC       NDLENKITDKT------KMVVLNNPHNPTGMVFDPKEIDQLIEIAKSKNLIVLSDEIYDYFVYEMRSVLE
DAPAT_NATTJ     ESIPQSRLSKG------KIVFMNYPNNPTSAVASKDFYSHAVKFCQKNKLLLCNDAAYSEIAFDPQSLLS
AAT_RICTY       EALERSITD------KTKWLIINSPSNPTGAGYNCKELENIAKTLRKYPNVIMSDDIYEHITFDDFK-FY
AAT_RICPR       EALEHSITD------KTKWLIINSPSNPTGAGYNCKELENIAKTLRKYPNVIMSDDIYEHITFDDFK-FY
AAT_PYRKO       ------VEEIKAD-----LIIINYPNNPTGRVLSGKEIRGLLDVAEENGVKVLSDEVYAELSFTRFT---
DAPT2_ANAVT     DLIPEEVA------RKAKMLWVNYPNNPTGALATLEFFEELVAFCQQHSILLCHDHAYSEMAYDPPSVLQ
DAPAT_MOOTA     GAIPSDVA------RRAKLMFINYPNNPTGAVADLKFFQEVVEFARSYDLIVCHDAAYSEITYDAPSFLQ
DAPT2_ANASP     DLIPEEVA------RKAKMLWINYPNNPTGALATLEFFEELVALCQQYSILLCHDHAYSEMAYDPPSVLQ
DAPAT_SYNFM     DSIPADVA------RRAKVMFINYPNNPTGATAERDFFEKVIAFAREYDVIVCHDAAYTEMAYRPLSFLE
DAPAT_GLOVI     EAVPETVA------RKAKLLWLNYPNNPTGAVASLEFFEKVVHFAKKHDILVCHDNAYSEMAYDPPSILQ
YFBQ_SHIFL      DDIRAKITPRT------RGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAE-HH
YFBQ_ECOLI      DDIRAKITPRT------RGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAE-HH
YFBQ_ECOL6      DDIRAKITPRT------RGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAE-HH
DAPAT_DESVV     DAIPED-TWKRA-----KMIFVNYPNNPTAATAPLGFYEKLVDICRRFDVIIAHDTAYTEIYYDPPSILS
DAPAT_DESVH     DAIPED-TWKRA-----KMIFVNYPNNPTAATAPLGFYEKLVDICRRFDVIIAHDTAYTEIYYDPPSILS
Y286_HAEIN      DDIKAKVNAKT------KAIVIINPNNPTGAVYSKELLQEIVEIARQNNLIIFADEIYDKILYD-GAVHH
DAPAT_AQUAE     DSIPEDVA------KKAKIIWINYPNNPTSAPPTLEFYKKLVDWAKEYNVIIASDNAYSEIYEKPPSILQ
DAPAT_CARHZ     DSIPEEVA------RKAKLMFINYPNNPTGAVADLGFFEKVVHFAKKYEILVCHDAAYSEITFDGRAPSF
PATA_BACSU      RLIEDALTP------NTKCVVLPYPSNPTGVTLSEEELKSIAALLKGRNVFVLSDEIYSELTYDRPH--Y
DAPAT_DESDG     DAVDEATWEKA------RCIFVNYPNNPTAAMAPRSFFEKLIGIARKHNVIVVHDAAYTEMYYNPLSIME
1A112_ARATH     SALEQALNQARKRGSKVSGILFSNPSNPVGNILSRETLCDILRFAQEKNIHVISDEIFAGSVYGDKEFVS
DAPAT_PROMA     -LNAENGFEAELPSEPVDLIYLCFPNNPTGAVASKVQLTKWVEYAKKNHALILFDAAYESFIQDP-LLPH
ATTY_TRYCR      DEIR------RLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVKDPNATFT
DAPAT_DESAD     DAISDEKWD------KCKIFFVNYPNNPTSATATPEFYAELVAKAKKHNVIIAADAAYTEVYYDPISILE
HIS8_GRABC      DALLDAITPRT------KVVCIANPNNPTGTMLPTAEIARL-RASLPSDVLLVLDAAYAEYVDDPDYDPG
DAPAT_EUBE2     PCTAET-NFAPELPKETPDIIYLCPNNPTGSTITKDELQKWVDYANKVGAVIIYDAAYEAYISEP-DVPH
PATR_STRCO      DAMADAITDRT------RLIFVCNPNNPTGTVVRRAELERFLDRVPS-DVLVVLDEAYREFIRD--AEVP
DAPAT_HALOH     KAIDEDIA------RKAKLFFINYPNNPTGAIAPEEFYEELIDFADKYDIIIAHDAAYSEIGLDG----Y
DAPAT_SYNPW     PISADNGFAAQIPSDPVDLIYLCFPNNPTGAVATKEQLKAWVDYARANDALILFDAAYEAFIQDP-SLPH
AAT2_METJA      DFTVESLEEALSD--KTKAIIINSPSNPLGEVIDR----EIYEFAYENIPYIISDEIYNGLVYEGKC--Y
DAPAT_SYNS9     PISADNNFSAEIPSEPVDLIYLCFPNNPTGAVATRAQLKAWVDYARSHNALILFDAAYEAFIQDP-EIPH
DAPAT_DESVM     DAI-PAATWDRA-----KMIFVNYXXXXXXXXXXRAFYEKLIGICRKHNVIIAHDTAYTEVYYDPMSILE
YFDZ_ECOLI      NELERAIRESYPKPK---MMILGFPSNPTAQCVELEFFEKVVALAKRYDVLVVHDLAYADIVYDAPSIMQ
DAPAT_DEHSC     EAIPQNILSKA------KVLWINYPNNPTGAVAGLSFFQEVANFAAKHNLAVCHDGPYSEIAFDGKPVSF
DAPAT_DEHSB     EAIPQNILSKA------KVLWINYPNNPTGAVAGLSFFQEVANFAAKHNLAVCHDGPYSEIAFDGKPVSF
PATR_STRAW      DAMADAITDRT------RLIFVCNPNNPTGTVVRRAELERFLDRVPS-DVLVVLDEAYREFIRDPEVPDG
ATTY_MOUSE      KQLESLIDEKTAC------LVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDM-------VF
DAPAT_SYNR3     PITAANDFTAPLPSTPVDLIYLCFPNNPTGAVASREQLKSWVDYALEHKALILFDAAYEAFIQDP-AIPH
DAPAT_DEHE1     NAIPQDVLS------KAKILWINYPNNPTGAVAGLDXXXXXXXXXXXHNLAVCHDGPYSEIAFDGRPVSF
YBDL_ECOLI      EFAA-------LLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHIQQGHASVLA
KAT3_DANRE      DWVLDQEELASKFNSKTKAIIVNTPNNPIGKIFSRSELQAIADLCIKHDTLCFSDEVYEWLIHEHVKIAT
DAPAT_ARATH     GFFPDLSTVGRT---DI--IFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDPRSIFE
ATTY_RAT        KQLESLIDEKTAC------LVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDM-------VF
KAT1_HUMAN      SSNWQ-LDPMELAGKRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVHQHISIAS
PATR_STRGG      DAMAEAITDRT------RLIFVCNPNNPTGTVVRRAELERFLDRVPS-DVLVVLDEAYKEFIRD--AEVP
KAT1_MOUSE      WQLDPTELASKFTPRTKILVLNT-PNNPLGKVFSKKELELVAALCQQHDVLCFSDEVYQWLVHQHISIAS
DAPAT_PROM4     -MNAENGFEAEIPSEHFDLIYLCFPNNPTGSVATKEQLMRWVEYAKNHDALILFDAAYEAFIQDP-ELPH
ATTY_HUMAN      KQLEYLIDEKTAC------LIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDM-------VF
Y1391_METJA     ESIPEDIKKRA------KILYLNYPNNPTGAQATKKFYKEVVDFAFENEVIVVQDAAYGALVYDGKPLSF
AATC_RHIME      --LERAV---RHSIPKPLALILNYPSNPTAQVATLDFYKDVIAFAKKHDIIVLSDLAYSEIYFDPPSVLE
ALA2_HORVU      SDVKKQLEDARSRGINVRALVVINPGNPTGQVLAEENQYDIVKFCKNEGLVLLADEVYQENIYVDNKKFH
DAPAT_SYNS3     PISADNGFAAQIPSEPVDLIYLCYPNNPTGAVATKAQLKKWVDYARANKALILFDAAYEAFIQDP-ELPH
BNA3_YEAST      KELDQRNTRGKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFDSFTRIA
KAT1_RAT        WQLDPAELASKFTPRTKILVLNT-PNNPLGKVFSRMELELVANLCQQHDVVCISDEVYQWLVHQHVSIAS
HIS8_LACPL      EGLMKAITP------HVKMVWLCNPNNPTGTVESLAAIEAFVQQVPPETMVLI-DEAYIDFTPGQVTAMQ
HIS8_ARTAT      YGLQSAAAQVRETGANI--VFLCSPNNPTGTGLSLDVVEAVYEAGEASQAIVIVDEAYHEFAHDPSALTL
DAPAT_NOSP7     ITADNNFT-AEIPSKKVDLIYLCFPNNPTGATATKEYLKAWVDYAKANNSIIFFDAAYEAYITDP-SIPH
HIS8_MAGSA      DNLLAAVTPRT------KILFLANPNNPTGTYLPATEVARL-RAGLRADILLVIDAAYTEFVSRNDYSGG
ATTY_DICDI      EHLRSLIDDKT------KAILVNNPSNPCGIVYSKQHLLDIIQVAREYCLPIIADEIYSDLTFGEHKFY-
ATTY_BOVIN      KQLESLIDEKTVC------LIVNNPSNPCGSVFSRRHLQKILAVAARQCVPILADEIYGDM-------VF
ALA2_PANMI      SDLKKQLEDARSKGIDVRALVVINPGNPTGQVLAEDNQCDIVRFCKNEGLVLLADEVYQENIY-------
DAPAT_DESOH     ECTAQNSFLPAIPKEPADLVYLCFPNNPTGAVATKEYLQAWVDWALDAKALILFDAAYEAFIRDPSTIYE
Y104_SULSO      DELERKIKDAHSNGKKVKLMVIPTAQNPAGTTMNTEDRKRLLEIASKYDFLIFEDDAYGFLVFEGESPPP
PATR_LEIXX      -ALAAAITDRT------RAVIVCTLNNPTGPVV---TAAEFASFMAEVDLLVLLDEAYHEFETDEAAVNG
HIS8_METAC      EKILGAVSPR------TKIIFLCSPNNPSGNLLPEADLRKIVENTHAL---VFVDEAYVEFARNLTGLVR
1A1L2_HUMAN     DKLEEALPEARLEGKKVRGLVLINPQNPLGDIYSPDSLMKYLEFAKRYNLHVIIDEIYMLSVFDESITFH
DAPAT_CYAP4     VTAENGFT-ASLPEQKVDLIYLCFPNNPTGATASRAHLQQWVDYARANGSIIFFDAAYEAFITDP-DLPH
PATR_MYCSS      DAMLAAITDRT------RLIFVCNPNNPTSTVVDPAALKRFVEAVPPHILVVI-DEAYVEYIRGDQVPDS
PATR_MYCSK      DAMLAAITDRT------RLIFVCNPNNPTSTVVDPAALKRFVEAVPPHILVVI-DEAYVEYIRGDQVPDS
PATR_MYCSJ      DAMLAAITDRT------RLIFVCNPNNPTSTVVDPAALKRFVEAVPPHILVVI-DEAYVEYIRGDQVPGS
HIS8_CHLPD      DAIIRKAGEER-----VDFIVLSTPNNPTGMSLASEEVCRIAEAA---DALVLVDEAYIEFSRQKSVV--
DAPAT_THEEB     ITAENHFT-ATLPSEPVDLIYLCFPNNPTGAVASREHLQAWVDYARAHKAILFFDAAYEAFITDP-AIPH
AAT2_BACSU      EKIDPAVLE------KAKLMFLNYPNNPTGXXXXXXXXXXXXXXXXEHNIHLIHDFAYGAFEFD-----Q
HIS8_MYCUA      DAAIAVVSDRRPD-----VVFITSPNNPTGQSVSLTELRRLLDVVPG---ILIVDEAYGEFSSQPSAV--
DAPAT_DESDA     PAVRPDM------------IYLCYPNNPTGTVLSRAALQGWVEYARREGCVILYDSAYEAFITE-ADIPH
HIS8_RHORT      DAMLAAVRDTT------KLVFLANPNNPTGTCLPTSEVVRLREGLRD-DIILVVDAAYAEYVERNDYDAG
HIS8_MYCMM      DAAIAVVSDRRPD-----VVFITSPNNPTGQSVSLTELRRLLDVVPG---ILIVDEAYGEFSSQPSAV--
HIS8_CORDI      DAALAAITTHQP-----NIVFVTTPNNPTGDVTSLDTIKKILDVAPG---IVIVDEAYAEFSEQPSAI--
DAPAT_SYNP6     ISAENNFT-AEIPSEKVDLIYLCFPNNPTGAVASREYLQAWVDYARANGAIILFDAAYEAFITDP-AIPH
DAPAT_SYNE7     ISAENNFT-AEIPSEKVDLIYLCFPNNPTGAVASREYLQAWVDYARANGAIILFDAAYEAFITDP-AIPH
DAPAT_PROM3     PINAENGFAAKIPSEPVDLIYLCFPNNPTGAVATRAQLQEWVNYARTNSVLILFDAAYEAFIQNP-DLPH
HIS8_METMA      EKILEAVSPRT------KIIFLCSPNNPSGNLLPEADLRKIIE---NTDALVFVDEAYVEFARNLAALVN
HIS8_LEUMM      DAILDAIDDKTAM------VWIANPNNPTGVFETTSSIKRFLD-KLPANITLVVDEAYYDFVDEPATVAP
DAPAT_CHLFF     ---------------DIFCLCS--PNNPTGTVLNREQLKELIDYANSHGSIILFDAAYSAFISDPTSIFE
ALAT1_HUMAN     AELHRALGQARDHCRP-RALCVINPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVYAAGSQFH
ALAT1_BOVIN     AELRRALRQARDHCRP-RALCVINPGNPTGQVQTRECIEDVIRFAYEEKLFLLADEVYQDNVYAESSQFH
KAT3_MOUSE      WTFDPRELESKFSSKT-KAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVHTHVKIAT
KAT3_BOVIN      DWTLDPQELASKFNSKTKAIILNTPHNPLGKVYTKEELQVIADLCIKYDTLCISDEVYEWLVY--TGNKH
HIS8_METBF      EKLLEA-TSSRT-----KIIFLCSPNNPSGNLLPEKDLRKVLENTRAL---VFVDEAYVEFAD------R
DAPAT_SYNPX     PISADNGFAAQIPSEPVDLIYLCFPNNPTGAVATKGQLKAWVDYARSNGSLILFDAAYEAFIQDP-SLPH
DAPAT_PARUW     SCLPENNFFPDLANLPKTDLIYFCPNNPTGSAATNEQLRELVQFAKKRQSIIIFDAAYASFVHIPRSIYE
DAPAT_SYNY3     PISAENDFVAAIPSKKVDLIYLCFPNNPTGATATKAYLKQWVDYALAHGSIIFFDAAYEAFITDP-TLPH
DAPAT_GEOSF     ------------LPKEKVDIIYLCPNNPTGTVASKAELKKWVDYANANDAVIFFDAAYEAFITDP-SIPH
HIS8_RHOSR      DAATAAITERRPD-----VVFVTSPNNPTGHSVGIAELRRVLDAAPG---IVIVDEAYAEFSDAPSAL--
HIS8_PELLD      DFDADLILE-RAKAEAVDLIVLSTPNNPTGKSLSPDDIRR---IATESGAIVLVDEAYIEFSRHPSAL--
DAPAT_TRIEI     IRAENNFT-AEIPTQKVDLIYLCFPNNPTGATATKEYLQTWVNYARANDAIILFDAAYEAFITD-ASLPH
DAPAT_SYNJB     ITAENHFT-ASLPSQKVDVIYLCFPNNPTGAVATREHLQNWVDYARAHGSLILFDAAYEAYITEP-GIPH
DAPAT_SYNJA     LTAENHFT-ASLPQQKVDVIYLCFPNNPTGAVATREHLQAWVDYARAHNSLILFDAAYEAYITEP-GIPH
DAPAT_DESAP     AAIP-AETARRA-----KVMFINYPNNPTGAVASKEFFARVVDFAREYGILVCHDAAYSEIAFD------
DAPAT_ACAM1     INAGNNFT-AQIPSQKVDLIYLCFPNNPTGAVASKSHLQDWVNYAKSHGSIILFDAAYEAFITDP-EIPH
DAPAT_PROMM     PINAENGFAAKIPSEPVDLIYLCFPNNPTGAVATRAQLQEWVNYARTNSVLILFDAAYEAFIQNP-DLPH
AAT_STRGR       EQLEAARTE------KTKVVLFVSPSNPTGAVYSEADAEAIGRWAVEHGLWVMTDEI-------------
HIS8_UNCMA      DAVLKQVTDRT------KFIFITSPNNPTGNLTSLAEIR---SVANAVDGIVFVDEAYIDFSGGKTAL--
HIS8_SYMTH      PAMAEA------AARGAKLLFLCRPNNPTGTVFAEADLRAALERVPPSTLVVV-DEAYREFDETPFDSRA
HIS8_RUBXD      EALLSAVTG------ETRAVILCNPNNPTGTHLTLEEVSALADALPE-DVLLILDEAYQEFVADP--AYH
DAPAT_SYNP2     PITADNDFVAQIPTEKVDLIYLCFPNNPTGATATKEQLQAWVDYAKTNGSIIFFDAAYEAFITD-ESLPH
ALAT2_MOUSE     NCWALNVDELRRALRDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFH
DAPAT_LEPBL     ------------IPKEKADIIYLCPNNPTGTVTTKKALRAWVEYAKKNNSIILYDSAYEAFISEP-GVPR
DAPAT_LEPBJ     ------------IPKEKADIIYLCPNNPTGTVTTKEALRAWVEYAKKNNSIILYDSAYEAFISEP-GVPR
ALAT2_HUMAN     NCWALNVNELRRAVQDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFH
PATR_MYCA9      -AMAAAVT-------DVTRLIFVCPNNPTGTVVRPAELRRFVESVPPHILIAI-DEAYVEYVREDFTDSL
HIS8_CORGL      DV---ALEEIRAKQPDI--VFVTTPNNPTGDVTSLDDVERIINVAPG---IVIVDEAYAEFSPSPSAT--
DAPAT_EUBR3     ------------LPKEVPDMIYLCPNNPTGTTLKKEQLQVWVDYANKNGSVIIFDAAYEAYISE-ADVPH
DAPAT_CHLTB     E------------DTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDP-SLPK
DAPAT_CHLT2     E------------DTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDP-SLPK
1A12_CUCPE      AALEIAYKKAQEANMKVKGVIITNPSNPLGTTYDRDTLKTLVTFVNQHDIHLICDEIYSATVFKAPTIVE
HIS8_CORGB      DV---ALEEIRAKQPDI--VFVTTPNNPTGDVTSLDDIERIINVAPG---IVIVDEAYAEFSPSPSAT--
DAPAT_LEPIC     ------IPKEKA---DI--VYLCYPNNPTGTVTTKESLKAWVEYAKKNNSIILYDSAYEAFISEP-GVPR
DAPAT_CHLTR     E------------DTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDP-SLPK
DAPAT_CHLTA     E------------DTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDP-SLPK
ALAT1_MOUSE     RAWALDIAELRRAARDRRVLCVINPGNPTGQVQTRECIEAVIRFAFEEGLFLMADEVYQDNVYAEGSQFH
HIS8_ACICJ      DAMLAEVTPAT------RLVFLANPNNPTGSLVPASDVSRLRAELPP-DVLLVLDAAYAEYVYDPGVELV
DAPAT_SYNSC     PISADNGFAALIPSEPVDLIYLCFPNNPTGAVATREQLQAWVNYARANGALILFDAAYEAFIQDPELPRS
DAPAT_CHLAB     ------IPQDEAI--DIFCICS--PNNPTGTVLNREQLKELVDYANAQGSIILFDAAYSAFISDPTSIFD
1A1C_TOBAC      KAVREAYENAQKSNIKVKGLILTNPSNPLGTTLDRDTLKNLLTFTNQHNIHLVCDEIYAATVFNTPQFV-
PATR_THEFY      EALAAAVTDRT------RMVFVCNPNNPTGTAV------RETELAEFLDTVVVLDEAYREYVQDP-----
ALAM_YEAST      EEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIF-PGTKFH
HIS8_DESHY      EGMLKA-----AAQPQVHMIVLCNPNNPTGTLFPREEILR---IVAESGKIVIVDEAYGEFSGES---VV
DAPT1_ANAVT     VTAENNFT-AEIPSQKVDLIYLCFPNNPTGATATKEHLQAWVDYAKAHNSIIFFDAAYESYITDP-SLPH
DAPAT_LEPIN     ------IPKEKA---DI--VYLCYPNNPTGTVTTKESLKAWVEYAKKNNSIILYDSAYEAFISEP-GVPR
1A11_CUCPE      -ALEIAYKKAQEANMKVKGVIITNPSNPLGTTYDRDTLKTLVTFVNQHDIHLICDEIYSATVFKAPTIVE
Y1527_METMP     DAISKEVRE------NAKILYLNYPNNPTGAQATKKFYKEAVDFAFENDLIVIQDAAYAALTYGDKPLSF
DAPAT_CHLCV     PVIPQ--------GEEIDIFCLCSPNNPTGTVLTKEQLEELITYANSHGSIILFDAAYSAFISDP-SLPK
ALAT1_RAT       RAWALDIAELRRAARDRRVLCVINPGNPTGQVQTRECIEAVIRFAFKEGLFLMADEVYQDNVYAEGSQFH
KAT3_HUMAN      SDWTLDPQELESKNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYDTLCISDEVYEWLVYSGNK--H
1A12_ARATH      DAAEWAYKKAQESNKKVKGLILTNPSNPLGTMLDKDTLTNLVRFVTRKNIHLVVDEIYAATVFAGGDFV-
MTNE_BACSU      SSITAEIRE------QAKLMYLNYPNNPTGAVATSEFFEDTVRFAAENGICVVHDFAYGAVGFDPLSFLQ
HIS8_MYCPA      DAAVAAVTE-----RTPDVVFVASPNNPSGQSVSLSGLRRLLDAAPG---IVIVDEAYGEFSSQP-SAVQ
HIS8_MYCA1      DAAVAAVTE-----RTPDVVFVASPNNPSGQSVSLSGLRRLLDAAPG---IVIVDEAYGEFSSQP-SAVQ
HIS8_CHLL2      DFDADSLIE-RAKQEKVDFIVLSTPNNPTGKSLASPDIAR---IVRECDAIVLVDEAYIEFSREHS--VL
DAPT1_ANASP     VTAENNFT-AEIPSQKVDLIYLCFPNNPTGATATKEHLQAWVDYAKAHNSIIFFDAAYESYITDP-SLPH
ALAT_SCHPO      DQFKKSFDEASKKGINVRLCVVINPGNPTGACISENSMEKVLRFAKAKGIVLLADEVYQNNIY-------
ALAT2_XENTR     NELRRSLTEARKHC-DPKVLCIINPGNPTGQVQSRKCIEDVIRFAAEENLFLMADEVYQDNVYAKGCTFH
ALAM_DICDI      SQLEHSYNDAVSKGINPRALVIINPGNPTGQCLDRANMEEIVKFCLEKNVVLLADEVYQENVY-------
Y1479_METJA     DDLEKRIKYNPA----VSGILVINPDNPTGAVYPKKILNEIVDLANEYDLFIICDEIYCNLVYNGKK-QH
PATR_CORGB      DAMAAAITDKT------RLIFICNPNNPSGTTITQAQFDNFMEKVPN-DVVVGLDEAYFEFNRADDTPVA
DAPAT_GEOMG     PT------------EKVDIIYLCFPNNPTGTVATKAELKKWVDYANANDAVIFFDAAYEAFITDP-AIPH
1A17_ARATH      EALESAYQTARDANIRVRGVLITNPSNPLGATVQKKVLEDLLDFCVRKNIHLVSDEIYSGSVFHASEFT-
HIS8_RHOBA      WELPQSFGENR---EDLKLVLLPNPNSPSGTIVSKP---QIAELSNSLNCPLVVDEAYADFAEENCLDLV
DAPAT_PELPD     PT------------EKVDIIYLCFPNNPTGTVASREELKKWVDYAIANNAVIFFDAAYEAFITDP-AIPH
DAPAT_GEOUR     CNEENHFIPSLPTEK-VDIIYLCFPNNPTGTVASRAELKKWVDYANANDAVIFFDAAYEAFITDP-EIPH
ALAT2_DANRE     SELQRSLQAARKHCNP-RVLCIINPGNPTGQVQSRQCIEDVIQFAAKENLFLMADEVYQDNVYAKGCEFH
1A11_CUCMA      AALEIAYKKAQEANIKVKGVIITNPSNPLGTTYDRDTLKTLVTFVNQHDIHLICDEIYSATVFKAPTIVE
HIS8_CHLTE      DAIIEAARREK-----VDFIVLSTPNNPTSKSLSHDEIERIVEAA---DAIVLVDEAYVEFSREQSAL--
HIS8_AZOC5      DAIIGAVTERT------RVIFLANPNNPTGTYLPFNEVRRL-HAALPPNVLLVLDAAYSEYVRRNDYETG
DAPAT_PROM5     NNFLPEIPKNK-----VDIVYLCFPNNPTGATITKDELKKWVDYANHNKSLILFDAAYEAFIQD-KDVPH
DAPAT_GEOLS     PT------------QKVDIIYLCFPNNPTGTVASKAELKKWIDYANANDAIIFFDAAYEAFITNP-EIPH
DAPAT_CLOPH     PCTKENKFVPSLPAETPDIIYLCFPNNPTGSAITKMKLQKWVDYAIEKGAVIIYDAAYEAYISEPHTIYE
1A16_ARATH      EALEAAYENARKSNIPVKGLLVTNPSNPLGTTLDRECLKSLVNFTNDKGIHLIADEIYAATTFGQSEFI-
HIS8_SILPO      DAILAAVNDRT------RLVFLANPANPTGTMISEAEVTRLAD-GLPGHVLLVLDGAYAEFVEDGGAALV
DAPAT_GEOSL     PT------------EKVDIIYLCFPNNPTGTVATKAELKKWVDYAIANDAVIFFDAAYEAFITDP-AIPH
DAPAT_CYAA5     IS-ADNHFVADIPSEKVDLIYLCFPNNPTGATATKEYLKAWVDYATANDSIIFFDAAYEAFITD-ESLPH
DAPAT_CLOTH     TAENNFIPELPKEKVDI--IYLCFPNNPTGMTLSREELKKWVDYARENRAIILFDSAYEAYIRE-KDVPH
1A1C_PHAAU      EALEDAYEKAREDNIRVKGLLITNPSNPLGTIMDRKTLRTVVSFINEKRIHLVCDEIYAATVFSQPGFI-
1A12_SOLLC      KAVKEAYENAQKSNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQFV-
PATR_CORGL      DAMAAAITDKT------RLIFICNPNNPSGTTITQAQFDNFMEKVPN-DVVVGLDEAYFEFNRADDTPVA
HIS8_METNO      DAILKAVTPRT------RIVYLANPNNPTGTYLPFDEVRRL-HAGLPGNVLLVLDAAYAEYVRRNDYAAG
DAPAT_DESAH     DCTAENNFVPDLPQEQVDLIYLCFPNNPTGTTITKPELKRWVDYAHEAKALILFDAAYEAFIRDDTLPRS
DAPAT_CHLPN     -----------LPNQQSLDILCLCPNNPTGTVLTFQQLQALVNYANQHGTVLIFDAAYSAFVSDPSSIFE
ALAT2_XENLA     NELRRALAEARKHC-DPKVLCIINPGNPTGQVQSRKCIEDVIRFAAEENLFLMADEVYQDNVYAKGCAFH
PATR_MYCVP      DAMLAAITDRT------RLIFVCNPNNPTSTVVDPDALARFVE-AVPPHIMVVVDEAYVEYIRDGLAPDS
PATR_CORDI      DAMAAAITPKT------KLVFVCNPNNPSGTVVRREAFLEFMAKVPA-DVVVALDEAYTEYVRDEDTIFA
KAT3_RAT        WTFNPQELESKFSSKT-KAIILNTPHNPIGKVYTREELQVIADLCIKHDTLCISDEVYEWLVHKHIKVAS
HIS8_PROVI      DAIIQSAQE-----ESVDFVVLSSPNNPTGKSITFDDIRR---IASSCDALVLVDEAYIEFSRQDSAL--
HIS8_PELPB      DFDLEAILRT-AHDEAVDFIVISTPNNPTGKSLTFEEVRL---IAQSSDAIVLVDEAYIEFSRQRS--VL
HIS8_MOOTA      -AMAAAITPR------TRLVFVCNPNNPTGTIVGQAALDGFLKQVPPSVLVVL-DEAYSDYVHYPNSLAY
HIS8_LACF3      GALA-VINEAT------RLVWICNPNNPTGVLESPQAIEDFVRQVPKDTLVFI-DEAYLDFADDPAKATC
AAT3_BACSU      EAVRQSITP------QTKGLILNTPHNPTGTVLSQKNIDDLGALLKEIEIYVLFDEPYSQLIYDEE--LA
1A1C_DIACA      EALQSAYEDALKKNIKVKGIIVTNPSNPLGTVLDKDTLKMLLTFVNAKNIHLVCDEIY------ATTVFN
1A14_SOLLC      EAIEEAYEKGQQANVKIKGLILTNPCNPLGTILDRDTLKKISTFTNEHNIHLVCDEIYAATVFNSPKFV-
1A11_PRUMU      EALEAAYEKAQKNNINVKGLIITNPSNPLGTTLDRNTLESLVEFINQKNIHLVCDEIYAATVFSSPTFVI
KAT_DICDI       KRSSKHKEELAAAFTDTKLIILNNPHNPVGKVYSKEELQEIADVVAKHNTTVISDEVYEWMTFDGEE--H
HIS8_METS4      DAILAAVTPRT------RIVYLANPNNPTGTYLPFDEVRRL-HAGLPGDVLLVLDAAYAEYVRRNDYAAG
HIS8_CHLP8      DAIIAAAEREK-----VDFIVLSTPNNPAGKSMSHDEVERIVSTC---DAIVLADEAYIEFSQQESVV--
DAPAT_MICAN     ITAENNFT-AQIPAEKVDLIYLCFPNNPTGATATKEHLTAWVNYARANGSIIFFDAAYEAFITD-ASLPH
DAPAT_HELMI     CTEANGMKPELPKTR-VDMIYLCFPNNPTGMTLTKEELKQWVDYARENKSIILYDAAYEAFIHIPRSIYE
CBL_BACSU       -AIDFEDLETKLSDPSVTLFILCNPHNPSGRSWSREDLLKLGELCLEHGVTVVSDEIHSDLMHKHTPFAS
1A1C_SOYBN      QALEDAYEKAKEDNIRVKGLLITNPSNPLGTVMDRNTLRTVMSFINEKRIHLVSDEIYSATVFSHPSFI-
1A110_ARATH     VVLDRAFYQAKKXXXXXXXXXXSNPSNPMGSLLSRENLYALLDFARERNIHIISNEIFAGSVHGEEGEFV
HIS8_COREF      DAALAAIEEHVP---DI--IFVTTPNNPTGDITSLADIEKIINAAPG---IVIVDEAYAEFSPSPTLITR
DAPAT_PROMP     NKFQPEIPKKK-----VDIVYLCFPNNPTGATITKQELKKWVDYAIENKSLILFDAAYEAFIQD-KNIPH
DAPAT_BACV8     D-------------RRIDILYLCYPNNPTGTVISKAELKKWVNYALENDTLILYDAAYEAYIQDP-DIPH
PATR_PROAC      DAMADAITDRT------RVIFLCTPNNPTGTVLHTDEVVEFLARVPE-NVVVVMDEAYCHFNRDDAAVDG
HIS8_LEUCK      DAMFDAVDEHTTM------VWLANPNNPTGVFETRSDILSFLQKLPQ-SVVLVVDEAYYDFVDQIDATVI
DAPAT_PROMS     NNFLPELPEKKVD------ILYLCPNNPTGATINKEELKKWVDYALQNKSLILFDAAYEAFIQD-NDIPH
HIS8_RHOPT      DAMLAAVTP------NTKLVWLANPNNPTGTYIPFDEVKRL-RAGLPSHVVLVLDAAYADYVMKNDYELG
HIS8_RHOPA      DAMLAAVTP------NTKLVWLANPNNPTGTYIPFDEVKRL-RAGLPSHVVLVLDAAYADYVMKNDYELG
HIS8_MYCS2      DVAVSAVTE-----RKPDVVFVTSPNNPSGQSVPLDDLRRVLDAMQ--GGILIVDEAYGEFSSQPSAV--
DAPAT_GEOBB     CTEENGFFPAYPKEK-VDMIYLCFPNNPTGAVATKAQLKGWVDYALANDSIILFDAAYEAFITDP-SIPH
HIS8_THEPX      DSFIKVIEKYQP-----KLVFLCNPNNPTGSVIER---EDIIKIIQKSNGIVVVDEAYFEFYGN--TIVD
HIS8_DINSH      DAILAGVTDRT------RLVFIANPNNPTGTMIGGNALARLADGLPEGCLLVL-DGAYAEYV--PDYDAG
DAPAT_METTH     NSFIPSLPEER-----VDLIYLCYPNNPTGTTLTEKQLAEWVDYARDSGSLILFDAAYEAYIQE-DGIPH
DAPAT_CYAP7     MTANNNFTP-ELPSQKVDLIYLCFPNNPTGATATKENLTKWVNYAKENGSIIFFDAAYEAFITDP-SLPH
PATR_MYCS2      DAMLAAITDRT------RLIFVCNPNNPTSTVVDPGELARFV-AAVPPHILVVLDEAYVEYIRDGLLPDS
PATR_MYCBT      -AMLAAVTDRT------RLIFVCNPNNPTSTVVGPDALARFVE-AVPAHILIAIDEAYVEYIRDGMRPDS
PATR_MYCBP      -AMLAAVTDRT------RLIFVCNPNNPTSTVVGPDALARFVE-AVPAHILIAIDEAYVEYIRDGMRPDS
PATR_MYCBO      -AMLAAVTDRT------RLIFVCNPNNPTSTVVGPDALARFVE-AVPAHILIAIDEAYVEYIRDGMRPDS
HIS8_HALMA      DDFAQTADTVLKDYDGERIVYLTSPHNPTGAEFTTDAVRTIAEETDEQTLVVV-DEAYGEFTEKPS---K
1A1L1_BOVIN     EKLEMALQGANSEGVKVKGLILINPQNPLGDIYSPGELQEYLEFAKRHELHVMVDEVYMLSVFEESAGYR
HIS8_HALLT      DGFAQDAETVLSAYGGERIVYLTSPHNPSGSVMPLDEVRAIADATAEETLVVV-DEAYGEFAEVDSAI--
DAPAT_PROM9     NNFLPELPQKKVD------ILYLCPNNPTGATITKEELKKWVDYALQNKSLILFDAAYEAFIQD-NDIPH
DAPAT_CYAP8     NAENNFIAEIPSQKVDI--IYLCFPNNPTGATATKDYLKNWVDYAKANGSIIFFDAAYEAFITD-SSLPH
1A18_ARATH      VALEEAYEQAQKLNLKVKGVLITNPSNPLGTTTTRTELNHLLDFISRKKIHLISDEIYSGTVFTNPGFI-
HIS8_THEP3      DSFIKVIEKYQP-----KLVFLCNPNNPTGSVIER---EDIIKIIQKSNGIVVVDEAYFEFYGN--TIVD
DAPAT_DESPS     NFVPELPTEK------VDLIYLCFPNNPTGSTITKAGLKRWVDYAIENKALILFDAAYEAFIQDDTLPKS
HIS8_RHOP2      DAILSKVTP------NTKLVWLANPNNPTGTYIPFDEVKRL-RAGLPSHVVLVLDAAYADYVSKNDYEIG
HIS8_MYCLE      EAAVTAV-----ADRKPDVVFIASPNNPSGQSISLADLRRLLDVVPG---ILIVDEAYGEFSSRPSAVA-
HIS8_MYCLB      EAAVTAV-----ADRKPDVVFIASPNNPSGQSISLADLRRLLDVVPG---ILIVDEAYGEFSSRPSAVA-
HIS8_BEII9      DAILAAVTPRT------RIVYIANPNNPTGTYLPFAEVKRLA-TSLPPNVLLVLDAAYGEYVTRNDYSAG
HIS8_BACHD      DGMLEVIDE------NTRIVWVCNPNNPTGTYVSAEAFQSFLAKVPE-DVLVVSDEAYVEYVTADDYPDT
DAPAT_PROMT     -INSENGFEASIPKDKFDLIYLCFPNNPTGAVATKEQLVSWVKYAKENNSLILFDAAYEAFIKD-ESIPH
DAPAT_PROM1     -INSENGFEASIPKDKFDLIYLCFPNNPTGAVATKEQLVSWVKYAKENNSLILFDAAYEAFIKD-ESIPH
YDT4_SCHPO      DMLRNAITEKT------KMIVINTPHNPLGKIFSEEELNEIADLVLKHNLLVVSDEVYDRLSFVPFVRL-
PATR_MYCTU      -AMLATVTDRT------RLIFVCNPNNPTSTVVGPDALARFVE-AVPAHILIAIDEAYVEYIRDGMRPDS
PATR_MYCTA      -AMLATVTDRT------RLIFVCNPNNPTSTVVGPDALARFVE-AVPAHILIAIDEAYVEYIRDGMRPDS
PATR_MYCPA      DAMLAAITDRT------RLIFVCNPNNPTSTVVDPDALVRFVD-AVPADILIAIDEAYVEYIRDGLLPNS
PATR_MYCA1      DAMLAAITDRT------RLIFVCNPNNPTSTVVDPDALVRFVD-AVPADILIAIDEAYVEYIRDGLLPNS
HIS8_NITWN      DAILERVTPKT------KMVWLANPNNPTGTYLPFDEIRRL-RAGLPPHVLLVLDGAYSDYVSRNDYEFG
DAPAT_PARD8     -----------LPSRRVDILYLCYPNNPTGTTLTKDELKKWVNYALANDVLIMYDSAYEAYIQDP-NIPH
HIS8_SPHAL      DALLAAVTDRT------RVVYLANPNNPTGTLATREEVGRLYAGLPQNVLFVIDQAYAEYLTPDEDDGGL
HIS8_MARMM      DYRSDVDAILEAAGDDTRIVFLANPNNPTGTYISAAEVRRLRDGLPASTLLVL-DAAYAEFVDNPD--YE
HIS8_BREBN      EAMAAAINEQTK-------VVWVCPNNPSGTIVTTSELEAFMKKTPK-DVLVVLDEAYYEYVVDPEYPQT
HIS8_ANOFW      EAMLEAIDD------HTRVVWICSPNNPTGTYVNDASLRALNKVPQH--VLVVVDEAYYEYVEDYPNTVS
DAPAT_GEOSM     CTEENGFFPAYPKEK-VDMIYLCFPNNPTGAVATKEQLKGWVDYALANDSIILFDAAYEAFITDP-SIPH
1A12_CUCMA      -ALEQAYKDAQTRNLRVKGVLVTNPSNPLGTTMNRDELNLVFDFITSKGIHLISDEIYSGTVFGSPGFVS
PATR_RHOSR      DAMLAAITDRT------RLIFVCNPNNPTGTALTKAELERFLD-AVPADVLVALDEAYFEYNRSDADGIE
HIS8_RHOOB      XXXXXXXXERRP-----DVVFVTSPNNPTGHSVGIAELRRVLDSAPG---IVIVDEAYAEFSDAPSAL--
HIS8_PARDP      DALIAGATPRT------RLIFVANPNNPTGTMVGLPELERLARAVPQAILVV--DAAYAEYVGD------
DAPAT_CHLMU     CLQENDFLPVFPENTHIDILCLCSPNNPTGTALNKNQLRAIVRYAIEHNILILFDAAYSAFISAP-SLPK
ALAT_YEAST      DEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQE----------
HIS82_NITMU     DAMLDAVAP------ETRVVFIANPNNPTGTLLPADDVLRFLERVSP-DVLVVLDEAYNEYL--PPALKG
HIS81_ARCFU     ESIFDAITQKT------KIILICNPNNPTGNAED---AKLIEELVNSTNALIFLDEAY---------VEF
1A111_ARATH     DALEDAYERALKHNLNVKGVLITNPSNPLGTSTTREELDLLLTFTSTKKIHMVSDEIYSGTVFDSPEFT-
YJIR_ECOLI      -ALELALEQWPIKGI---ILVPNC-NNPLGFIMPDARKRAVLSLAQRHDIVIFEDDVYGELATEPRT-IH
HIS8_ZYMMO      DALLKAVTPRT------RVVFIANPNNPTGTWITRAEVEKLHNGLPRNCLLVI-DQAYAEYLDPECDDGA
HIS8_HALSA      EMTADAVVDAYDGER---VVYLTTPHNPTG---ARFTLDEIVAVADDEDTLVLVDEAYGEFTETPSAVTH
HIS8_HALS3      EMTADAVVDAYDGER---VVYLTTPHNPTG---ARFTLDEIVAVADDEDTLVLVDEAYGEFTETPSAVTH
HIS8_AERHH      PAIADRLS-------DVKLVFLCSPNNPTGDLVGRDGLIALLEKARDRAIVVV-DEAYIEFCPE-ASVVD
DAPAT_BACFR     PCTAENHFIPAIPEKRIDIVYLCYPNNPTGTTLTKAELKKWVDYALANDTLILFDAAYEAYIREP-DIPH
DAPAT_BACFN     PCTAENHFIPAIPEKRIDIVYLCYPNNPTGTTLTKAELKKWVDYALANDTLILFDAAYEAYIREP-DIPH
COBD_THETN      AKVISKIEEADG-------LILGNPNNPTGQGIIREEIGILLKKAELMNIPVLIDEAFIEFMKDYKKYEA
1A1C_MALDO      -ALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSFI-
HIS8_SILST      DALLAGCTA------QTKLVFIANPNNPTGTMISEAEVARLADGIPE-DAILVLDGAYAEYVEGFDAGAQ
HIS8_ROSDO      DAIIDRLTPAT------RLVYIANPANPTGTAIGLEALRRLAQSVPPTSLLVL-DGAYAEFFEGYDGGAS
HIS8_NOVAD      DALLACVTERT------RVVFLANPNNPTGSWLPREEVARL-HAGLRSDILLVLDGAYAEYLDPANDDGA
HIS82_NITEU     EAMLAAVTP------ETRIIFIANPNNPTGTLCARDLLRFMERVPQ--DVLVILDEAYDEYLPEANKANS
DAPAT_PROM0     NNFLPELPEKKVD------ILYLCPNNPTGATINKADLKKWVDYALQNKSLILFDAAYEAFIQD-DNIPH
CBL_MYCTU       DALQEAFXXXXXXXXXXXAYLLCNPHNPTGSVHTADELRGIAERAQRFGVRVVSDEIHAPLI--------
CBL_MYCBO       DALQEAFXXXXXXXXXXXAYLLCNPHNPTGSVHTADELRGIAERAQRFGVRVVSDEIHAPLI--------
HIS8_STRMK      --LDAVIDTARA--RNAKLVFLCAPSNPAGSDIALDEVERVA-VALRGQALVVVDEAYVEYAQRPTTLLV
HIS8_ROSCS      FXXXXXXXXXXXXXXXXKLLFLAAPNNPTGTPLARTTVERLL----DLPIILAIDEAYAEFA---GTSVI
HIS8_NITHX      DAILQRVTPKT------KMVWLANPNNPTGTYLPFDEIKRL-HGGLPPHVLLVLDAAYSDYVSRNDYELG
HIS8_HALWD      --FQQRASDILTQYDDERLLYVTTPHNPSGSELPIPEITALAEGVDDQTLIVI-DEAYGEYSNNPSAIIQ
HIS81_RALEJ     DAMAAAITS------DTRLVFIANPNNPTGTFVPAAALETLAKVPAE--VVVVLDEAYNEYLDDDQQYDS
DAPAT_LAWIP     D------------------IIYLCPNNPTGTVLSKDQLTIWVNYAKKEGAIILFDAAYEAYITDP-TIPH
DAPAT_DESHD     PCTEEGDMKPELPTAPVDMIYLCFPNNPTGMTLTKEELKVWVDYARENKAIILFDSAYEAFIREPRSIYE
HIS8_METTH      RLDLESVLDA--VDESTRLVFLCTPNNPTGGLIDKKDIR---AVLESTDTLVVVDEAYTEFAGVDNT---
HIS8_CALS8      EEFSKHINER------TRVIWICNPNNPTGTIVKKDELYNFIKSVPS-EIAVVVDQAYKEYIDDPPDAIH
HIS8_BACCN      DAMLEQVDY------NTRIVWVCNPNNPTGTYVEKQKLLSFLENVPKSSLVIMDXXXXXXXXXXPQTL--
HIS8_AERS4      PAIADRLS-------DVKLVFLCSPNNPTGDLVGRDGLIALLEKARNRAIIVV-DEAYIEFC-PKASVVD
DAPAT_PELCD     NGFTPAIPKEKVD------IIYLCPNNPTGTVATKEVLKAWVDYALANDAVIFFDAAYEAFITEP-GIPH
DAPAT_LEPBP     PATEENNFEPDFPKEKADIIYLCYPNNPTGMVATKARLTEWVNYAKKMGSIILYDSAYESFIQDPKSIYE
DAPAT_LEPBA     PATEENNFEPDFPKEKADIIYLCYPNNPTGMVATKARLTEWVNYAKKMGSIILYDSAYESFIQDPKSIYE
DAPAT_DESHY     PCTEEGDMKPELPTAPVDMIYLCFPNNPTGMTLTKEELKVWVDYARENKAIILFDSAYEAFIREPRSIYE
1A14_ARATH      -ALEEAYEQAKKLDLNVKGILITNPSNPLGTTTTQTELNILFDITKNKNIHLVSDEIYSGTVFNSSEFI-
YDFD_BACSU      VHLTR--------GERGRAILYTCFHNPTGILMSKKRREEILAVSENTQLPIIEDDIYRELWIDEIPPYP
HIS8_PROA2      DAIIARTNQERAG-----FVVLSTPNNPTSQSLRLDDVRRIVSGVEALVLV---DEAYVEFSREESALTL
HIS8_MYCTU      FGLXXXXXXXXXXXRKPDVVFIASPNNPSGQSVSLPDLCKLLDVAPGIAIV---DEAYGEFSSQPSAV--
HIS8_MYCTA      FGLXXXXXXXXXXXRKPDVVFIASPNNPSGQSVSLPDLCKLLDVAPGIAIV---DEAYGEFSSQPSAV--
HIS8_MYCBT      FGLXXXXXXXXXXXRKPDVVFIASPNNPSGQSVSLPDLCKLLDVAPGIAIV---DEAYGEFSSQPSAV--
HIS8_MYCBP      FGLXXXXXXXXXXXRKPDVVFIASPNNPSGQSVSLPDLCKLLDVAPGIAIV---DEAYGEFSSQPSAV--
HIS8_MYCBO      FGLXXXXXXXXXXXRKPDVVFIASPNNPSGQSVSLPDLCKLLDVAPGIAIV---DEAYGEFSSQPSAV--
HIS8_ANADF      DALRKLLS------RRTKLVFLANPDNPTGTWFTEAELTPFLDAVPK-DTLVVLDEAYVEYVDAPGFQDG
1A11_ORYSJ      PALDDAYRRAQKRRLRVKGVLITNPSNPLGTASPRADLETIVDFVAAKGIHLISDEIYAG-----TAFAE
1A11_ORYSI      PALDDAYRRAQKRRLRVKGVLITNPSNPLGTASPRADLETIVDFVAAKGIHLISDEIYAG-----TAFAE
HIS8_STRAW      AAARQAIAESRPD-----VVFITTPNNPTGTAVPPETVLALYEAAQAVPSMVVVDEAYIEFSH-------
HIS8_RHISN      ELLFGPAKQAKF-------ILLANPNNPTGTFVPIADIESLVALSDQL---VVLDEAYVDFAPDSARLVN
HIS8_NOCFA      FSLDIDHAVATIAERRPDVVFVTSPNNPTGHSIPGADLARILDAAPG---IVVVDEAYAEFSAQPSAI--
HIS8_BRUSU      DAILAGVT-ART-----KIVFIANPANPTGTYLPFEEVRRL-HAGLPQHVLLVLDAAYAEYVRRNDYEAG
HIS8_BRUO2      DAILAGVT-ART-----KIVFIANPANPTGTYLPFEEVRRL-HAGLPQHVLLVLDAAYAEYVRRNDYEAG
HIS8_BRUAB      DAILAGVT-ART-----KIVFIANPANPTGTYLPFEEVRRL-HAGLPQHVLLVLDAAYAEYVRRNDYEAG
HIS8_BRUA2      DAILAGVT-ART-----KIVFIANPANPTGTYLPFEEVRRL-HAGLPQHVLLVLDAAYAEYVRRNDYEAG
HIS8_AKKM8      DGFLAAITE------NTRVVFITNPTNPVGTVVGQQEIDDFMAKVPE-HVLVVFDEAYREFSDNPPDTLK
PATR_MYCUA      EAMLAAVTERT------RLIIVCDPNNPTSTVVQPEALAEFVRSVPPHILVAI-DEAYVEYLRDGTVPDS
PATR_MYCMM      EAMLAAVTERT------RLIIVCNPNNPTSTVVQPEALAEFVRSVPPHILVAI-DEAYVEYLRDGTVPDS
PATR_CORJK      SGRHDLKAMSEAIGERTRLVFVCNPNNPTGTTVSRDEFREFMG-RVPADVTVVLDEAYVEYNRDAESPV-
HIS8_TOBAC      ERIAEVVEHEKP-----KCIFLTSPNNPDGSIVDDETLLKIL----DLPILVILDEAYVEF-----SGME
HIS8_RHOS5      DAILAACTP------HTRLVFLANPNNPTGTMIGQADLARLAE-GLPPQAILVLDGAYAEYV--------
HIS8_GEOKA      EAMLAVIDE------NTRIVWICNPNNPTGTYVNDTELRAFLDRVPRHVLVVV-DEAYYEYATAPDYPQT
HIS8_GEOBB      EGIPEHY--------DGKLFFLTNPNAPLGFTYSQ---RYIADLAGRLSGVLVVDEAYVDFAEE--TSLE
HIS81_RHIME     DAILAAVTERT------KIVFIANPANPTGTYIPVEEVRRL-HAGLPAGVLLVLDAAYAEYVRRNDYEAG
DAPAT_BACTN     PCTSENDFIPEIPDKRIDIVYLCYPNNPTGTTLTKPELKKWVDYALANDTLILFDAAYEAYIQD-ADVPH
DAPAT_AZOPC     ------------FPRKTADVIYLCPNNPTGIALNAAQLKNWVDYALTNKSLILFDAAYEAYI-SQQDVPH
HIS8_YERE8      ---------IKASLDRVKLIYICSPNNPTGNLINPADLRAVLELAQGRAIVAI-DEAYIEFC--PQASVS
HIS8_STRCO      PAATRAIDEHRPD-----VVFITTPNNPTGTAVPAETVLALYEAAQAAPSMVVVDEAYIEFSH-------
HIS8_NICPL      ERIAEVVEHEKP-----KCIFLTSPNNPDGSIIDDETLLKIL----DLPILVILDEAYVEF-----SGME
HIS8_GEOSM      EGIPEHY--------DGKLFFLTNPNAPLGFTYSQ---RYIADLAGRLSGVLVVDEAYVDFAEE--TSLD
HIS8_ACIAC      AMLA-AIAQHRPA-----ITYLAYPNNPTATLWDEGAVQRVIDAAGAQGGIVVMDEAYQPFA-SRTWLDR
HIS81_PASMU     -------IERQLTG--VKVVFVCSPNNPTGTLVNRTDLLALLEMTRNKAIVVV-DEAYIEFCPQATMV--
CBL_MYCLE       AALQDAFSRARSSGPNGKVAYLLCPHNPTGSVHTVAELHGVAELARRFGVRVISDEIHAPLV--------
1A1L1_TAKRU     DKLEEGLRRAEHEGFIVRGLVLMNPHNPLADIYTPKEMVGFLEFAKRNELHTIVDEVYMLSVFDESVTFD
1A1L1_HUMAN     EKLEMALREAHSEGVKVKGLILISPQNPLGDVYSPEELQEYLVFAKRHRLHVIVDEVYMLSVFEKSVGYR
YISV_BACSU      DEGVKAGLVSSNRKQYGGQLLYTIPSNPTGTVMSEQRRKEIISLSKKEQMPIIEDDAYGDL---------
HIS8_VIBCM      ----------------VKLVFVCSPNNPTGNLVKRADIIKLLEMTQDRAIVVM-DEAYIDFCPEAST-VD
HIS8_VIBCH      ----------------VKLVFVCSPNNPTGNLVKRADIIKLLEMTQDRAIVVM-DEAYIDFCPEAST-VD
HIS8_VIBC3      ----------------VKLVFVCSPNNPTGNLVKRADIIKLLEMTQDRAIVVM-DEAYIDFCPEAST-VD
HIS8_THEGJ      EAVAEKAKNARV-------VFIASPNNPTGNLQPEEEIIRVLETRRP----VVLDEAYAEFVGKS---LW
HIS8_RHOP5      DAILAKVSP------NTKLVWLANPNNPTGTYIPFDEVRRLRAGLPE-HVVLVLDGAYADYVAKNDYETG
HIS8_NATPD      -----------------RIVYLTSPHNPTGSEVSLSDVEAVAEGTDEETLVVV-DEAYGEFADSPSAV--
HIS8_METFL      DAMLAAIT-------DKTRLFIANPNNPTGTLLSKPALRDFLAKVPRQVLVVLDEAYDEYLAAELKSEAF
HIS8_RHOPB      DAILAKVSPST------KLVWLANPNNPTGTYVPFDEVKRLRAGLPE-HVILVLDGAYADYVGKNDYESG
HIS8_PHOPR      ----------------VKLVFVCSPNNPTGNVMNRRDIEKLLDMTTDKALVVI-DEAYIDFCLE-TSTVD
HIS8_METVS      ESVLNNITEKT------KAIFLCTPNNPTGNVISNEDIKKIIE---STDALIMIDHAYIEYSKKEYDLTQ
HIS8_DEHE1      -----------ALTPKTKLIFIAAPNNPTGTAISKEDIRQIL----DLGVPTVIDEAYYEFT-GQTMVTD
HIS8_BDEBA      --------------KNIRLIFVSNPNNPTGTYATKAEVEALQKVGNRDDVMIIFDEAYNEFVRAKDYASA
HIS83_BURS3     --LNQALDSIRAHQPGV--VLLTSPNNPTGTALPIDDIRAILDAAPG---VVVVDEAYAEFRRHPSAVTL
HIS81_HAEI8     DDFQLNLPEIKNHLNDVKVVFVCSPNNPTGNLLKQSDILDLLQITAGKAIVVV-DEAYIEFC--PEASVI
1A1L2_MOUSE     DXXXXXXXXXXXXXXXXXXXXXINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEPSVTFH
HIS8_RHOSK      DAILAACTP------HTRLVFLANPNNPTGTMIGQADLARLA-AGLPAQAILVLDGAYAEYV--------
HIS8_RHOS4      DAILAACTP------HTRLVFLANPNNPTGTMIGQADLARLA-AGLPAQAILVLDGAYAEYV--------
HIS8_RHOS1      DAILAACTP------HTRLVFLANPNNPTGTMIGQADLARLA-AGLPAQAILVLDGAYAEYV--------
HIS8_PECCP      --------ESIEAQLDGTKVIYVCPNNPTGNLIAREDLRQLLTMAQGNALVVI-DEAYIEFCPQATTAVW
HIS8_ARATH      DRIAEVVELEKP-----KCIFLTSPNNPDGSIISEDDLLKIL----EMPILVVLDEAYIEF-----SGVE
HIS82_RHILO     DAMLAAVTPRT------KIVFLANPNNPTGTYVPFQEVRRL-HAGLPRHVLLVLDAAYAEYVRRNDYEAG
1A1L1_MOUSE     EMVLQGVS---SEGVKVKGLILINPQNPLGDVYSPEELQDFLRFAMRHKLHVIMDEVYMLSVFEESLGYR
YEY2_YEAST      HSTTEMIQGPKLTKKVYRYVMYCIPTNPSGNTYSLETRRRLIDIARKYDMLIITDDVYDELPSPPLRMVH
HIS8_VIBFM      -----------ASLENVKVVFVCSPNNPTGNIVDRKDILSLLEMTKDRAIVVM-DEAYIDFCMEKST-VD
HIS8_METMP      ESVLNNITEKT------KAIFLCTPNNPTGNVIPTEDIKKIVE---STDALVMIDHAYIEYSKEEYDLTS
HIS8_HAEIG      DDFQLNLPEIKNHLNDVKVVFVCSPNNPTGNLLKQSDILDLLQITAGKAIVVV-DEAYIEFC--PEASVI
HIS8_BRUME      DAILAGVT-ART-----KIVFIANPANPTGTYLPFEEVRRL-HAGLPQHVLLVLDAAYAEYVRRNDYEAG
HIS83_RHILO     LLFGPA--------KDAKFILLANPNNPTGTFVPVADIERL---VAKSDRLIVLDEAYVD----------
HIS82_THIDA     DAFEIRVDDYLAPKG---GVIFPNPNAPTGRLLALGEIERL--LAANRDSVVVIDEAYVDFGGDSAV---
HIS82_CARHZ     EHRLDLKTMAEAVNEKTRLVYLCNPNNPTGTYITKG----------------------------------
HIS81_HAEIN     DDFQLNLPEIKNHLNDVKVVFVCSPNNPTGNLLKQSDILDLLQITAGKAIVVV-DEAYIEFC--PEASVI
HIS8_MYCSS      DT---AVREIAARRPDL--VFVTSPNNPSGQSVPLEDLRRLLD-AMETGILIL-DEAYGEFSSQPSGV--
HIS8_MYCSM      DVAVSAVTE-----RKPDVVFVTSPNNPSGQSVPLDDLRRVLDAMQ--GGILIVDEAYGEFSSQPSAV--
HIS8_MYCSK      DT---AVREIAARRPDL--VFVTSPNNPSGQSVPLEDLRRLLD-AMETGILIL-DEAYGEFSSQPSGV--
HIS8_MYCSJ      DT---AVREIAARRPDL--VFVTSPNNPSGQSVPLEDLRRLLD-AMETGILIL-DEAYGEFSSQPSGV--
HIS8_METM5      ESVLNNITEKT------KVIFLCTPNNPTGNVIPTEDIKKIVE---STDALVMIDHAYIEYSKGEYDLTN
HIS8_GLUDA      DAMRIDVDDYR---RPCAGLVLPNPNAPTGIALGLGQIETLLRA--QPDRVVVIDEAYVDFGAD--TAIP
HIS8_GEOUR      WKLANFPERY-----DGKIFFLTNPNAPYGFTFSREFIE---ELAGRVAGMLVVDETYADFAGD--TALD
HIS82_BRAJA     DAILKAVTPKT------KLVWLANPNNPTGTYIPFDEVKRL-RAGLPSHVLLVLDAAYCDYVSRNDYEMG
1A19_ARATH      ----------------VKGVLVTNPSNPLGTMLTRRELNLLVDFITSKNIHLISDEIYSGTVFDVLKDKN
PATR_RHOOB      DAMAAAVTDRT------RLIFVCTPNNPTGPALSTSELERFLDAVPD-RVVVALDEAYFEYNRSGTDGLD
HIS8_XANP2      DAILALVTPRT------RLVFLANPNNPTGTYLPFDEVRRL-HAGLPANVLLVLDAAYAEYVRRNDYETG
HIS8_ROSS1      DQFDVDIXXXXXXXXXXKLLFLAAPNNPTGTPLARSDVERLL----DLPIILAIDEAYAEFA---GTSVV
HIS8_HELHP      FFQLYQSEKER---KHISAVFLCAPNNPLGECLDAAAIEQFIQ-AVDKDTLVIVDGAYQEFAKDKAKAIN
HIS8_HAEIE      DDFQLNLPEIKNHLNDVKVVFVCSPNNPTGNLLKQSDILDLLQITAGKAIVVV-DEAYIEFC--PEASVI
HIS8_COLP3      EAQCQLDLEGLKQQVGKAKVVFLCPGNPTGNTLSSAQIKAAIEIFKDSAMVVV-DEAYYEYTNKEAEQVN
HIS8_BLOPB      ENWQLDLASIKSQLNNVKLIYICNPNNPTGNIIHLNSLKKLLKIIQNRAL-LVTDEAYIDFCPDASLVRW
HIS8_VIBF1      -----------ASLENVKVVFVCSPNNPTGNIVDRKDILSLLEMTKDRAIVVM-DEAYIDFCMEKSTV--
HIS8_SHEON      ---ADFATAARGA----KLVFICNPNNPTGTVIDKA---RIEQAIQALDSIVVVDEAYIEFC--PEYSVA
HIS8_POLNA      FELDEAAMLAAIAEHKPSITYLAYPNNPTANLWDDAVIENIINAVGEQGGLVVIDEAYQ-----------
HIS8_LYSSC      EAMAAAID-------DQTAVIWVCPNNPTGVVIPDTALRAFLAKVPN-DVLVVLDEAYIEYVTHPEHKDT
HIS8_GEOTN      EAMLKEIDE------NTRIVWVCNPNNPTGTYVNETELRAFLDRVPSHVLVVLDEAYYEYVTADPQTV--
HIS8_DEHSB      XXXXXTP--------QTKLIFIAAPNNPTGTAISKEEIRQIL----DLGVPTVVDEAYYEFTGQ--TMVS
HIS8_BAUCH      ----------------VKLIYICHPNNPTGNIINPSDIRQLLDITHGRTILVV-DEAYIDFY--PTASIS
HIS8_ALISL      ---------------NVKLVFVCSPNNPTGNVINRKDILSLLEMTKDRAIVVM-DEAYIDFCMEVSTV--
HIS82_OCEIH     DKMLGSID-------DHTAIVWLCPNNPTGAAFSKEELITFLDNCPK-EVLVVLDEAYYEYLHSDKDLDA
HIS81_BURS3     DAMLAAIAEHRPA-----IVYLAYPNNPTGTLYDDADIERIVAAARH--SLIVIDEAYQPFA--VRSWLP
HIS8_MYCVP      FGLDAAVAATAIKEHTPDVVFVTSPNNPSGSVSXXXXXXXXXXXXXXXGGVMIVDEAYGEFSSQPSAI--
HIS8_ERWCT      -----------------KVVYVCSPNNPTGNLIARDDLRQLLTLAQGKALVVI-DEAYIEFCPQASTASW
HIS8_BACSU      DAMLEAIDE------QTQVVWICSPNNPTGTYTSEGELLAFLERVPSRVLVVLDEAYYEYVTAEPETV--
HIS8_VIBPA      ---------------NVKLVFVCSPNNPTGNLVKREDIVSLLEMTKDRAIVVM-DEAYIDFCPEAST-VD
HIS8_VIBHB      ---------------NVKLVFVCSPNNPTGNLVKREDIVSLLEMTKDRAIVVM-DEAYIDFCPEAST-VD
HIS8_RHOCS      DALLARVSERT------RIVYVANPNNPTGSYLPADALARL-HAGLPPHVLLVIDAAYAEYVTDGTALV-
HIS8_CORJK      EALA-AIDE-----RQPNVIFIXXXXXXXXXXXXLADIERILQAAPG---IVIVDEAYAEFSDEPSAV--
HIS82_MANSM     -------IEKNLAG--VKVIFVCSPNNPTGNVLNQADLIRLLDITAGSAIVVV-DEAY--IEFSPETSMI
HIS82_BACC1     DEISSAVNN------NTKIVWICNPNNPTGTYVNDRKLTQFIEGISENTLIVI-DEAYYEYVTAKDFPET
HIS8_DEHSC      XXXXXTP--------QTKLIFIAAPNNPTGTAISKEEIRQIL----DLGVPTVVDEAYYEFTGQ--TMVS
HIS8_AGRT5      DAILAAVTPKT------KMVFLANPGNPTGTYVPVAEIRRL-QAGLPKHVVLVLDAAYAEYVRKNDYEAG
YDIU_SHISS      ----------------------------------------------------------------------
YDIU_SHIBS      ----------------------------------------------------------------------
YDIU_SHIB3      ----------------------------------------------------------------------
YDIU_ESCF3      ----------------------------------------------------------------------
YDIU_ECOUT      ----------------------------------------------------------------------
YDIU_ECOSE      ----------------------------------------------------------------------
YDIU_ECOLI      ----------------------------------------------------------------------
YDIU_ECOLC      ----------------------------------------------------------------------
YDIU_ECOL6      ----------------------------------------------------------------------
YDIU_ECOL5      ----------------------------------------------------------------------
YDIU_ECOK1      ----------------------------------------------------------------------
YDIU_ECOHS      ----------------------------------------------------------------------
YDIU_ECODH      ----------------------------------------------------------------------
YDIU_ECOBW      ----------------------------------------------------------------------
YDIU_ECO81      ----------------------------------------------------------------------
YDIU_ECO5E      ----------------------------------------------------------------------
YDIU_ECO57      ----------------------------------------------------------------------
YDIU_ECO55      ----------------------------------------------------------------------
YDIU_ECO45      ----------------------------------------------------------------------
YDIU_ECO27      ----------------------------------------------------------------------
YDIU_ECO24      ----------------------------------------------------------------------
HIS8_SODGM      ----------RARLDGVKLVYICSPNNPTGNLIDLETLRAMLEMTHGRALLVV-DEAYIDFC-PQASVVN
HIS8_METM7      ESVLNNITEKT------KAIFLCTPNNPTGNVIPTEDIKKIVE---STDALVMIDHAYIEYSNEDYDLTD
HIS8_MESSB      DAILAAVTERT------KIVFLANPNNPTGTYLPMEEVKRLRSGLPRKVLLVL-DAAYAEYVRRNDYEAG
HIS8_LISIN      EGMLNAIDEK-------TTIVWICPNNPTGNYIELADIQAFLDRVPS-DVLVVLDEAYIEYV-TPQPEKH
HIS8_KLEP3      EAQLDGV----------KVVFVCSPNNPTGQIIDPQSIRDLLEMTRD-KAIVVADEAYIEFC--PQATLA
HIS8_BIFLO      DKVLEAIAEVKPS-----MVLLTSPNNPTGTPLPMEDIERILAACETAEVVLVIDEAYVEFRKPGTPSAV
1A15_ARATH      ----------------VKGVLVTNPSNPLGTALTRRELNLLVDFITSKNIHLISDEIYSGTVMDVLKDKK
YDEF_BACSU      DEMSPESLEYACKNENIKGLYLI-PDNPTTSFMSVENRRMVADIVKKYNLFVIEDASYHLLNKNPLPAL-
HIS8_RHOPS      DAILAKVSP------KTKIVWLANPNNPTGTYIPFDEVKRL-RAGLPGHVVLVLDAAYADYVSRNDYEIG
HIS8_METPP      DAAAML-----AAVREHRPALTAYPNNPTANLWDDAVIERVVDAVREHGGLVVIDEAYQ-----------
HIS8_LISMF      DGMLNAID-------DNTTIVWVCPNNPTGNYIDLADIQAFLDKVPS-DVLVVLDEAYIEYV-TPQPEKH
HIS8_LISMC      DGMLNAID-------DNTTIVWVCPNNPTGNYIDLADIQAFLDKVPS-DVLVVLDEAYIEYV-TPQPEKH
HIS8_FRASC      FTLSPAVVTDAIARHRPALVFLCSPNNPTGTALPPXXXXXXXXXXXXTGSMVVVDEAYAEFRRAPSTLTL
HIS8_ENT38      ----------------VKVVFVCSPNNPTGQIINPQDVRTLLEMTRGKALV-VADEAYIEFC--PQATLT
HIS8_DESDG      -----------AADADTAVAFITTPDNPSGYCP---PVEEIIDLARRLSCLLVVDEAYMDFADDPASVLP
HIS81_RHILO     DALIDAVRERP------RMLLFSNPMNPVGSWLSAGDLSKVLDAVSDETLIVV-----------------
HIS8_VIBVY      ----------------VKLVFVCSPNNPTGNLVKREDIIALLEMTKDRAIVVM-DEAYIDFCPEAST-VD
HIS8_VIBVU      ----------------VKLVFVCSPNNPTGNLVKREDIIALLEMTKDRAIVVM-DEAYIDFCPEAST-VD
HIS8_LISMH      DGMLNAID-------DNTTIVWVCPNNPTGNYIDLADIQAFLDKVPS-DVLVVLDEAYIEYV-TPQPEKH
HIS8_KLEP7      -------IEARLDG--VKVVFVCSPNNPTGQIIDPQSMRDLLEMTRG-KAIVVADEAYIEFC--PQATLA
HIS8_ACEPA      DDMQ--VNVADYAG-PCSGVVVANPNAPTGIALDLADVRKLLEL--QPNRVVLIDEAYVDFGAESAV---
HIS82_RALSO     DAMAAAITP------DTRLIYVANPNNPTGTFLPADAVAALAKVPP--TVVVVLDEAYNEFLYDSIAWVR
HIS81_IDILO     DGMAKAVTDKT------KMIFIANPNNPTGTFLSTSALKSFLDKIPQ-HIIVVLDEAYYEYV--------
HIS8_LISMO      EGMLNAIDEK-------TTIVWICPNNPTGNYIDLADIQAFLDKVPS-DILVVLDEAYIEYV-TPQPKKH
HIS8_CLOK5      DKLIESANVEK-----VKVLFLSNPNNPTGKVLKR---EQIFKILNGCDCAVVIDEAYVEFHEE--SIVD
HIS8_CLOK1      DKLIESANVEK-----VKVLFLSNPNNPTGKVLKR---EQIFKILNGCDCAVVIDEAYVEFHEE--SIVD
HIS8_BURM1      DAMLAAIAEHRPA-----IVYLAYPNNPTGTLYDDADIERILRAATH--SLIVIDEAYQPFAQ------H
HIS8_BACNA      DAMLEAIDE------QTQVVWICSPNNPTGTYTSEGELLAFLERVPSRVLVVLDEAYYEYVTAEPETV--
COBD_SALTY      DAILEALTP------DLDCLFLCTPNNPTGLLPERPLLQAIADRCKSLNINLILDEAFIDFIPHETGFI-
COBD_SALTI      DAILEALTP------DLDCLFLCTPNNPTGLLPERQLLQAIADRCKSLNINLILDEAFIDFIPHETGFI-
1A13_SOLLC      -ALEEAYLDAKKRNLKVKGVLVTNPSNPXXXXXXXXXXXXXXXFIDEKGIHLISDEIYSGTVFNSPGFVS
YDIU_SALTY      ----------------------------------------------------------------------
YDIU_SALSV      ----------------------------------------------------------------------
YDIU_SALPK      ----------------------------------------------------------------------
YDIU_SALPC      ----------------------------------------------------------------------
YDIU_SALPB      ----------------------------------------------------------------------
YDIU_SALPA      ----------------------------------------------------------------------
YDIU_SALNS      ----------------------------------------------------------------------
YDIU_SALHS      ----------------------------------------------------------------------
YDIU_SALEP      ----------------------------------------------------------------------
YDIU_SALDC      ----------------------------------------------------------------------
YDIU_SALAR      ----------------------------------------------------------------------
YDIU_SALA4      ----------------------------------------------------------------------
HIS8_STRM5      -ADLDAVIDT-AKSRNAKLVFLCAPSNPAGSDIALDEIERVATALRGQALVVV-DEAYVEYAQRPS----
HIS8_DIAST      -AMLDAIAQHRPA-----ITFLAYPNNPTATLWDEAVVQRIIDAAGAQGGIVVMDEAYQ-----------
HIS8_ACISJ      AMLA-AIAQHRPA-----ITFLAYPNNPTATLWDEAVVQRIIDAAGAQGGIVVMDEAYQ-----------
HIS82_NITOC     PAMLQVIRERVPA-----VVFIAYPNNPTGNLFSAEELQAIIEASPGL---VIVDEAY------------
HIS82_ARCFU     DVIAEERP---------KLVFLCSPNNPTGNSLSREIVQKVAESAE----YVVLDEAYVEFSDD--SKIE
HIS81_CAUCR     DEVIKCVDERT------RLVFIANPANPTGTWLTGEEIRAL-HAALPPSVVLVLDGAYAEFCSDPHFEDG
YDIU_SALTI      ----------------------------------------------------------------------
HIS8_SHEAM      -----------------KLVFVCNPNNPTGTLLPLGEIARVAKTFP--NALVVVDEAYIEFAHNAD---G
HIS8_PELCD      ----------RYTG---KLFFLTNPNAPLGFCYPQEFIE---ELAGRVDGMLVVDEAYADFAKENSLVRR
HIS8_METI4      -----------AIGPKTKLIFIANPNNPTGTRVSNEDLYLFLERVPD-EVIVAIDEAYIDFVPDPPQTL-
YDIU_ECOSM      ----------------------------------------------------------------------
YDIU_ECOLU      ----------------------------------------------------------------------
YDIU_ECO7I      ----------------------------------------------------------------------
HIS8_YERPY      -AIANNLEQ-------VKVIYVCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAYIEFC--PQASVS
HIS8_YERPS      -AIANNLDQ-------VKVIYVCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAYIEFC--PQASVS
HIS8_YERPP      -AIANNLEQ-------VKVIYVCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAYIEFC--PQASVS
HIS8_YERPN      -AIANNLEQ-------VKVIYVCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAYIEFC--PQASVS
HIS8_YERPG      -AIANNLEQ-------VKVIYVCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAYIEFC--PQASVS
HIS8_YERPE      -AIANNLEQ-------VKVIYVCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAYIEFC--PQASVS
HIS8_YERPB      -AIANNLDQ-------VKVIYVCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAYIEFC--PQASVS
HIS8_YERPA      -AIANNLEQ-------VKVIYVCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAYIEFC--PQASVS
HIS8_YERP3      -AIANNLEQ-------VKVIYVCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAYIEFC--PQASVS
HIS8_METJA      ESVLNNITDKT------KVIFLCTPNNPTGNIIENRDVER---VINETDALVVIDHAYIEYAKKEYDWTQ
HIS8_GEOSW      EAMLNAIDE------QTRVVWICNPNNPTGTYVNEQELTSFLERVPSHVLAVLDEAYYEYATANPQTV--
HIS8_GEOSL      DDLRIAGFPGRYEGK---LFFLTTPNSPLGFAFPLAYIE---ELATRCAGVLVVDEAYADFADDALDLVR
HIS8_BACLD      DAMLKAIDE------QTKVVWVCSPNNPTGTYESGRNLIRFLEKVPEHVLAVVDEAYYEYVTAEDYPETI
HIS82_METCA     ---------------DTRVVFIANPNNPTGTLLGRGELYSFLAALPE-HVIAVVDEAYFEYARRPD---H
HIS82_HAEIN     QGFLTALSDKT------KLIYIANPNNPTGNFLTSQEIEDLAEVPE--NVIVVLDEAYTEFTRSEERVDS
HIS82_BACAN     DEISSVVDN------DTKIVWICNPNNPTGTYVNDRKLTQFIEGISENTLIVI-DEAYYEYVTAKDFPET
CR3L3_BOVIN     PAGCHSVESGKGPCPSYHPG-PTCPARHLGPVAPR------LETSVAIDLEMWSPGVYAE---EQTDLAD
HIS8_HALVO      DDFEQTADLVLDAYDGERMVYLTTPHNPTGSVLPRXXXXXXXXXXXXHTLLVV-DEAYGEFAEEP-SAID
HIS82_PSYA2     --------------RPCSGIIIANPNAPTGLLLSLADIRKL--AGEHSDSVIVIDEAYIDFAESQMSAIS
HIS82_PASMU     DGFLQAISDKT------KLIYLANPNNPTGTFLSAGEISQLNQVPAH--VIVVLDEAYTEFTLPEERVDS


                         .         .         .         +         .         .         .:280
query           SPAEFAPERTVITTGLSKNLALGGWRIGVARLPDSDTGRHIHAALLGIASEIWSSPSGPVQRAAAYAFQE
AAT_THEAQ       SPGTLAPEHTITVNGAAKAFAMTGWRIGYACGP-----KAVIKAMADVSSQSTTSPDTIAQWATLEALTN
AAT_THET8       SPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGP-----KEVIKAMASVSSQSTTSPDTIAQWATLEALTN
AAT_BACY2       QISEEVKAQTIVINGVSKSHSMTGWRIGYAA-----GNADIINAMTDLASHSTSNPTTASQYAAIEAYNG
AAT1_BACSU      QLSDRLKEQTVIINGVSKSHSMTGWRIGYAA-----GSEDIIKAMTNLASHSTSNPTSIAQYGAIAAYNG
AAT_AQUAE       SPASFSDEVKNITNAFSKSYSMTGWRIGYVACPE-----EYAKVIASLNSQSVSNVTTFAQYGALEALKN
AAT_BACST       SIAELSPEQTVIINGVSKSHSMTGWRIGYAAGP-----KDIIKAMTDLASHSTSNPTXXXXXXXXXXXXG
AATA_RHIME      TPVEVEPERTLTMNGVSKAYAMTGWRIGYAAGP-----LHLIKAMDMIQGQQTSGAASIAQWAAVEALNG
AAT_SYNY3       IGADEIFQRTIISNGFAKSYSMTGWRVGAGELP-------LIQACSTIQGHSTSNVCTFAQYGAIAALEN
AAT_PYRHO       YPIKFAPENTILANSFSKTFAMTGWRLGFVVAPSQKEMTKLHAYVIGVASALRSEESWKAVEEMKKEYNE
AAT_PYRAB       LDGMF--ERTITVNGFSKTFAMTGWRLGFVAAPSWIIEKMVKFQMYNA-----TCPVTFIQYAAAKALRD
AAT_RHILP       TPVEVEPDRTLTMNGVSKAYAMTGWRIGYAAGP-----IQLIKAMDMIQGQQTSGATSIAQWAAVEALNG
AATB1_RHIME     TPAQLEPNRTLTVNGVSKAYAMTGWRIGYAGGP-----RELIKAMAVVQSQATSCPSSISQAASVAALNG
AAT_SULSO       STLEDSDWRLIYVNGFSKTFSMTGWRLGVAK-------REIIQKMGILAANVYTAPTSFVQKAAVKAFDT
AAT_STRVG       LPVPALRDKCIIVNGVAKTYAMTGWRVGWVIAP-----QDVIKAATNLQSHATSNVSNVAQVAALAAVSG
AAT_SULTO       DPD--WRDYVIYVNGFSKTFSMTGWRLGYVVAKEK-----VIKKMAEIAANIYTCPTSFAQKGALAAFES
AATB2_RHIME     TPARLEPDRTLTVNGVSKAYAMTGWRIGYAGGP-----RALIKAMAVVQSQATSCPXXXXXXXXXXXLNG
AAT_MYCTU       SLASIAPDMLCLTNGLSKAYRVAGYRAGWLAI----TGPKEHASSIGLLANMRLCPNVPAQHAIQVALGG
AAT_MYCBO       SLASIAPDMLCLTNGLSKAYRVAGYRAGWLAI----TGPKEHASSIGLLANMRLCPNVPAQHAIQVALGG
AAT_THEMA       DVSE-GFDRIVYINGFSKSHSMTGWRVG------------------------------------------
AAT1_METJA      SPMQFT-DRCILINGFSKTYAMTGWRIGYLAVSDENKELDLINNMIKIHQYSFACATTFAQYGALAALRG
AAT_RICCN       TLAQIAPDRIFTVNGVSKAYSMTGWRIGYGA-----GSKTLIKAMTIIQSQSTSNPCSISQMAAIEALNG
AAT_RICFE       TLAQIAPERIFTVNGVSKAYSMTGWRIGY-----GVGSKALIKAMTIIQSQSTSNPCSISQMAAIESLNG
AAT_RICBR       TLAEIAPDRIFTVNGVSKAYSMTGWRIGYGA-----GSKALIKAMTIIQSQSTSNPCSISQVAAVEALNG
AAT_SULAC       DPD--WKNFSIYVNGFSKTFSMTGWRLGYVVAKE-----NVIKKMSEIAANVYTCPTSFAQKAAVSAFDT
DAPAT_NATTJ     VPG--AKEVAIEFNSLSKTFNMTGWRVGFV-----VGNEKAISALAKYKTNVDSGVFTPLQLAATHALEN
AAT_RICTY       TLAQIAPERIFTVNGVSKAYSMTGWRIGYGA-----GSKALIKAMTVIQSQSTSNPCSISQMAAIEALNG
AAT_RICPR       TLAQIAPERIFTVNGVSKAYSMTGWRIGYGA-----GSKALIKAMTIIQSQSTSNPCSISQMAAIEALNG
AAT_PYRKO       -PARELYENVVTVKGFSKLYSMTGFRLGYA-IGERNEIRRIQRF---IESTVTCVPPF-VQRAGVKALEL
DAPT2_ANAVT     IPG--AKDIAIEFHSLSKSYNMTGWRIGFA-----VGNAYAIQGLSQVKTNVDSGVFKAIQKAAIAAYEV
DAPAT_MOOTA     APG--AKEVGIEFNSVSKPYNMTGWRLGWA------CGRDVIEALARIKSNIDSGAFQAVQYAGIAALTG
DAPT2_ANASP     IPG--AKDIAIEFHSLSKSYNMTGWRIGFA-VGNAYAIKGLSQVKTNVDSGVF-XXXXXXXXXXXXTDEV
DAPAT_SYNFM     LPG--AGEVGVEFHSLSKTYNMTGWRLGFA-VGNAD----ILAGLGQVKSNIDSGAFNAVQWAGITALE-
DAPAT_GLOVI     VPG--ARDVAIEFLSCSKAYNMTGWRVG------------------------------------------
YFBQ_SHIFL      SIAPLAPDLLTITNGLSKTYRVAGFRQGVLNGPKKHAKGYIEG--LEMLASMRLCANVPAQHAIQTALGG
YFBQ_ECOLI      SIAPLAPDLLTITNGLSKTYRVAGFRQGVLNGPKKHAKGYIEG--LEMLASMRLCANVPAQHAIQTALGG
YFBQ_ECOL6      SIAPLAPDLLTITNGLSKTYRVAGFRQGVLNGPKKHAKGYIEG--LEMLASMRLCANVPAQHAIQTALGG
DAPAT_DESVV     VPG--AKDVAIEFHSLSKTYNMTGWRVGMA------VGNPTLVAGLGIKENMDSGIFQAVQEASIVALRD
DAPAT_DESVH     VPG--AKDVAIEFHSLSKTYNMTGWRVGMA------VGNPTLVAGLGIKENMDSGIFQAVQEASIVALRD
Y286_HAEIN      HIAALAPDLTVTLNGLSKAYRVAGFRQGWMILNGPKHNAKGYIEGLDMLASMRLCANVPMQHAIQTALGG
DAPAT_AQUAE     VPG--AKDVAIEFHSLSKTYNMTGWRIGMA-----VGNKELVAGLGKVKTNVDSGQFGAVQDAGIVALNL
DAPAT_CARHZ     LEVKGAKDVGIEFHSLSKTYNMTGWRIGWA------VGNAKAIDALGLKSNIDSGVFQAIQYAGIKALEG
PATA_BACSU      SIATYLRDQTIVINGLSKSHSMTGWRIGFLFAP-KDIAKHI----LKVHQYNVSCASSISQKAALEAVTN
DAPAT_DESDG     IPG--AMDVAIEFNSLSKPYNMTGWRIAMA------VGNASLVAGLGKVKENMDSGAQAVQEAAIVALRD
1A112_ARATH     GSGEFDKTRVHIIYGLSKDLSIPGFRAGV-----------------------------------------
DAPAT_PROMA     SIFEIATDCAIEFRSFSKNAGFTGTRCAFTVIPKSLKGKTLDGAEVDFWS-LWNRRQSTKFNGVSYIVQR
ATTY_TRYCR      SVADFTTVPRVILGGTAKNLVVPGWRLG------------------------------------------
DAPAT_DESAD     TPG--AKDVAIEFHSLSKTYNMTGWRCGMA------VGNASLVAGLGIKENVDSGIFQAVQEAGIVALKE
HIS8_GRABC      VKLVDAGDNTVMTRTFSKIFGLGGLRLGWAYAP---------PAIVDVLNRVRGTVNAAVQEAAIGALEE
DAPAT_EUBE2     TIYECEGARTIELRSFSKNAGFTGVRLGFTVIPKGDVTLH----------SLWARRHGTKFNGAPYIVQR
PATR_STRCO      DGVEFYRERVCVLRTFSKAYGLAGLRVGFA----------------------------------------
DAPAT_HALOH     NPPSFAKKVGIEFNSLSKPFNMTGWRVGWA----------------------------------------
DAPAT_SYNPW     SEIEGARDCAIEFRSFSKNAGFTGTRCAFTVVPKGLKGKAANGEAVELWS-LWNRRQSTKFNGVSYIIQR
AAT2_METJA      SAIEFDEEKTILINGFSKLYAMTGWRIGYVISND-----EIIEAILKLQQNLFISAPTISQYAALKAFEK
DAPAT_SYNS9     SEIEGARECAIEFRSFSKNAGFTGTRCAFTVVPKGLKGTAANGELVELWG-LWNRRQSTKFNGVSYIIQR
DAPAT_DESVM     --VEGAKDVTIEFHSLSKTYNMTGWRVGMA------VGNASLVAGLGVKENVDSGIFQAVQEASIVALRD
YFDZ_ECOLI      VPG--ARDVAVEFFTLSKSYNMAGWRIGF-----MVGNKTLVSALARIKSYHDYGTFTPLQVAAIAALEG
DAPAT_DEHSC     LEADGAKDVGIEFHSLSKSYNMTGWRIGMA----------------------------------------
DAPAT_DEHSB     LEADGAKDVGIEFHSLSKSYNMTGWRIGMA----------------------------------------
PATR_STRAW      VAIYRERPNVCVLRTFSKAYGLAGLRVGFA----------------------------------------
ATTY_MOUSE      SDCKYEPMATLSTNGLAKRWLVPGWRLGWILIHDRRDGNEIRDGLVKLSQRI------------------
DAPAT_SYNR3     SEIEGARQCAIEFRSFSKNAGFTGTRCALTVVPTSATGEQVE--LWG----LWNRRQSTKFNGVSYIVQR
DAPAT_DEHE1     LEADGAKEVGIEFHSLSKSYNMTGWRIGMA----------------------------------------
YBDL_ECOLI      HPQ--LRERAVAVSSFGKTYHMTGWKVGVAPAPISAEIRKVHQYL-------------------------
KAT3_DANRE      LPGMW--DRTITVGSAGKTFSVTGWKLGWSIGPE-HLIRHLQTVM---QNSLYTCPT-PLQEAVGRGLLR
DAPAT_ARATH     IPG--AEEVAMETASFSKYAGFTGVRLGWTVIP-------------------------------------
ATTY_RAT        SDCKYEPLANLSTNGLAKRWLVPGWRLGWILIHDRRDGNEIRDGLVKLSQRI------------------
KAT1_HUMAN      LPGMW--ERTLTIGSAGKTFSATGWKVGWVLGPD-----HIMKHLRTVHQN--SVFHCPTQSQAAVAFRQ
PATR_STRGG      DGIEIYRDRVAVLRTFSKAYGLAGLRVGFA----------------------------------------
KAT1_MOUSE      LPGMW--ERTLTIGSAGKSFSATGWKVGWVMGPD-NIMKHLRTV---HQNSIFHCPT-QAQAAVAQCFQH
DAPAT_PROM4     SIYEIARDCAIEFRSFSKNAGFTGTRCAFTVIPKCLRGRSPSNDEVDLWS-LWNRRQSTKFNGVSYIVQR
ATTY_HUMAN      SDCKYEPLATLSTDGLAKRWLVPGWRLGWILIHDRRDGNEIRDGLVKLSQRI------------------
Y1391_METJA     LSVKDAKEVGVEIHSFSKAFNMTGWRL--AFLVGNEL---IIKAFATVKDNFDSGQFIPIQKAGIYCLQH
AATC_RHIME      VPG--ATDVTVEFTSMSKTFSMPGWRMGFA-----VGNERLIAALTRVKSYLDYGAFTPIQVAATQALNG
ALA2_HORVU      S---------------------------------------------------------------------
DAPAT_SYNS3     SEIEGARDCAIEFRSFSKNAGFTGTRCALTVVPKGLKGKADDGSEVELWG-LWNRRQSTKFNGVSYIIQR
BNA3_YEAST      TLSPEIGQLTLTVGSAGKSFAATGWRIGWV--------LSLNAELLSYAAKCFASPS-PLQEACANSIND
KAT1_RAT        LPGMW--DRTLTIGSAGKSFSATGWKVGWVMGPDN-----------------------------------
HIS8_LACPL      LPAKY--PNVVVMRTFSKAYGLANFRIGYA----------------------------------------
HIS8_ARTAT      LPGR---ERLIVSRTMSKAFALAGARLG------------------------------------------
DAPAT_NOSP7     SEIEGAREVAIEFRSFSKNAGFTGTRCALTVVPKTLTGKAADGSDVEL-WKLWNRRQSTKFNGVSYIVQR
HIS8_MAGSA      IELVEAGDNVVVCRTFSKMYALGGLRLGWAYCPENVAG--------------------------------
ATTY_DICDI      -PMASLTDKVPILSGIAKRFLVPGWRLGWVAIHDRD----------------------------------
ATTY_BOVIN      SDSKFEPLATLSSKGLAKRWLVPGWRMG------------------------------------------
ALA2_PANMI      ----------------------------------------------------------------------
DAPAT_DESOH     IPG--ARKVAVEFRSFSKTAGFTGTRCAFSVVPTSGKAHALHALWNRRHCTKFNGVSYPVQRAA------
Y104_SULSO      IKAFDKEGRVIYTSTFSKILAPGGWVI-------------------------------------------
PATR_LEIXX      IPLLSRHPNLVVLRTFSKAYGLAALRIGYA----------------------------------------
HIS8_METAC      EYDNLAVGRT-----FSKVFGLAGLRLGYGILPE------------------------------------
1A1L2_HUMAN     SILSMKSNRTHVIWGTSKDFGISGFRFG------------------------------------------
DAPAT_CYAP4     SIYEIPGARSIEFRSFSKNAGFTGTRCALTVVPKTLTAKAADGSEVEI-WKLWNRRQSTKFNGVSYIVQR
PATR_MYCSS      FGLVRAHPNVVVLRTFSKAYGLAGLRIGYA-VADAD----------------------------------
PATR_MYCSK      FGLVRAHPNVVVLRTFSKAYGLAGLRIGYA-VADAD----------------------------------
PATR_MYCSJ      FGLVRAHPNVVVLRTFSKAYGLAGLRIGYA-VADAD----------------------------------
HIS8_CHLPD      --AEIARKNLIVLRTMSKALALAGMRIGFA----------------------------------------
DAPAT_THEEB     SIYEIARECAIEFRSFSKNAGFTGTRCAFTVVPKGLKGQ----TPSGDAVELWS----------------
AAT2_BACSU      KPASFLEAEDAKTVGFSKTFNMAGWRMAFA----------------------------------------
HIS8_MYCUA      GLIEEYPTRVVVTRTMSKAFAFAGGRLG------------------------------------------
DAPAT_DESDA     SIYEIAEEVAVEFRSFSKTAGFTGLRCAYTVVPKASDGKSGSVSL----NALWNRRQCTKYNGCPYIVQR
HIS8_RHORT      ARLVDSHPNTVMLRTFSK-IGLGGLRLG------------------------------------------
HIS8_MYCMM      GLIEEYPTRLVVTRTMSKAFAFAGGRLG------------------------------------------
HIS8_CORDI      SLLENYPTKLVVSRTMSKAFDFAGGRLG------------------------------------------
DAPAT_SYNP6     SIFEIARDCAIEFRSFSKNAGFTGTRCAFTVVPKGLKGK----AADGSEVELWNGVSYIVQRGAVYSAEG
DAPAT_SYNE7     SIFEIARDCAIEFRSFSKNAGFTGTRCAFTVVPKGLKGK----AADGSEVELWNGVSYIVQRGAVYSAEG
DAPAT_PROM3     SEIEGARECAIEFRSFSKNAGFTGTRCAFTVVPKGLKGKSDDGSDVELWN-LWNRRQSTKFNGVSYIIQR
HIS8_METMA      EYDNVAVGRT-----FSKVFGLAGLRLGYGIMPEWLTKEYLRAA--------------------------
HIS8_LEUMM      LVAEYT--NLVVLRTLSKAYGLANLRVGYGIMQD------------------------------------
DAPAT_CHLFF     IPARFC---AIEINSFSKSLGFAGVRLG------------------------------------------
ALAT1_HUMAN     S---------------------------------------------------------------------
ALAT1_BOVIN     S---------------------------------------------------------------------
KAT3_MOUSE      LPGMW--ERTITIGSAGKTFSVTGWKLGWSIGP-----AHLIKHLQTVQQNSFYTCATPLQAALAEAF--
KAT3_BOVIN      FKIATFPERTITIGSAGKTFSVTGWKLGWSIGP-----KHLIKHLQTVQQNTVYTCATPLQEALAQAF--
HIS8_METBF      NLAELVREYDNLVVGFSKVFGLAGLRLGYGIMPEWLAKEYIRAA--------------------------
DAPAT_SYNPX     SEIEGARECAIEFRSFSKNAGFTGTRCAFTVVPKGLKGTASNGEAVELWG-LWNRRQSTKFNGVSYIIQR
DAPAT_PARUW     --IEGAKEVAIEVGSFSKMIGFTGVRLGWSVVP-------------------------------------
DAPAT_SYNY3     SEIEGARDCAIEFRSFSKNAGFTGTRCALTVVPKTLTAKAADGSDVEL-WKLWNRRQSTKFNGVSYIIQR
DAPAT_GEOSF     SEIEGAKKCAIEFRSFSKTAGFTGVRCGLVVVPEEVMGTSFNRLWLRRTTTKFNGASYPVQRAAAAVYKQ
HIS8_RHOSR      TLIDEYPSKLVVSRTMSKAFAFAGGRLG------------------------------------------
HIS8_PELLD      -PLVDELPNVVILRTMSKALALAGMRIGFAIAPEA-----------------------------------
DAPAT_TRIEI     SEIEGAKECAIEFRSFSKNAGFTGTRCALTVVPKTLKGKAADGSDVEL-WKLWNRRQSTKFNGVSYIVQR
DAPAT_SYNJB     SIYEIARECAIEFRSFSKTAGFTGTRCAFTVVPKSLRGQAADGSWVDLWS-LWYRRQSTKFNGVSYIVQR
DAPAT_SYNJA     SIYEIARECAIEFRSFSKTAGFTGTRCAFTVVPKSLRGQAADGSWVDLWS-LWYRRQSTKFNGVAYIVQR
DAPAT_DESAP     ----------------------------------------------------------------------
DAPAT_ACAM1     SEIEGARDCAIEFRSFSKNAGFTGTRCALTVVPKTLMAKAADESDVEL-WKLWNRRQSTKFNGVSYIVQR
DAPAT_PROMM     SEIEGARECAIEFRSFSKNAGFTGTRCAFTVVPKGLKGKSDDGSDVELWN-LWNRRQSTKFNGVSYIIQR
AAT_STRGR       ----------------------------------------------------------------------
HIS8_UNCMA      ---ELMKENIVIGRTMSKAWGLAGMRIGYGFMPD------------------------------------
HIS8_SYMTH      LVQDY--PNVVIARTFSKIYGMAGFRLG------------------------------------------
HIS8_RUBXD      GSHALALERVAVARTFSKAHGLAGFRVG------------------------------------------
DAPAT_SYNP2     SELEGAKDCAIEFRSFSKNAGFTGTRCAFTVVPKNLTVTASNGQAVQLWS-LWNRRQSTKFNGVSYIVQR
ALAT2_MOUSE     S---------------------------------------------------------------------
DAPAT_LEPBL     SIYEVAGAKEVAIRSFSKTAGFTGLRCAYIVIPKELKGRTRGGEEVSINS-LWSRRHTTKFNGVSYVTQK
DAPAT_LEPBJ     SIYEVAGAKEVAIRSFSKTAGFTGLRCAYIVIPKELKGRTRGGEEVSINS-LWSRRHTTKFNGVSYVTQK
ALAT2_HUMAN     S---------------------------------------------------------------------
PATR_MYCA9      ALVREHPNVVVLRT-FSKAYGLAGLRVGYA----------------------------------------
HIS8_CORGL      TLLEKYPTKLVVSRTMSKAFDFAGGRLG------------------------------------------
DAPAT_EUBR3     SIYECNGAKTIELRSFSKNAGFTGVRLGFTVVPKGDVSLH----------AMWARRHGTKFNGAPYIVQR
DAPAT_CHLTB     SIFEIPDARAIEINSFSKPLGFAGIRLGWTVIPQELT---------------------------------
DAPAT_CHLT2     SIFEIPDARAIEINSFSKPLGFAGIRLGWTVIPQELT---------------------------------
1A12_CUCPE      QMEHCKKELIHILYSLSKDMGLPGFRVGI-----------------------------------------
HIS8_CORGB      TLLEKYPTKLVVSRTMSKAFDFAGGRLG------------------------------------------
DAPAT_LEPIC     SEVEGAKEVAIEFRSFSKTAGFTGLRCAYIVIPKELKGRTRSGEEVSLNS-LWNRRHTTKFNGVSYVTQK
DAPAT_CHLTR     SIFEIPDARAIEINSFSKPLGFAGIRLGWTVIPQELT---------------------------------
DAPAT_CHLTA     SIFEIPDARAIEINSFSKPLGFAGIRLGWTVIPQELT---------------------------------
ALAT1_MOUSE     S---------------------------------------------------------------------
HIS8_ACICJ      DSGQ----NTVMTRTFSKMFGLGGVRLGWAYAP-------------------------------------
DAPAT_SYNSC     FEIEGARDCAIEFRSFSKNAGFTGTRCAFTVVPKGLKGKAANGEAVELWG-LWNRRQSTKFNGVSYIIQR
DAPAT_CHLAB     IPG--ARSCAIEVNSFSKSLGFAGVRLG------------------------------------------
1A1C_TOBAC      SIAEILDDETSIVYSLSKDMGLPGFRVGI-----------------------------------------
PATR_THEFY      ----------------------------------------------------------------------
ALAM_YEAST      S---------------------------------------------------------------------
HIS8_DESHY      DQIPYCPNLLVMKT-FSKLFAMAALRLG------------------------------------------
DAPT1_ANAVT     SEIEGAREVAIEFRSFSKNAGFTGTRCALTVVPKTLKAKAADGSDVEL-WKLWNRRQSTKFNGVSYIVQR
DAPAT_LEPIN     SEVEGAKEVAIEFRSFSKTAGFTGLRCAYIVIPKELKGKTRSGEEVSLNS-LWNRRHTTKFNGVSYVTQK
1A11_CUCPE      QMEHCKKELIHILYSLSKDMGLPGFRVGI-----------------------------------------
Y1527_METMP     LSVKDAKEVGVEIHSFSKAYNMTGWRLGFAAVKDNDSGQFIPIQKAGI----------------------
DAPAT_CHLCV     SIFEIPEARSIEINSFSKSLGFSGVRLG------------------------------------------
ALAT1_RAT       S---------------------------------------------------------------------
KAT3_HUMAN      LKIATFPERTITIGSAGKTFSVTGWKLGWSIGPN-----HLIKHLQTVQQNTIYTCATPLQEALAQAF--
1A12_ARATH      SVAEVVNDVDIIVYSLSKDMGLPGFRVGIVSFNDSVVSCARKMSSFGLV-------SSQTQLMLASMLSD
MTNE_BACSU      T--EGAKDIGIEIYTLSKTYNMAGWRVGFA----------------------------------------
HIS8_MYCPA      LVGEY-PTKLVVTRTMSKAFAFAGGRLG------------------------------------------
HIS8_MYCA1      LVGEY-PTKLVVTRTMSKAFAFAGGRLG------------------------------------------
HIS8_CHLL2      ALIEECPNLIVLRT-MSKALALAGMRIGFA----------------------------------------
DAPT1_ANASP     SEIEGAREVAIEFRSFSKNAGFTGTRCALTVVPKTLKAKAADGSDVEL-WKLWNRRQSTKFNGVSYIVQR
ALAT_SCHPO      ----------------------------------------------------------------------
ALAT2_XENTR     S---------------------------------------------------------------------
ALAM_DICDI      ----------------------------------------------------------------------
Y1479_METJA     LLCEVIDDVCGLSKGISKELPWPGARCGWIEIYNAD----------------------------------
PATR_CORGB      TEEIHRHDNVIGLRTFSKAYGLAGLRVGYA----------------------------------------
DAPAT_GEOMG     SEIEGAKKCAIEFRSFSKTAGFTGVRCGLVVVPEEVMGTSFNKLWLRRTTTKFNGASYPVQKAAAAVYSD
1A17_ARATH      SVAEIVKERVHIVYSLSKDLGLPGFRVG------------------------------------------
HIS8_RHOBA      Q----SDENIFVTRTLSKSYGLAGIRFG------------------------------------------
DAPAT_PELPD     SEIEGAKKCAIEFRSFSKTAGFTGVRCGLVVVPEEVMGSTATGEAYSF-NKLWNGASYPVQRAAAAVYTD
DAPAT_GEOUR     SEIEGAKKCAIEFRSFSKTAGFTGVRCGLVVVPETSTGERFNKLWLRRTTTKFNGASYPVQRAAEAVYKQ
ALAT2_DANRE     SGPEYSKKVELASFHSTSKCYMGGFRGGYMEVINMDA--DVKAQLTKLVS-VRLCPPAPGQALMDLVVNE
1A11_CUCMA      EMEHCKKELIHILYSLSKDMGLPGFRVGI-----------------------------------------
HIS8_CHLTE      DLIDRYPNLIVLRT-MSKALALAGMRIGFA----------------------------------------
HIS8_AZOC5      LELALSAENVIMCRTFSKIHGLAALRIGWA----------------------------------------
DAPAT_PROM5     SIYEIAKSCAIEFRSFSKNAGFTGVRCAYTVIPKCLTGQNSKGDKVDL-WPLWNRRQCTKFNGVSYVVQK
DAPAT_GEOLS     SEIEGAKKCAIEFRSFSKTAGFTGVRCGLVVVPEEVMGTTASGEKYSF-NKLWNGASYPVQRAAAAVYSE
DAPAT_CLOPH     --CDGAKKCAIELRSFSKNAGFTGTRLGFTIVPKELTSDGVS------LNSLWARRHGTKFNGAPYIIQ-
1A16_ARATH      SVAEVIEELIHIVYSLSKDMGLPGLRVGI-----------------------------------------
HIS8_SILPO      S----ARDNVIMTRTFSKIYGLGGLRIGWGYAP-------------------------------------
DAPAT_GEOSL     SEIEGAKKCAIEFRSFSKTAGFTGVRCGLVVVPEEVMGTSFNKLWLRRTTTKFNGASYPVQKAAAAVYQQ
DAPAT_CYAA5     SEIEGAKDCAIEFRSFSKNAGFTGTRCAFTVVPKQLTAKASDGSQVEL-WKLWNRRQSTKFNGVSYIVQR
DAPAT_CLOTH     SEVEGADEVAIEFRSFSKTAGFTGTRCAYTVVP-------------------------------------
1A1C_PHAAU      SIAEILEDETHIVYSLSKDMGFPGFRVGI-----------------------------------------
1A12_SOLLC      SIAEILDEQEMIVYSLSKDMGLPGFRVGI-----------------------------------------
PATR_CORGL      TEEIHRHDNVIGLRTFSKAYGLAGLRVGYA----------------------------------------
HIS8_METNO      LELVAESENVVMTRTFSKVYGLAALRIG------------------------------------------
DAPAT_DESAH     YEIEGAKEVAVEFRSFSKTAGFTGTRCAYTVVPKACRVFDQKGAAIAL-HPLWNGVSYPVQRAAVYSTEG
DAPAT_CHLPN     IPE--AKYCAIEINSFSKSLGFTGMRLAWNVIP-------------------------------------
ALAT2_XENLA     S---------------------------------------------------------------------
PATR_MYCVP      FGLVRAHSNVVVLRTFSKAYGLAGLRIGYA----------------------------------------
PATR_CORDI      TEILSEFPNLVGLRTFSKAFGLAGVRVGYA----------------------------------------
KAT3_RAT        LPGMW--DRTLTIGSAGKTFSVTGWKLGWSIGPG-----HLIKHLRTVQQTSVYTCATPLQAALAEAF--
HIS8_PROVI      PLIEEFPNLVVLRT-MSKALALAGMRIGFA----------------------------------------
HIS8_PELPB      ELIDELPNLVVLRT-MSKAIALAGIRIGFA----------------------------------------
HIS8_MOOTA      VRAGRA--NVIILRTFSKIYGLAGLRVG------------------------------------------
HIS8_LACF3      LPLVKRYQNVAVLRTLSKAYGLANVRVGFAVMP-------------------------------------
AAT3_BACSU      NPFQ-SYHRVILASSFSKDLGIAGERLGYSRMPDAD----------------------------------
1A1C_DIACA      SPSFISVAEVIILYSLSKDMGMPGFRVGI-----------------------------------------
1A14_SOLLC      SIAEIINEDNCIVSSLSKDLGFPGFRVGI-----------------------------------------
1A11_PRUMU      QNMNCNPNLIHIVYSLSKDMGLPGLRVGI-----------------------------------------
KAT_DICDI       HRFATLPERTITIGSAGKTFSITGWKVGWCIGPSNIIG-----AIANTHQYVPFSVPTPTQEAVAIALEQ
HIS8_METS4      LELVAESENVVMTRTFSKAYGLAALRIG------------------------------------------
HIS8_CHLP8      DLIDRYPNLIVLRT-MSKALALAGMRIGFA----------------------------------------
DAPAT_MICAN     SEIEGARQCAIEFRSFSKNAGFTGTRCALTVVPQSLTAKAADGSDVQL-WKLWNRRQSTKFNGVSYIVQR
DAPAT_HELMI     --IEGAREVAVEFRSFSKTAGFTGTRCAFTVVPKDREGRSLNGLWLRRQTTKFNGVSYPVQAAAAAIYTE
CBL_BACSU       LSDDFA-DISVTCAAPSKTFNIAGLQASAIIIPD------------------------------------
1A1C_SOYBN      SIAEILEEDTHIVYSLSKDMGFPGFRVGI-----------------------------------------
1A110_ARATH     SMAEIVDERVHIVYDLSKDLSFRGLR--------------------------------------------
HIS8_COREF      YPAKLVVSRT-----MSKAFDFAGGRLG------------------------------------------
DAPAT_PROMP     SEIEGAKNCAIEFRSFSKNAGFTGVRCAYTVIPKNLSGQNSKGDKIDLWS-LWNRRQCTKFNGVSYIVQR
DAPAT_BACV8     SIYEIAKKVAIEFRSFSKTAGFTGVRCGYTVVPKELTAATLEGERIPL-NRMWNRRQCTKFNGTSYITQR
PATR_PROAC      LTLLEDHPNVVVLRTFSKAYGLAGLRIGFA----------------------------------------
HIS8_LEUCK      RDVKDYPNLVVLRT-LSKAYGLANLRIG------------------------------------------
DAPAT_PROMS     SEIEGAKDCAIEFRSFSKNAGFTGVRCAFTVIPKN---------LKGLSSPLWNRRQSTKFNGVSYVVQK
HIS8_RHOPT      IELVSTTENTVLTHTFSKVHGLAGWMFGPANIVDA-----------------------------------
HIS8_RHOPA      IELVSTTENTVLTHTFSKVHGLAGWMFGPANIVDA-----------------------------------
HIS8_MYCS2      ALLDDYPAKLVVSRTMSKAFAFAGGRLG------------------------------------------
DAPAT_GEOBB     SEVEGAKKCAIEFRSFSKTAGFTGVRCGLVVVPDELEGTTSNGEKYSF-NKLWNGASYPVQKAAAAVYTE
HIS8_THEPX      AINEF--ENLIVLRTLSKAFGLAGLRVGYA----------------------------------------
HIS8_DINSH      KALVESRENVVMTRTFSKIYGLGALRVG------------------------------------------
DAPAT_METTH     SEVEGAREVAIEFRSFSKNAGFTGTRCAFTVVPEEDSSGRMHS-----VRELWNRRQTTKFNGVSYPVQR
DAPAT_CYAP7     SEIEGARDCAIEFRSFSKNAGFTGTRCALTVVPKTLKAKASDGSEVEL-WKLWNRRQSTKFNGVSYIVQR
PATR_MYCS2      LGLVREHRNVVVLRTFSKAYGLAGLRVGYA----------------------------------------
PATR_MYCBT      LGLVRAHNNVVVLRTFSKAYGLAGLRIGYA----------------------------------------
PATR_MYCBP      LGLVRAHNNVVVLRTFSKAYGLAGLRIGYA----------------------------------------
PATR_MYCBO      LGLVRAHNNVVVLRTFSKAYGLAGLRIGYA----------------------------------------
HIS8_HALMA      RPLLSDRDDVALLRTFSKAYGLAGIRLGYAVVPE------------------------------------
1A1L1_BOVIN     SVLSLEPQRTHVMWATSKDFGMSGLRFG------------------------------------------
HIS8_HALLT      -PLVDERDDVAVLRTFSKAYGLAGLRIGYSVVPEA-----------------------------------
DAPAT_PROM9     SEIEGAKDCAIEFRSFSKNAGFTGVRCAFTVIPKNLKGLSSTNEEIDL-WPLWNRRQSTKFNGVSYVVQR
DAPAT_CYAP8     SEIEGARDCAIEFRSFSKNAGFTGTRCALTVVPKTLTAKASDGSDVEL-WKLWNRRQSTKFNGVSYIVQR
1A18_ARATH      SVMEVLKDRKLIVYSLSKDLGLPGFRVGV-----------------------------------------
HIS8_THEP3      VINEF--ENLIVLRTLSKAFGLAGLRVGYA----------------------------------------
DAPAT_DESPS     YEIEGADKVAIEFRSFSKNAGFTGTRCAYTVVPDSEGNSHLHSMWNRRHCTKFNGVSYPIQRAAAYTPEG
HIS8_RHOP2      IELVSTTDNTVLTHTFSKVHGLAGWMFGPANIVD---------AVNRIRGPF--NTSIPAQLAAVAAIQD
HIS8_MYCLE      LVGEY-PTKIVVTRTTSKAFAFAGGRLG------------------------------------------
HIS8_MYCLB      LVGEY-PTKIVVTRTTSKAFAFAGGRLG------------------------------------------
HIS8_BEII9      LELVSTHENVVMTRTFSKIYGLAALRLGWCYAP-------------------------------------
HIS8_BACHD      VPMIRTYKNLVVLRTFSKVFGLAALRIG------------------------------------------
DAPAT_PROMT     SEIEGARDCAIEFRSFSKNAGFTGTRCAFTVIPKSLKGK------AGIETSLWNRRQSTKFNGVSYVVQR
DAPAT_PROM1     SEIEGARDCAIEFRSFSKNAGFTGTRCAFTVIPKSLKGK------AGIETSLWNRRQSTKFNGVSYVVQR
YDT4_SCHPO      --ATLRPEKHVVTVGSGKTFGCTGWRVGWL-IGDESLIKYSAAA----HTRICFAVNSPCQEALAIAFGE
PATR_MYCTU      LGLVRAHNNVVVLRTFSKAYGLAGLRIGYA----------------------------------------
PATR_MYCTA      LGLVRAHNNVVVLRTFSKAYGLAGLRIGYA----------------------------------------
PATR_MYCPA      LELALSRSNVVVLRTFSKAYGLAGLRVGYA----------------------------------------
PATR_MYCA1      LELALSRSNVVVLRTFSKAYGLAGLRVGYA----------------------------------------
HIS8_NITWN      IELVATTENTVLTHTFSKIHGLAALRIGWMFGP-----AHIVDAMNRIRGPF--NVSTPAMLAAAAAIED
DAPAT_PARD8     SIYEIAKKVAIEFRSFSKTAGFTGIRCGYTVVPKELNAFTLDGQRVQL-NKLWNRRQCTKFNGTSYITQR
HIS8_SPHAL      ELAKTRP-NVFVTRTFSKIHGLAAERIG------------------------------------------
HIS8_MARMM      AGIELARERVIVTRTFSKIHGLAALRLGWA----------------------------------------
HIS8_BREBN      VPMLAEYPNLIILRTFSKIYGLAALRIG------------------------------------------
HIS8_ANOFW      LLQQY--ENMMILRTFSKAYGLAALRIG------------------------------------------
DAPAT_GEOSM     SQVEGAKKCAIEFRSFSKTAGFTGVRCGLVVVPEELEGTTSNGEKYSF-NKLWNGASYPVQKAAAAVYTE
1A12_CUCMA      SEDEEVWKRVHIVYSLSKDLGLPGFRVG------------------------------------------
PATR_RHOSR      L-FRGRPNVVVLRT-FSKAYGLAGIRVGYA----------------------------------------
HIS8_RHOOB      TLIDEYPSKLVVSRTMSKAFAFAGGRLG------------------------------------------
HIS8_PARDP      ----------------------------------------------------------------------
DAPAT_CHLMU     SIFEIPDARAIEINSFSKSLGFAGIRLGWTVIPKEEDGQPIIRDWKRFLSTTFNGASIPAQEAA------
ALAT_YEAST      ----------------------------------------------------------------------
HIS82_NITMU     DSIAWLKQNLLITRTFSKAYGMAGVRVG------------------------------------------
HIS81_ARCFU     SDVSFSAENVVIARTFSKAFGLANLRIGYALLPE------------------------------------
1A111_ARATH     SVLEVAKDKNMVVYSLSKDLGLPGFRVGL-----------------------------------------
YJIR_ECOLI      S--WDIDGRVLLCSSFSKSIAPGGW---------------------------------------------
HIS8_ZYMMO      LALAKNTKNVLVTRTFSKIYGLAAERIGWA----------------------------------------
HIS8_HALSA      APRD---DIAVLRT-FSKAYGLAGIRLGYAVVPDS-----------------------------------
HIS8_HALS3      APRD---DIAVLRT-FSKAYGLAGIRLGYAVVPDS-----------------------------------
HIS8_AERHH      LLARF--PNLVVTRTLSKAFALAGIRCG------------------------------------------
DAPAT_BACFR     SIYEIAKKCAIEFRSFSKTAGFTGVRCGYTVVPKELTAATLEGERIPL-NRLWNRRQCTKFNGTSYITQR
DAPAT_BACFN     SIYEIAKKCAIEFRSFSKTAGFTGVRCGYTVVPKELTAATLEGERIPL-NRLWNRRQCTKFNGTSYITQR
COBD_THETN      LPLVKKHDKLFVVRAVTKFFGMPGIRLG------------------------------------------
1A1C_MALDO      SVMEVLKDRNCVVYSLSKDLGLPGFRVG------------------------------------------
HIS8_SILST      LIA--ARHNVVMTRTFSKIYGLGGARVGWAYGP-------------------------------------
HIS8_ROSDO      LVDEF--DNVVMTRTFSKLYGLGGLRVGWA----------------------------------------
HIS8_NOVAD      LDLAVTACNVLVTRTFSKIYGLAGERIG------------------------------------------
HIS82_NITEU     IAWLKNFQNLVITRTFSKAYGLASVRVGFA----------------------------------------
DAPAT_PROM0     SEIEGAKDCAIEFRSFSKNAGFTGVRCAFTVIPKNLKGLSSTNEEIDL-WPLWNRRQSTKFNGVSYVVQR
CBL_MYCTU       ----------------------------------------------------------------------
CBL_MYCBO       ----------------------------------------------------------------------
HIS8_STRMK      AHANLAVLRT-----LSKAHALAAARIG------------------------------------------
HIS8_ROSCS      DLVGTRPNLVVLRT-FSKWAGLAGLRIGYAAM--------------------------------------
HIS8_NITHX      IELAATTGNTVLTHTFSKIHGLAGWMFGPAHVVDA-----------------------------------
HIS8_HALWD      EYDNIAVLRT-----FSKAYGLAGLRIGYAAVPES-----------------------------------
HIS81_RALEJ     VAWVRRYPNLLVSRTFSKAYGLAGLRIGYA----------------------------------------
DAPAT_LAWIP     SIYEIAKEVAIEFRSFSKTAGFTGLRCAYTVIP-------------------------------------
DAPAT_DESHD     --VEGAREVAVEFRSFSKTAGFTGTRCAYTVVPSTGEGHSLNKLWLRRQTTKFNGVSYPVQAGAAAVYTE
HIS8_METTH      ---DLLPENLFILRTFSKVMGLAGMRIG------------------------------------------
HIS8_CALS8      WLDEF--KNLIVLQTFSKIYGLASLRIGYA----------------------------------------
HIS8_BACCN      -PLLEKYENLMVLRTFSKAYGLAAFRIGYA----------------------------------------
HIS8_AERS4      LLARF--PNLVVTRTLSKAFALAGIRCG------------------------------------------
DAPAT_PELCD     SEIEGANRCAIEFRSFSKTAGFTGVRCALTVVPEAATGNGEKVSLNKLQSTKFNGVSYPVQKAAAAVYSD
DAPAT_LEPBP     IPG--AKEVAMEFRSFSKTAGFTGTRCAYLVIPKDLKGKTKSGEEVSFNS-LWNRRHTTKFNGVSYITQK
DAPAT_LEPBA     IPG--AKEVAMEFRSFSKTAGFTGTRCAYLVIPKDLKGKTKSGEEVSFNS-LWNRRHTTKFNGVSYITQK
DAPAT_DESHY     --VEGAREVAVEFRSFSKTAGFTGTRCAYTVVPSTGEGHSLNKLWLRRQTTKFNGVSYPVQAGAAAVYTE
1A14_ARATH      SVMEILKNRVHIVCSLSKDLGLPGFRVGAIYSNDKD----------------------------------
YDFD_BACSU      IKTIDKNGHVLYIGSLSKTLSPGGWIVGIERLSD------------------------------------
HIS8_PROA2      ID-EF-PNLIILRT-MSKALALAGMRIGFA----------------------------------------
HIS8_MYCTU      SLVEEYPSKLVVTRTMSKAFAFAGGRLG------------------------------------------
HIS8_MYCTA      SLVEEYPSKLVVTRTMSKAFAFAGGRLG------------------------------------------
HIS8_MYCBT      SLVEEYPSKLVVTRTMSKAFAFAGGRLG------------------------------------------
HIS8_MYCBP      SLVEEYPSKLVVTRTMSKAFAFAGGRLG------------------------------------------
HIS8_MYCBO      SLVEEYPSKLVVTRTMSKAFAFAGGRLG------------------------------------------
HIS8_ANADF      LALRRKYPNVVVLRTFSKIYGLAGMRLG------------------------------------------
1A11_ORYSJ      PPAGFVSALEXVVYSLSKDLGLPGFRVG------------------------------------------
1A11_ORYSI      PPAGFVSALEXVVYSLSKDLGLPGFRVG------------------------------------------
HIS8_STRAW      ----------------------------------------------------------------------
HIS8_RHISN      RYSNLLLLRT-----FSKSYAAAGIRVG------------------------------------------
HIS8_NOCFA      GLIDRYPAKLVVSRTMSKAFAFAGGRLG------------------------------------------
HIS8_BRUSU      LELVSSNENVVMTRTFSKIHGLPGLRIG------------------------------------------
HIS8_BRUO2      LELVSSNENVVMTRTFSKIHGLPGLRIG------------------------------------------
HIS8_BRUAB      LELVSSNENVVMTRTFSKIHGLPGLRIG------------------------------------------
HIS8_BRUA2      LELVSSNENVVMTRTFSKIHGLPGLRIG------------------------------------------
HIS8_AKKM8      FVRE--GRNVVVLRTFSKAYGLAGLRVGYGIAPE------------------------------------
PATR_MYCUA      PHLVRTHSNVVVLRTFSKAYGLAGLRVGYA----------------------------------------
PATR_MYCMM      PHLVRTHSNVVVLRTFSKAYGLAGLRVGYA----------------------------------------
PATR_CORJK      ----------------------------------------------------------------------
HIS8_TOBAC      SKMKWVKENLIVLRTFSKRAGLAGLRVGYGAFPKS-----------------------------------
HIS8_RHOS5      ----------------------------------------------------------------------
HIS8_GEOKA      VPLLNEYEQLVVMRTFSKAYGLAALRVG------------------------------------------
HIS8_GEOBB      LVRSF--DNVVVTRTFSKSYSLAGMRLGLA----------------------------------------
HIS81_RHIME     LELVSSNRNVVMTRTFSKIYGLAGLRIG------------------------------------------
DAPAT_BACTN     SIYEIAKKCAIEFRSFSKTAGFTGVRCGYTVVPKELTAATLEGDRIPL-NKLWNRRQCTKFNGTSYITQR
DAPAT_AZOPC     SIYEISDAKKVAIRSFSKTAGFTGLRAGYTIVPKELIIQTSKGKMLSL-NAMWRRRQSTKFNGTAYIVQR
HIS8_YERE8      SWLKDYPNLVILRT-LSKAFALAGLRCGFT-LANSD----------------------------------
HIS8_STRCO      ----------------------------------------------------------------------
HIS8_NICPL      SKMKWVKENLIVLRTFSKRAGLAGLRVGYGAFPKS-----------------------------------
HIS8_GEOSM      LVRSF--DNVVVTRTFSKSYSLAGMRLGLA----------------------------------------
HIS8_ACIAC      MRAEPVRNAHVLLMRTLSKFGLAGVRLG------------------------------------------
HIS81_PASMU     TELKNYPHLAIIRT-LSKAFALAGLRCG------------------------------------------
CBL_MYCLE       ----------------------------------------------------------------------
1A1L1_TAKRU     SVLSLEPQRTHVMWGLGKDFAMAGIRVG------------------------------------------
1A1L1_HUMAN     SVLSLEPQRTHVMWATSKDFGMSGLRFGTLYTENQD----------------------------------
YISV_BACSU      ----------------------------------------------------------------------
HIS8_VIBCM      LLAQY-PNLAILRT-LSKAFALAGLRCG------------------------------------------
HIS8_VIBCH      LLAQY-PNLAILRT-LSKAFALAGLRCG------------------------------------------
HIS8_VIBC3      LLAQY-PNLAILRT-LSKAFALAGLRCG------------------------------------------
HIS8_THEGJ      RLIEEYPNLVVLRT-FSKAFGMAGIRAG------------------------------------------
HIS8_RHOP5      IELVSTTENTVVCHTFSKIHGLAGWMFGPANIVDA-----------------------------------
HIS8_NATPD      ALVEERDDVAVLRT-FSKAYGLAGVRLGYAVVPGEWADAYARVNTPFAASEI-------ACRAGLAALED
HIS8_METFL      SLAEF--DNLLISRTLSKAYGLAGLRVG------------------------------------------
HIS8_RHOPB      IELVSTTDNTVVTRTFSKIHGLAGWMFGPANIVDA-----------------------------------
HIS8_PHOPR      LLAKY-PHLVILRT-LSKAFALAGLRCG------------------------------------------
HIS8_METVS      WALKY--DNVLVLRTFSKVFGLAGQRIG------------------------------------------
HIS8_DEHE1      MPS--YPNLMILRT-FSKWAGLAGLRVGYGLFP-------------------------------------
HIS8_BDEBA      QGYMGQYKNLIVLRTFSKIYGLAGFRLGAMIAP-------------------------------------
HIS83_BURS3     LPAY---PRLIVTRTLSKAFKFAGGRVG------------------------------------------
HIS81_HAEI8     NLLKNYPHLAIIRT-LSKAFALAGLRCG------------------------------------------
1A1L2_MOUSE     SVLSIKPNMTHMIWGTSKDFGMSGIRFGV-----------------------------------------
HIS8_RHOSK      ----------------------------------------------------------------------
HIS8_RHOS4      ----------------------------------------------------------------------
HIS8_RHOS1      ----------------------------------------------------------------------
HIS8_PECCP      LD-EF-PHLVILRT-LSKAFSLAGLRCG------------------------------------------
HIS8_ARATH      SRMKWVKENLIVLRTFSKRAGLAGLRVGYGAFP------------LSIIEYLWRSVAGEVAALAALSNGK
HIS82_RHILO     IELVRSAENVVMTRTFSK-IGLGGARIG------------------------------------------
1A1L1_MOUSE     SVLSLEPQRTHVMWATSKDFGMSGLRFGV-----------------------------------------
YEY2_YEAST      IDRSTAPSNTVSNATFSKLIAPG-----------------------------------------------
HIS8_VIBFM      LLADY-PHLAILRT-LSKAFALAGLRCG------------------------------------------
HIS8_METMP      WALKY--DNVLVLRTFSKVFGLAGQRVG------------------------------------------
HIS8_HAEIG      NLLKNYPHLAIIRT-LSKAFALAGLRCG------------------------------------------
HIS8_BRUME      LELVSSNENVVMMRTFSKIHGLPGLRIG------------------------------------------
HIS83_RHILO     ----------------------------------------------------------------------
HIS82_THIDA     -PLVARHPQLLVTRTLSKSHALAGLRVGYA----------------------------------------
HIS82_CARHZ     ----------------------------------------------------------------------
HIS81_HAEIN     NLLKNYPHLAIIRT-LSKAFALAGLRCG------------------------------------------
HIS8_MYCSS      ALIDQYPTKLVVSRTMSKAFAFAGGRLG------------------------------------------
HIS8_MYCSM      ----------------------------------------------------------------------
HIS8_MYCSK      ALIDQYPTKLVVSRTMSKAFAFAGGRLG------------------------------------------
HIS8_MYCSJ      ALIDQYPTKLVVSRTMSKAFAFAGGRLG------------------------------------------
HIS8_METM5      WALKY--DNVLVLRTFSKVFGLAGQRVG------------------------------------------
HIS8_GLUDA      LVRRF-PNLLVVRT-LSKSHALAGLRVGYA----------------------------------------
HIS8_GEOUR      LVRKY--ENVVVTRTLSKSYSLAGMRLGLA----------------------------------------
HIS82_BRAJA     IELVATTENTVVTHTFSKIHGLAALRIGWMFGPE-----HIIDAVNRIRGPF--NVSTPAMYAAVAAIED
1A19_ARATH      LENSEVSKRVHIVYSLSKDLGLPGFRVG------------------------------------------
PATR_RHOOB      LFRRY-PNVVVLRT-FSKAYGLAGLRVG------------------------------------------
HIS8_XANP2      LELALTADNVLMSRTFSKIHGLAGWAVGPAHVIDA-----------------------------------
HIS8_ROSS1      DMVGACPNLVVLRT-FSKWAGLAGLRIGYAAM--------------------------------------
HIS8_HELHP      PKQLIERFSNVIYLGFSKVYGLGGMRVGYVRPPFNVTTLSLQAALIALKDQVFVS---------------
HIS8_HAEIE      NLLKNYPHLAIIRT-LSKAFALAGLRCG------------------------------------------
HIS8_COLP3      IKLISQYDNVIILRTLSKAFALAGLRCG------------------------------------------
HIS8_BLOPB      LP--MYPHLVILRT-LSKAFALAGLRCG------------------------------------------
HIS8_VIBF1      DLLVDYPHLAILRT-LSKAFALAGLRCG------------------------------------------
HIS8_SHEON      DLLETYPNLVVLRT-LSKAFALAGARCG------------------------------------------
HIS8_POLNA      ----------------------------------------------------------------------
HIS8_LYSSC      LPIIDQYPNVLLLRTFSKAYGLASFRVGYA----------------------------------------
HIS8_GEOTN      -PLLQEYEQLVIMRTFSKAYGLAALRVG------------------------------------------
HIS8_DEHSB      DMSKY-PNLMILRT-FSKWAGLAGLRVGYGLFP-------------------------------------
HIS8_BAUCH      SWINHYPHLVILRT-LSKAFALAGLRCG------------------------------------------
HIS8_ALISL      DLLATYPNLAILRT-LSKAFALAGLRCG------------------------------------------
HIS82_OCEIH     LQLRFTYSNVIVLRTFSKAYGLAGLRIG------------------------------------------
HIS81_BURS3     RAAEF--DNVVVMRTVSK-LGLAGIRLG------------------------------------------
HIS8_MYCVP      GLIESYPGKLVVTRTMSKAFAFAGGRVG------------------------------------------
HIS8_ERWCT      L-AEF-PHLVILRT-LSKAFSLAGLRCG------------------------------------------
HIS8_BACSU      -PLLSKYSNLMILRTFSKAYGLAALRVGYG-IADENLIRQIEPA--------------------------
HIS8_VIBPA      LLAQY-PNLAILRT-LSKAFALAGLRCG------------------------------------------
HIS8_VIBHB      LLAQY-PNLAILRT-LSKAFALAGLRCG------------------------------------------
HIS8_RHOCS      --ARF--DNVVMTRTFSKLFGLGGMRLGWAYCP-------------------------------------
HIS8_CORJK      GLLEQYPTKLVVSRTMSKAFDFAGGRLG------------------------------------------
HIS82_MANSM     KQLGNYPHLAIIRT-LSKAFALAGLRCG------------------------------------------
HIS82_BACC1     LPLLEKHKNILVLRTFSKAYGLASFRVGYA----------------------------------------
HIS8_DEHSC      DMSKY-PNLMILRT-FSKWAGLAGLRVGYGLFP-------------------------------------
HIS8_AGRT5      LELVSGNRNVVMTRTFSKVYGLAALRVG------------------------------------------
YDIU_SHISS      ----------------------------------------------------------------------
YDIU_SHIBS      ----------------------------------------------------------------------
YDIU_SHIB3      ----------------------------------------------------------------------
YDIU_ESCF3      ----------------------------------------------------------------------
YDIU_ECOUT      ----------------------------------------------------------------------
YDIU_ECOSE      ----------------------------------------------------------------------
YDIU_ECOLI      ----------------------------------------------------------------------
YDIU_ECOLC      ----------------------------------------------------------------------
YDIU_ECOL6      ----------------------------------------------------------------------
YDIU_ECOL5      ----------------------------------------------------------------------
YDIU_ECOK1      ----------------------------------------------------------------------
YDIU_ECOHS      ----------------------------------------------------------------------
YDIU_ECODH      ----------------------------------------------------------------------
YDIU_ECOBW      ----------------------------------------------------------------------
YDIU_ECO81      ----------------------------------------------------------------------
YDIU_ECO5E      ----------------------------------------------------------------------
YDIU_ECO57      ----------------------------------------------------------------------
YDIU_ECO55      ----------------------------------------------------------------------
YDIU_ECO45      ----------------------------------------------------------------------
YDIU_ECO27      ----------------------------------------------------------------------
YDIU_ECO24      ----------------------------------------------------------------------
HIS8_SODGM      WLAEY-PHLVILRT-LSKAFALAGLRCG------------------------------------------
HIS8_METM7      WALKY--DNVLVLRTFSKVFGLAGQRVG------------------------------------------
HIS8_MESSB      VELVSSNDNVVMTRTFSKIHGLAGLRIG------------------------------------------
HIS8_LISIN      EKLVRTYKNLIITRTFSKIYGLASARVG------------------------------------------
HIS8_KLEP3      GWLSDYPHLVVVRT-LSKAFALAGLRCG------------------------------------------
HIS8_BIFLO      SLIKDHPNLAVSRT-MSKAFAFAGARVG------------------------------------------
1A15_ARATH      LEDTEVSKRVHVVYSLSKDLGLPGFRVG------------------------------------------
YDEF_BACSU      --ASFAPQQVIHIASLSKSLAPG-----------------------------------------------
HIS8_RHOPS      IELVATTDNTVMTHTFSKIHGLAGWMFGPANIVD---------AVNRIRGPF--NVSVPAQLAAVAAIQD
HIS8_METPP      ----------------------------------------------------------------------
HIS8_LISMF      EKLIRTYKNLIITRTFSKIYGLASARVG------------------------------------------
HIS8_LISMC      EKLIRTYKNLIITRTFSKIYGLASARVG------------------------------------------
HIS8_FRASC      LPRH---PRLVVTRTMSKAFALAGARVG------------------------------------------
HIS8_ENT38      GWLEEYPHLVVLRT-LSKAFALAGLRCG------------------------------------------
HIS8_DESDG      HLTEF-PNVAVLRT-FSKSYGLAGLRLG------------------------------------------
HIS81_RHILO     ----------------------------------------------------------------------
HIS8_VIBVY      LLAQYS--NLAILRTLSKAFALAGLRCG------------------------------------------
HIS8_VIBVU      LLAQYS--NLAILRTLSKAFALAGLRCG------------------------------------------
HIS8_LISMH      EHLIRTYKNLIITRTFSKIYGLASARVG------------------------------------------
HIS8_KLEP7      GWLSDYPHLVVLRT-LSKAFALAGLRCG------------------------------------------
HIS8_ACEPA      SLIKEYPNLLVVQT-FSKSRALAGLRVGFA----------------------------------------
HIS82_RALSO     RYPNLLVSRT-----FSKAYGLAGLRVG------------------------------------------
HIS81_IDILO     ----------------------------------------------------------------------
HIS8_LISMO      EKLIRTYKNLIITRTFSKIYGLASARVG------------------------------------------
HIS8_CLOK5      SIYEY--ENLIVLRTCSKAMASAAIRLG------------------------------------------
HIS8_CLOK1      SIYEY--ENLIVLRTCSKAMASAAIRLG------------------------------------------
HIS8_BURM1      SPRAGEFDNVVVMRTVSK-LGLAGIRLG------------------------------------------
HIS8_BACNA      -PLLSKYSNLMILRTFSKAYGLAALRVGYG-IADENLIRQIEPA--------------------------
COBD_SALTY      -PALKDNPHIWVLRSLTKFYAIPGLRLG------------------------------------------
COBD_SALTI      -PALKDNPHIWVLRSLTKFYAIPGLRLG------------------------------------------
1A13_SOLLC      VMEVLIEERVHIVYSLSKDLGLPGFRIG------------------------------------------
YDIU_SALTY      ----------------------------------------------------------------------
YDIU_SALSV      ----------------------------------------------------------------------
YDIU_SALPK      ----------------------------------------------------------------------
YDIU_SALPC      ----------------------------------------------------------------------
YDIU_SALPB      ----------------------------------------------------------------------
YDIU_SALPA      ----------------------------------------------------------------------
YDIU_SALNS      ----------------------------------------------------------------------
YDIU_SALHS      ----------------------------------------------------------------------
YDIU_SALEP      ----------------------------------------------------------------------
YDIU_SALDC      ----------------------------------------------------------------------
YDIU_SALAR      ----------------------------------------------------------------------
YDIU_SALA4      ----------------------------------------------------------------------
HIS8_STRM5      ----------------------------------------------------------------------
HIS8_DIAST      ----------------------------------------------------------------------
HIS8_ACISJ      ----------------------------------------------------------------------
HIS82_NITOC     ----------------------------------------------------------------------
HIS82_ARCFU     MVRDY--NNLIVLRSFSKFFGLAGMRVGYA----------------------------------------
HIS81_CAUCR     LELARTAENVIVTRTFSKIHGLAALRVGWGYAPE-----HIIAPIERIRPPF--NTSIPAQEAAVAALFD
YDIU_SALTI      ----------------------------------------------------------------------
HIS8_SHEAM      SPAQSATENLVILRTLSKAFGLAGARCG------------------------------------------
HIS8_PELCD      LP------NVVVTRTFSKSYSLAGMRLGLA----------------------------------------
HIS8_METI4      ---SFVKKRIVILRTFSKMYGLAGLRIG------------------------------------------
YDIU_ECOSM      ----------------------------------------------------------------------
YDIU_ECOLU      ----------------------------------------------------------------------
YDIU_ECO7I      ----------------------------------------------------------------------
HIS8_YERPY      NWLKDYPNLVILRT-LSKAFALAGLRCGFT-LANSD----------------------------------
HIS8_YERPS      NWLKDYPNLVILRT-LSKAFALAGLRCGFT-LANSD----------------------------------
HIS8_YERPP      NWLKDYPNLVILRT-LSKAFALAGLRCGFT-LANSD----------------------------------
HIS8_YERPN      NWLKDYPNLVILRT-LSKAFALAGLRCGFT-LANSD----------------------------------
HIS8_YERPG      NWLKDYPNLVILRT-LSKAFALAGLRCGFT-LANSD----------------------------------
HIS8_YERPE      NWLKDYPNLVILRT-LSKAFALAGLRCGFT-LANSD----------------------------------
HIS8_YERPB      NWLKDYPNLVILRT-LSKAFALAGLRCGFT-LANSD----------------------------------
HIS8_YERPA      NWLKDYPNLVILRT-LSKAFALAGLRCGFT-LANSD----------------------------------
HIS8_YERP3      NWLKDYPNLVILRT-LSKAFALAGLRCGFT-LANSD----------------------------------
HIS8_METJA      KAPEY--DNVIVLRTFSKVFGLAGMRVG------------------------------------------
HIS8_GEOSW      -PLLRQYDNLMILRTFSKAYGLAALRVG------------------------------------------
HIS8_GEOSL      RH-----ENVVVTRTLSKSYSLAGMRLGFA----------------------------------------
HIS8_BACLD      PLLERFPNLMILRT-FSKAYGLASLRVG------------------------------------------
HIS82_METCA     PDAEWLGEGLIVTRTFSKAYGLAGLRVGYA----------------------------------------
HIS82_HAEIN     FSLLKKYSNLIISRSLSKAYGLAGLRIGYA----------------------------------------
HIS82_BACAN     LPLLEKHKNILVLRTFSKAYGLASFRVGYA----------------------------------------
CR3L3_BOVIN     SPSRY-----------------------------------------------------------------
HIS8_HALVO      LLSEY--DNVAALRTFSKAYGLAGLRIGYACVPEAWADAYARVNTPFAASEV------------------
HIS82_PSYA2     LINEF--DNLLVTQTFSKSRSLAGLRVGMA----------------------------------------
HIS82_PASMU     FTLLKKHSNLVICRTLSKAYGLAGLRIGYA----------------------------------------


                         .         *         .         .         .         .         +:350
query           PAEIVDLVARSRRLHGLXXXXXXXXXXXXXXPVIAPQAAFYLYPDFGVWREWLGEAHGVTTGPELTRMLL
AAT_THEAQ       REASMAFIAMAREAYRKRRDLLLEGLSRIGLEAVRPSGAFYVLMDTSPFAPNEVEA--------AERLLM
AAT_THET8       QEASRAFVEMAREAYRRRRDXXXXXXXXXXXKAVRPSGAFYVLMDTS------------PIAPDEVRAAL
AAT_BACY2       PQDSVEEMRKA--FESRLETIYPKLSAIPGFKVVKPQGAFYLLPDVSE----AAQKTGFASVDEFASALL
AAT1_BACSU      PSEPLEEMAFEHRLNTI----YAKLIEIPGFSCVKPEGAFYLFPN----AKEAAQSCGFKDVDEFVKALL
AAT_AQUAE       P-KSKDFVNEMRNFERRRDTAVEELSKIPGMDVVKPEGAFYIFPDFSAYAEKLG------GDVKLSEFLL
AAT_BACST       PQEPVEQMAFEQRLN----IIYDKLVQIPGFTCVKPQGAFYLFPN-------------------------
AATA_RHIME      PQ---DFIGRNKEIQGRRDLVVSMLNQAKGISCPTPEGAFYVYPSAGLIGKTAPSGKVIETDEDFVSELL
AAT_SYNY3       PQTCVETMVKAFTERRQVIVEGINQIAGLSCP--NPKGAFYVFVDI---------AKTGLNSLEFSARLL
AAT_PYRHO       RRKIV--VKRLKNMPGI--------------KVKEPKGAFYVFPNI--------SGTGMSS-EKFSEWLL
AAT_PYRAB       ERS-WKAVEEMRKEYDRRRKLVWKRLNEMGLPTVKPKGAFYIFPDTGL------------TSKEFSELML
AAT_RHILP       TQDFIP--ENKKIFEGRRDLVVSMLNQAKGIVCPVPEGAFYVYPSCGLIGKTAPSGKVIETDEDFVSELL
AATB1_RHIME     PQDF--LKERTESFQRRRDLVVNGLNAIDGLDCRVPEGAFYTFSGAGVLGKVTPSGKRIKTDTDFCAYLL
AAT_SULSO       FDEVNQMVSLFKKRRDV---MYDELTKVKGVEVSKPNGAFYMFPN-------------------------
AAT_STRVG       NLDAVAEMRKAFDRRRQTMVKMLNEIDGVFCP--TPEGAFYAYPSV---KELLGEIRGPQSSVELAALIL
AAT_SULTO       FDEVKEMISLFKKRRDI---MYEELKKIKGIQVHKSQGAFYMFPFIG---EILKKAN--LSVKDFSLKLI
AATB2_RHIME     PQDF--LKERTESFQRRRNLVVNGLNAIEGLDCRVPEGAFYTFSGAGVARRVTPSGKRIESDTDFCAYLL
AAT_MYCTU       HQSIEDLVLPGGRLLEQRDIAWTKLNEIPGVSCVKPAGALYAFP--------------------------
AAT_MYCBO       HQSIEDLVLPGGRLLEQRDIAWTKLNEIPGVSCVKPAGALYAFP--------------------------
AAT_THEMA       ----------------------------------------------------------------------
AAT1_METJA      SQKCVEDMVREFKMR----RDLIYNGLKDIFKVNKPDGAFYIFPDVSEYGD----------GVEVAKKLI
AAT_RICCN       PQDYIKLNCQKKRDLAL-----SILKRVKYFECYKPEGAFYLFVKCDIFGHKTKSGTIIANSNDFAEYLL
AAT_RICFE       PQDYIK--PNALNFQKKRDLALSILKRVKYFECYKPEGAFYLFVKCDIFGHKTKSGKIIANSNDFAEYLL
AAT_RICBR       VQGYI--AQNALNFEKKRDLALSILQRVKYFECYKPEGAFYLFIKCDIFGAKTKSGKVINNSNDFGEYLL
AAT_SULAC       FDDVKKMIDTFKKRRDV---MYSELKKIKGIQVNKSQGAFYMFPYLG-----------------------
DAPAT_NATTJ     RHEIPDILKAYKERRDLVIEFLEEAGFH----VYHPKATFY------VWAQVPGNQDSF----NFTKSLL
AAT_RICTY       TQDYIK--PNALNFQKKRDLALSILEKVIYFECYKPEGAFYLFVKCDIFGTKTKSGKIIANSNHFSEYLL
AAT_RICPR       TQDYIK--SNALNFQKKRDLALSILEEVTYFECYKPEGAFYLFVKCDIFGTKTKSGRIIANSNNFSEYLL
AAT_PYRKO       RDELIKEVRRA-----YLERVRMASKMLRGFDFVEPEGAFYIF------------LRTPQDGMAFAERLL
DAPT2_ANAVT     ELQAVMSVYQNRR------DIIVKGLQSLGWPIEPPKATLYV---------WVPVPPGYTS-TEFTTLLL
DAPAT_MOOTA     PQE---GLAEVRRVYQERRDIIVEGFNSLGWHLEKPKATFYV---------WAPVPRGYTSA-SFAEMVL
DAPT2_ANASP     ELQAVMSVYQSRR------DIIVKGLQSLGWPIEPPKATLYV---------WVPVPPGYTS-TEFTTLLL
DAPAT_SYNFM     ----------------------------------------------------------------------
DAPAT_GLOVI     ----------------------------------------------------------------------
YFBQ_SHIFL      YQSISEFITPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFP--------------------------
YFBQ_ECOLI      YQSISEFITPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFP--------------------------
YFBQ_ECOL6      YQSISEFITPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFP--------------------------
DAPAT_DESVV     GDDF------CRELRGIYRQRRDTVITALHKAGIVPQATFYV---------WARVPQGHTSADFVTRVLQ
DAPAT_DESVH     GDDF------CRELRGIYRQRRDTVINALHKAGIVPQATFYV---------WARVPQGHTSADFVTRVLQ
Y286_HAEIN      YQSINEFILPGGRLLEQRNKAYDLITQIPGITCVKPMGAMYMFPKIDV----------------------
DAPAT_AQUAE     PEEEVEKI--------------------------------------------------------------
DAPAT_CARHZ     PQDVVDLYAQRRDL--------------------------------------------------------
PATA_BACSU      GFDDALIM---REQYKKRLDYVYDRLVSMGLDVVKPSGAFYIFPSI--------KSFGMTSF-DFSMALL
DAPAT_DESDG     GAEIRDIYRKRR----------------------------------------------------------
1A112_ARATH     ----------------------------------------------------------------------
DAPAT_PROMA     GAEAV-----------------------------------------------------------------
ATTY_TRYCR      ----------------------------------------------------------------------
DAPAT_DESAD     GE---PYVKEFRKIYKERRDCVIEALEKINISCKVPDASIFV---------WAKTPEGYTSS-EFVSKLL
HIS8_GRABC      PG----WVERSRAHNSAARAKLATALFDIGIPTL-PSVTNFLLADFG-----------------------
DAPAT_EUBE2     AGEAV-----------------------------------------------------------------
PATR_STRCO      ----------------------------------------------------------------------
DAPAT_HALOH     ----------------------------------------------------------------------
DAPAT_SYNPW     GAEAVYSEAGQAEVKGL-----------------------------------------------------
AAT2_METJA      ETEINSMIKEFDRRRRLVLKYVKDFGWEVNNPI----GAYYVFPNIG------------EDGREFAYKLL
DAPAT_SYNS9     GAEAV-----------------------------------------------------------------
DAPAT_DESVM     GDDF------CRELRGIYRKRRDVVVAALNKVGIAPTAAFYI---------WAKVPAGYGSSAEFVTAVL
YFDZ_ECOLI      DQQCVDIAEQYKRRRDVLVKGLHEAGWM----VEMPKASMY------VWAK-IPEPYAAMGSLEFAKKLL
DAPAT_DEHSC     ----------------------------------------------------------------------
DAPAT_DEHSB     ----------------------------------------------------------------------
PATR_STRAW      ----------------------------------------------------------------------
ATTY_MOUSE      ----------------------------------------------------------------------
DAPAT_SYNR3     GAEAV-----------------------------------------------------------------
DAPAT_DEHE1     ----------------------------------------------------------------------
YBDL_ECOLI      ----------------------------------------------------------------------
KAT3_DANRE      DFELM-----------------------------------------------------------------
DAPAT_ARATH     ----------------------------------------------------------------------
ATTY_RAT        ----------------------------------------------------------------------
KAT1_HUMAN      PSSY--FVQFPQAMQRCRDHMIRSLQSVGLKPII-PQGSYFLITDISDFKRKMPDLPGAVDEPRFVKWMI
PATR_STRGG      ----------------------------------------------------------------------
KAT1_MOUSE      FGQPSSYFLQLPQAMGLNRDHMIQSLQSVGLKPLIPQGSYFLIADISDFKSSMPDLPGAMDEPYDTRFMI
DAPAT_PROM4     GAEAV-----------------------------------------------------------------
ATTY_HUMAN      ----------------------------------------------------------------------
Y1391_METJA     P----EITERVRQKYERRLRKMVKILNEVGFKARMPGGTFYLY---------------------------
AATC_RHIME      DGSD---IAEVRAIYKRRRDVMVESFGKAGFEVPPPPATMFAWAKIPEKFRHLGSL-------EFSKLLV
ALA2_HORVU      ----------------------------------------------------------------------
DAPAT_SYNS3     GAEAV-----------------------------------------------------------------
BNA3_YEAST      ALKI-GYFEKMRQEYINKFKIFTSIFDELGLPYTAPEGTYFVLVDFSIPEDYPYPEEILNKGKDISHWLI
KAT1_RAT        ----------------------------------------------------------------------
HIS8_LACPL      ----------------------------------------------------------------------
HIS8_ARTAT      ----------------------------------------------------------------------
DAPAT_NOSP7     GAEAVYSEEGQAQIKGL-----------------------------------------------------
HIS8_MAGSA      ----------------------------------------------------------------------
ATTY_DICDI      ----------------------------------------------------------------------
ATTY_BOVIN      ----------------------------------------------------------------------
ALA2_PANMI      ----------------------------------------------------------------------
DAPAT_DESOH     ----------------------------------------------------------------------
Y104_SULSO      ----------------------------------------------------------------------
PATR_LEIXX      ----------------------------------------------------------------------
HIS8_METAC      ----------------------------------------------------------------------
1A1L2_HUMAN     ----------------------------------------------------------------------
DAPAT_CYAP4     GAEAV-----------------------------------------------------------------
PATR_MYCSS      ----------------------------------------------------------------------
PATR_MYCSK      ----------------------------------------------------------------------
PATR_MYCSJ      ----------------------------------------------------------------------
HIS8_CHLPD      ----------------------------------------------------------------------
DAPAT_THEEB     ----------------------------------------------------------------------
AAT2_BACSU      ----------------------------------------------------------------------
HIS8_MYCUA      ----------------------------------------------------------------------
DAPAT_DESDA     AAEAV-----------------------------------------------------------------
HIS8_RHORT      ----------------------------------------------------------------------
HIS8_MYCMM      ----------------------------------------------------------------------
HIS8_CORDI      ----------------------------------------------------------------------
DAPAT_SYNP6     QAQIKELVA-------------------------------------------------------------
DAPAT_SYNE7     QAQIKELVA-------------------------------------------------------------
DAPAT_PROM3     GAEAV-----------------------------------------------------------------
HIS8_METMA      ----------------------------------------------------------------------
HIS8_LEUMM      ----------------------------------------------------------------------
DAPAT_CHLFF     ----------------------------------------------------------------------
ALAT1_HUMAN     ----------------------------------------------------------------------
ALAT1_BOVIN     ----------------------------------------------------------------------
KAT3_MOUSE      ----------------------------------------------------------------------
KAT3_BOVIN      ----------------------------------------------------------------------
HIS8_METBF      ----------------------------------------------------------------------
DAPAT_SYNPX     GAEAVYSDAGQAEVKGL-----------------------------------------------------
DAPAT_PARUW     ----------------------------------------------------------------------
DAPAT_SYNY3     GAEAV-----------------------------------------------------------------
DAPAT_GEOSF     TKEVIDYYMENARI--------------------------------------------------------
HIS8_RHOSR      ----------------------------------------------------------------------
HIS8_PELLD      ----------------------------------------------------------------------
DAPAT_TRIEI     GAEAV-----------------------------------------------------------------
DAPAT_SYNJB     GAEAVYSEAGQAQVQGL-----------------------------------------------------
DAPAT_SYNJA     GAEAV-----------------------------------------------------------------
DAPAT_DESAP     ----------------------------------------------------------------------
DAPAT_ACAM1     GAEAV-----------------------------------------------------------------
DAPAT_PROMM     GAEAV-----------------------------------------------------------------
AAT_STRGR       ----------------------------------------------------------------------
HIS8_UNCMA      ----------------------------------------------------------------------
HIS8_SYMTH      ----------------------------------------------------------------------
HIS8_RUBXD      ----------------------------------------------------------------------
DAPAT_SYNP2     GAEAV-----------------------------------------------------------------
ALAT2_MOUSE     ----------------------------------------------------------------------
DAPAT_LEPBL     GAE-------------------------------------------------------------------
DAPAT_LEPBJ     GAE-------------------------------------------------------------------
ALAT2_HUMAN     ----------------------------------------------------------------------
PATR_MYCA9      ----------------------------------------------------------------------
HIS8_CORGL      ----------------------------------------------------------------------
DAPAT_EUBR3     AGEAV-----------------------------------------------------------------
DAPAT_CHLTB     ----------------------------------------------------------------------
DAPAT_CHLT2     ----------------------------------------------------------------------
1A12_CUCPE      ----------------------------------------------------------------------
HIS8_CORGB      ----------------------------------------------------------------------
DAPAT_LEPIC     GAE-------------------------------------------------------------------
DAPAT_CHLTR     ----------------------------------------------------------------------
DAPAT_CHLTA     ----------------------------------------------------------------------
ALAT1_MOUSE     ----------------------------------------------------------------------
HIS8_ACICJ      ----------------------------------------------------------------------
DAPAT_SYNSC     GAEAV-----------------------------------------------------------------
DAPAT_CHLAB     ----------------------------------------------------------------------
1A1C_TOBAC      ----------------------------------------------------------------------
PATR_THEFY      ----------------------------------------------------------------------
ALAM_YEAST      ----------------------------------------------------------------------
HIS8_DESHY      ----------------------------------------------------------------------
DAPT1_ANAVT     GAEAV-----------------------------------------------------------------
DAPAT_LEPIN     GAE-------------------------------------------------------------------
1A11_CUCPE      ----------------------------------------------------------------------
Y1527_METMP     ----------------------------------------------------------------------
DAPAT_CHLCV     ----------------------------------------------------------------------
ALAT1_RAT       ----------------------------------------------------------------------
KAT3_HUMAN      ----------------------------------------------------------------------
1A12_ARATH      DQFVDNFLMESSRRLGIRHKVFTTGIKKADIACLTSNAGLFAWMDL---RHLLRDRNSFESEIELWHIII
MTNE_BACSU      ----------------------------------------------------------------------
HIS8_MYCPA      ----------------------------------------------------------------------
HIS8_MYCA1      ----------------------------------------------------------------------
HIS8_CHLL2      ----------------------------------------------------------------------
DAPT1_ANASP     GAEAV-----------------------------------------------------------------
ALAT_SCHPO      ----------------------------------------------------------------------
ALAT2_XENTR     ----------------------------------------------------------------------
ALAM_DICDI      ----------------------------------------------------------------------
Y1479_METJA     ----------------------------------------------------------------------
PATR_CORGB      ----------------------------------------------------------------------
DAPAT_GEOMG     EGEIIDYYMENARI--------------------------------------------------------
1A17_ARATH      ----------------------------------------------------------------------
HIS8_RHOBA      ----------------------------------------------------------------------
DAPAT_PELPD     EGEIIDYYMENARI--------------------------------------------------------
DAPAT_GEOUR     TKEIIDYYMENARI--------------------------------------------------------
ALAT2_DANRE     PSHQTFMQERTAVLSALAEKAKLTEQILNTVPGISVQGAMYSFPRITLPERAISEAKAKGQAPDMCMKLL
1A11_CUCMA      ----------------------------------------------------------------------
HIS8_CHLTE      ----------------------------------------------------------------------
HIS8_AZOC5      ----------------------------------------------------------------------
DAPAT_PROM5     GAEAV-----------------------------------------------------------------
DAPAT_GEOLS     EGEIIDYYMENARI--------------------------------------------------------
DAPAT_CLOPH     ----------------------------------------------------------------------
1A16_ARATH      ----------------------------------------------------------------------
HIS8_SILPO      ----------------------------------------------------------------------
DAPAT_GEOSL     NKEIIDYYMENARI--------------------------------------------------------
DAPAT_CYAA5     GAEAVYSEAGKAQIKGL------VSFYLENAKIICEQAGFEVYGGVNAPYIWLKTPHNLSSWDFFDKLLQ
DAPAT_CLOTH     ----------------------------------------------------------------------
1A1C_PHAAU      ----------------------------------------------------------------------
1A12_SOLLC      ----------------------------------------------------------------------
PATR_CORGL      ----------------------------------------------------------------------
HIS8_METNO      ----------------------------------------------------------------------
DAPAT_DESAH     KAQV------------------------------------------------------------------
DAPAT_CHLPN     ----------------------------------------------------------------------
ALAT2_XENLA     ----------------------------------------------------------------------
PATR_MYCVP      ----------------------------------------------------------------------
PATR_CORDI      ----------------------------------------------------------------------
KAT3_RAT        ----------------------------------------------------------------------
HIS8_PROVI      ----------------------------------------------------------------------
HIS8_PELPB      ----------------------------------------------------------------------
HIS8_MOOTA      ----------------------------------------------------------------------
HIS8_LACF3      ----------------------------------------------------------------------
AAT3_BACSU      ----------------------------------------------------------------------
1A1C_DIACA      ----------------------------------------------------------------------
1A14_SOLLC      ----------------------------------------------------------------------
1A11_PRUMU      ----------------------------------------------------------------------
KAT_DICDI       P---------------------------------------------------------------------
HIS8_METS4      ----------------------------------------------------------------------
HIS8_CHLP8      ----------------------------------------------------------------------
DAPAT_MICAN     GAEAV-----------------------------------------------------------------
DAPAT_HELMI     ----------------------------------------------------------------------
CBL_BACSU       ----------------------------------------------------------------------
1A1C_SOYBN      ----------------------------------------------------------------------
1A110_ARATH     ----------------------------------------------------------------------
HIS8_COREF      ----------------------------------------------------------------------
DAPAT_PROMP     GAEAV-----------------------------------------------------------------
DAPAT_BACV8     GAEAI-----------------------------------------------------------------
PATR_PROAC      ----------------------------------------------------------------------
HIS8_LEUCK      ----------------------------------------------------------------------
DAPAT_PROMS     GAEAVYSLEGKKQVRGL-----------------------------------------------------
HIS8_RHOPT      ----------------------------------------------------------------------
HIS8_RHOPA      ----------------------------------------------------------------------
HIS8_MYCS2      ----------------------------------------------------------------------
DAPAT_GEOBB     ----------------------------------------------------------------------
HIS8_THEPX      ----------------------------------------------------------------------
HIS8_DINSH      ----------------------------------------------------------------------
DAPAT_METTH     AAEAV-----------------------------------------------------------------
DAPAT_CYAP7     GAEAV-----------------------------------------------------------------
PATR_MYCS2      ----------------------------------------------------------------------
PATR_MYCBT      ----------------------------------------------------------------------
PATR_MYCBP      ----------------------------------------------------------------------
PATR_MYCBO      ----------------------------------------------------------------------
HIS8_HALMA      ----------------------------------------------------------------------
1A1L1_BOVIN     ----------------------------------------------------------------------
HIS8_HALLT      ----------------------------------------------------------------------
DAPAT_PROM9     GAEAVYSLEGKKEVRGL-----------------------------------------------------
DAPAT_CYAP8     GAEAV-----------------------------------------------------------------
1A18_ARATH      ----------------------------------------------------------------------
HIS8_THEP3      ----------------------------------------------------------------------
DAPAT_DESPS     KAECKELI--------------------------------------------------------------
HIS8_RHOP2      TAHV------------------------------------------------------------------
HIS8_MYCLE      ----------------------------------------------------------------------
HIS8_MYCLB      ----------------------------------------------------------------------
HIS8_BEII9      ----------------------------------------------------------------------
HIS8_BACHD      ----------------------------------------------------------------------
DAPAT_PROMT     GAEAV-----------------------------------------------------------------
DAPAT_PROM1     GAEAV-----------------------------------------------------------------
YDT4_SCHPO      ----------------------------------------------------------------------
PATR_MYCTU      ----------------------------------------------------------------------
PATR_MYCTA      ----------------------------------------------------------------------
PATR_MYCPA      ----------------------------------------------------------------------
PATR_MYCA1      ----------------------------------------------------------------------
HIS8_NITWN      TAHV------------------------------------------------------------------
DAPAT_PARD8     GAEAV-----------------------------------------------------------------
HIS8_SPHAL      ----------------------------------------------------------------------
HIS8_MARMM      ----------------------------------------------------------------------
HIS8_BREBN      ----------------------------------------------------------------------
HIS8_ANOFW      ----------------------------------------------------------------------
DAPAT_GEOSM     ----------------------------------------------------------------------
1A12_CUCMA      ----------------------------------------------------------------------
PATR_RHOSR      ----------------------------------------------------------------------
HIS8_RHOOB      ----------------------------------------------------------------------
HIS8_PARDP      ----------------------------------------------------------------------
DAPAT_CHLMU     ----------------------------------------------------------------------
ALAT_YEAST      ----------------------------------------------------------------------
HIS82_NITMU     ----------------------------------------------------------------------
HIS81_ARCFU     ----------------------------------------------------------------------
1A111_ARATH     ----------------------------------------------------------------------
YJIR_ECOLI      ----------------------------------------------------------------------
HIS8_ZYMMO      ----------------------------------------------------------------------
HIS8_HALSA      ----------------------------------------------------------------------
HIS8_HALS3      ----------------------------------------------------------------------
HIS8_AERHH      ----------------------------------------------------------------------
DAPAT_BACFR     AAEAI-----------------------------------------------------------------
DAPAT_BACFN     AAEAI-----------------------------------------------------------------
COBD_THETN      ----------------------------------------------------------------------
1A1C_MALDO      ----------------------------------------------------------------------
HIS8_SILST      ----------------------------------------------------------------------
HIS8_ROSDO      ----------------------------------------------------------------------
HIS8_NOVAD      ----------------------------------------------------------------------
HIS82_NITEU     ----------------------------------------------------------------------
DAPAT_PROM0     GAEAVYSLEGKKQVKGL-----------------------------------------------------
CBL_MYCTU       ----------------------------------------------------------------------
CBL_MYCBO       ----------------------------------------------------------------------
HIS8_STRMK      ----------------------------------------------------------------------
HIS8_ROSCS      ----------------------------------------------------------------------
HIS8_NITHX      ----------------------------------------------------------------------
HIS8_HALWD      ----------------------------------------------------------------------
HIS81_RALEJ     ----------------------------------------------------------------------
DAPAT_LAWIP     ----------------------------------------------------------------------
DAPAT_DESHD     ----------------------------------------------------------------------
HIS8_METTH      ----------------------------------------------------------------------
HIS8_CALS8      ----------------------------------------------------------------------
HIS8_BACCN      ----------------------------------------------------------------------
HIS8_AERS4      ----------------------------------------------------------------------
DAPAT_PELCD     EGETIDYYMENARL--------------------------------------------------------
DAPAT_LEPBP     GAEAV-----------------------------------------------------------------
DAPAT_LEPBA     GAEAV-----------------------------------------------------------------
DAPAT_DESHY     ----------------------------------------------------------------------
1A14_ARATH      ----------------------------------------------------------------------
YDFD_BACSU      ----------------------------------------------------------------------
HIS8_PROA2      ----------------------------------------------------------------------
HIS8_MYCTU      ----------------------------------------------------------------------
HIS8_MYCTA      ----------------------------------------------------------------------
HIS8_MYCBT      ----------------------------------------------------------------------
HIS8_MYCBP      ----------------------------------------------------------------------
HIS8_MYCBO      ----------------------------------------------------------------------
HIS8_ANADF      ----------------------------------------------------------------------
1A11_ORYSJ      ----------------------------------------------------------------------
1A11_ORYSI      ----------------------------------------------------------------------
HIS8_STRAW      ----------------------------------------------------------------------
HIS8_RHISN      ----------------------------------------------------------------------
HIS8_NOCFA      ----------------------------------------------------------------------
HIS8_BRUSU      ----------------------------------------------------------------------
HIS8_BRUO2      ----------------------------------------------------------------------
HIS8_BRUAB      ----------------------------------------------------------------------
HIS8_BRUA2      ----------------------------------------------------------------------
HIS8_AKKM8      ----------------------------------------------------------------------
PATR_MYCUA      ----------------------------------------------------------------------
PATR_MYCMM      ----------------------------------------------------------------------
PATR_CORJK      ----------------------------------------------------------------------
HIS8_TOBAC      ----------------------------------------------------------------------
HIS8_RHOS5      ----------------------------------------------------------------------
HIS8_GEOKA      ----------------------------------------------------------------------
HIS8_GEOBB      ----------------------------------------------------------------------
HIS81_RHIME     ----------------------------------------------------------------------
DAPAT_BACTN     AAEAV-----------------------------------------------------------------
DAPAT_AZOPC     GAEAV-----------------------------------------------------------------
HIS8_YERE8      ----------------------------------------------------------------------
HIS8_STRCO      ----------------------------------------------------------------------
HIS8_NICPL      ----------------------------------------------------------------------
HIS8_GEOSM      ----------------------------------------------------------------------
HIS8_ACIAC      ----------------------------------------------------------------------
HIS81_PASMU     ----------------------------------------------------------------------
CBL_MYCLE       ----------------------------------------------------------------------
1A1L1_TAKRU     ----------------------------------------------------------------------
1A1L1_HUMAN     ----------------------------------------------------------------------
YISV_BACSU      ----------------------------------------------------------------------
HIS8_VIBCM      ----------------------------------------------------------------------
HIS8_VIBCH      ----------------------------------------------------------------------
HIS8_VIBC3      ----------------------------------------------------------------------
HIS8_THEGJ      ----------------------------------------------------------------------
HIS8_RHOP5      ----------------------------------------------------------------------
HIS8_NATPD      DAHVEKTVETAR----------------------------------------------------------
HIS8_METFL      ----------------------------------------------------------------------
HIS8_RHOPB      ----------------------------------------------------------------------
HIS8_PHOPR      ----------------------------------------------------------------------
HIS8_METVS      ----------------------------------------------------------------------
HIS8_DEHE1      ----------------------------------------------------------------------
HIS8_BDEBA      ----------------------------------------------------------------------
HIS83_BURS3     ----------------------------------------------------------------------
HIS81_HAEI8     ----------------------------------------------------------------------
1A1L2_MOUSE     ----------------------------------------------------------------------
HIS8_RHOSK      ----------------------------------------------------------------------
HIS8_RHOS4      ----------------------------------------------------------------------
HIS8_RHOS1      ----------------------------------------------------------------------
HIS8_PECCP      ----------------------------------------------------------------------
HIS8_ARATH      YLEDVDALVRERRLFGL-----------------------------------------------------
HIS82_RHILO     ----------------------------------------------------------------------
1A1L1_MOUSE     ----------------------------------------------------------------------
YEY2_YEAST      ----------------------------------------------------------------------
HIS8_VIBFM      ----------------------------------------------------------------------
HIS8_METMP      ----------------------------------------------------------------------
HIS8_HAEIG      ----------------------------------------------------------------------
HIS8_BRUME      ----------------------------------------------------------------------
HIS83_RHILO     ----------------------------------------------------------------------
HIS82_THIDA     ----------------------------------------------------------------------
HIS82_CARHZ     ----------------------------------------------------------------------
HIS81_HAEIN     ----------------------------------------------------------------------
HIS8_MYCSS      ----------------------------------------------------------------------
HIS8_MYCSM      ----------------------------------------------------------------------
HIS8_MYCSK      ----------------------------------------------------------------------
HIS8_MYCSJ      ----------------------------------------------------------------------
HIS8_METM5      ----------------------------------------------------------------------
HIS8_GLUDA      ----------------------------------------------------------------------
HIS8_GEOUR      ----------------------------------------------------------------------
HIS82_BRAJA     TA--------------------------------------------------------------------
1A19_ARATH      ----------------------------------------------------------------------
PATR_RHOOB      ----------------------------------------------------------------------
HIS8_XANP2      ----------------------------------------------------------------------
HIS8_ROSS1      ----------------------------------------------------------------------
HIS8_HELHP      ----------------------------------------------------------------------
HIS8_HAEIE      ----------------------------------------------------------------------
HIS8_COLP3      ----------------------------------------------------------------------
HIS8_BLOPB      ----------------------------------------------------------------------
HIS8_VIBF1      ----------------------------------------------------------------------
HIS8_SHEON      ----------------------------------------------------------------------
HIS8_POLNA      ----------------------------------------------------------------------
HIS8_LYSSC      ----------------------------------------------------------------------
HIS8_GEOTN      ----------------------------------------------------------------------
HIS8_DEHSB      ----------------------------------------------------------------------
HIS8_BAUCH      ----------------------------------------------------------------------
HIS8_ALISL      ----------------------------------------------------------------------
HIS82_OCEIH     ----------------------------------------------------------------------
HIS81_BURS3     ----------------------------------------------------------------------
HIS8_MYCVP      ----------------------------------------------------------------------
HIS8_ERWCT      ----------------------------------------------------------------------
HIS8_BACSU      ----------------------------------------------------------------------
HIS8_VIBPA      ----------------------------------------------------------------------
HIS8_VIBHB      ----------------------------------------------------------------------
HIS8_RHOCS      ----------------------------------------------------------------------
HIS8_CORJK      ----------------------------------------------------------------------
HIS82_MANSM     ----------------------------------------------------------------------
HIS82_BACC1     ----------------------------------------------------------------------
HIS8_DEHSC      ----------------------------------------------------------------------
HIS8_AGRT5      ----------------------------------------------------------------------
YDIU_SHISS      -------------------------------PGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQLTTMDW
YDIU_SHIBS      -------------------------------PGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQLTTMDW
YDIU_SHIB3      -------------------------------PGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQLTTMDW
YDIU_ESCF3      -------------------------------PGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQLTTMDW
YDIU_ECOUT      -------------------------------PGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQLTTMDW
YDIU_ECOSE      -------------------------------PGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQLTTMDW
YDIU_ECOLI      -------------------------------PGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQLTTMDW
YDIU_ECOLC      -------------------------------PGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQLTTMDW
YDIU_ECOL6      -------------------------------PGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQLTTMDW
YDIU_ECOL5      -------------------------------PGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQLTTMDW
YDIU_ECOK1      -------------------------------PGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQLTTMDW
YDIU_ECOHS      -------------------------------PGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQLTTMDW
YDIU_ECODH      -------------------------------PGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQLTTMDW
YDIU_ECOBW      -------------------------------PGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQLTTMDW
YDIU_ECO81      -------------------------------PGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQLTTMDW
YDIU_ECO5E      -------------------------------PGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQLTTMDW
YDIU_ECO57      -------------------------------PGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQLTTMDW
YDIU_ECO55      -------------------------------PGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQLTTMDW
YDIU_ECO45      -------------------------------PGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQLTTMDW
YDIU_ECO27      -------------------------------PGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQLTTMDW
YDIU_ECO24      -------------------------------PGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQLTTMDW
HIS8_SODGM      ----------------------------------------------------------------------
HIS8_METM7      ----------------------------------------------------------------------
HIS8_MESSB      ----------------------------------------------------------------------
HIS8_LISIN      ----------------------------------------------------------------------
HIS8_KLEP3      ----------------------------------------------------------------------
HIS8_BIFLO      ----------------------------------------------------------------------
1A15_ARATH      ----------------------------------------------------------------------
YDEF_BACSU      ----------------------------------------------------------------------
HIS8_RHOPS      SAHV------------------------------------------------------------------
HIS8_METPP      ----------------------------------------------------------------------
HIS8_LISMF      ----------------------------------------------------------------------
HIS8_LISMC      ----------------------------------------------------------------------
HIS8_FRASC      ----------------------------------------------------------------------
HIS8_ENT38      ----------------------------------------------------------------------
HIS8_DESDG      ----------------------------------------------------------------------
HIS81_RHILO     ----------------------------------------------------------------------
HIS8_VIBVY      ----------------------------------------------------------------------
HIS8_VIBVU      ----------------------------------------------------------------------
HIS8_LISMH      ----------------------------------------------------------------------
HIS8_KLEP7      ----------------------------------------------------------------------
HIS8_ACEPA      ----------------------------------------------------------------------
HIS82_RALSO     ----------------------------------------------------------------------
HIS81_IDILO     ----------------------------------------------------------------------
HIS8_LISMO      ----------------------------------------------------------------------
HIS8_CLOK5      ----------------------------------------------------------------------
HIS8_CLOK1      ----------------------------------------------------------------------
HIS8_BURM1      ----------------------------------------------------------------------
HIS8_BACNA      ----------------------------------------------------------------------
COBD_SALTY      ----------------------------------------------------------------------
COBD_SALTI      ----------------------------------------------------------------------
1A13_SOLLC      ----------------------------------------------------------------------
YDIU_SALTY      -------------------------------PGMSPVAQVYSGHQFGVWAGQLGDGRGILLGEQLLASTL
YDIU_SALSV      -------------------------------PGMSPVAQVYSGHQFGVWAGQLGDGRGILLGEQLLASTL
YDIU_SALPK      -------------------------------PGMSPVAQVYSGHQFGVWAGQLGDGRGILLGEQLLASTL
YDIU_SALPC      -------------------------------PGMSPVAQVYSGHQFGVWAGQLGDGRGILLGEQLLASTL
YDIU_SALPB      -------------------------------PGMSPVAQVYSGHQFGVWAGQLGDGRGILLGEQLLASTL
YDIU_SALPA      -------------------------------PGMSPVAQVYSGHQFGVWAGQLGDGRGILLGEQLLASTL
YDIU_SALNS      -------------------------------PGMSPVAQVYSGHQFGVWAGQLGDGRGILLGEQLLASTL
YDIU_SALHS      -------------------------------PGMSPVAQVYSGHQFGVWAGQLGDGRGILLGEQLLASTL
YDIU_SALEP      -------------------------------PGMSPVAQVYSGHQFGVWAGQLGDGRGILLGEQLLASTL
YDIU_SALDC      -------------------------------PGMSPVAQVYSGHQFGVWAGQLGDGRGILLGEQLLASTL
YDIU_SALAR      -------------------------------PGMSPVAQVYSGHQFGVWAGQLGDGRGILLGEQLLASTL
YDIU_SALA4      -------------------------------PGMSPVAQVYSGHQFGVWAGQLGDGRGILLGEQLLASTL
HIS8_STRM5      ----------------------------------------------------------------------
HIS8_DIAST      ----------------------------------------------------------------------
HIS8_ACISJ      ----------------------------------------------------------------------
HIS82_NITOC     ----------------------------------------------------------------------
HIS82_ARCFU     ----------------------------------------------------------------------
HIS81_CAUCR     D----DFQDRSRAL--------------------------------------------------------
YDIU_SALTI      -------------------------------PGMSPVAQVYSGHQFGIWAGQLGDGRGILLGEQLLASTL
HIS8_SHEAM      ----------------------------------------------------------------------
HIS8_PELCD      ----------------------------------------------------------------------
HIS8_METI4      ----------------------------------------------------------------------
YDIU_ECOSM      -------------------------------PGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQQTTMDW
YDIU_ECOLU      -------------------------------PGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQRTTMDW
YDIU_ECO7I      -------------------------------PGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQQTTMDW
HIS8_YERPY      ----------------------------------------------------------------------
HIS8_YERPS      ----------------------------------------------------------------------
HIS8_YERPP      ----------------------------------------------------------------------
HIS8_YERPN      ----------------------------------------------------------------------
HIS8_YERPG      ----------------------------------------------------------------------
HIS8_YERPE      ----------------------------------------------------------------------
HIS8_YERPB      ----------------------------------------------------------------------
HIS8_YERPA      ----------------------------------------------------------------------
HIS8_YERP3      ----------------------------------------------------------------------
HIS8_METJA      ----------------------------------------------------------------------
HIS8_GEOSW      ----------------------------------------------------------------------
HIS8_GEOSL      ----------------------------------------------------------------------
HIS8_BACLD      ----------------------------------------------------------------------
HIS82_METCA     ----------------------------------------------------------------------
HIS82_HAEIN     ----------------------------------------------------------------------
HIS82_BACAN     ----------------------------------------------------------------------
CR3L3_BOVIN     ----------------------------------------------------------------------
HIS8_HALVO      ----------------------------------------------------------------------
HIS82_PSYA2     ----------------------------------------------------------------------
HIS82_PASMU     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DRYGMGVLPAVEFGESTHALRVRVATSLLYGESEAQRYSALAAEDPTALPWIRAHLDRISxxxxxxxxxx
AAT_THEAQ       --AGVAVVPGTEFAAFGH-VRLSYAT--------------------------------------------
AAT_THET8       LEAGVAVVPGTDFAAFGH-VRLSYATS-------------------------------------------
AAT_BACY2       TEANVAVIPGSGFG-APSTIRISYATSLNLIEEAIER---------------------------------
AAT1_BACSU      EEEKVAIVPGSGFG-SPENVRLSYATSLDLLEEAIER---------------------------------
AAT_AQUAE       EKAKVAVVPGSAFG--------------------------------------------------------
AAT_BACST       ----------------------------------------------------------------------
AATA_RHIME      ETEGVAVVHGSAFGLGPN-FRISYATSEALLEEACRRIQRFCA---------------------------
AAT_SYNY3       ESHQVAVIPGAAFG-ADDCVRFSYATTIKQGLAELERFVSTLA---------------------------
AAT_PYRHO       EKARVVVIPGTAFGRMGEGVRISYATS-------------------------------------------
AAT_PYRAB       MEAKVAVVPGSAFGKAGEGY-VRISYATAYEKLE------------------------------------
AAT_RHILP       ESEGVAVVHGSAFGLGPN-FRISYATS-------------------------------------------
AATB1_RHIME     EDAHVAVVPGSAFGLSPF-FRISYATS--------------EAELKEALERIAAACDRLS----------
AAT_SULSO       ----------------------------------------------------------------------
AAT_STRVG       DEVEVAVVPGEAFGTPGY-LRLSYAEDLVEGVSRIQKLLAEA----------------------------
AAT_SULTO       EEKGVTTIPGEVF---------------------------------------------------------
AATB2_RHIME     EDSHVAVVPGSAFGLSPY-FRISYATSEAELKEALERISA------------------------------
AAT_MYCTU       ----------------------------------------------------------------------
AAT_MYCBO       ----------------------------------------------------------------------
AAT_THEMA       ----------------------------------------------------------------------
AAT1_METJA      ENKVLCV-PGVAFGEN------------------------------------------------------
AAT_RICCN       EEAKVAVVPGIAFGLEGY-FRISYATSM------------------------------------------
AAT_RICFE       EEAKVAVVPGIAFGLEGY-FRISYATSM------------------------------------------
AAT_RICBR       EEAKVAVVPGIAFGLEGY-FRISYATSM------------------------------------------
AAT_SULAC       ----------------------------------------------------------------------
DAPAT_NATTJ     TKTGVVVTPGIGFGK-------------------------------------------------------
AAT_RICTY       EEAKVAVVPGVAFGLDGY-FRISYATSM------------------------------------------
AAT_RICPR       EEAKVAVVPGIAFGLDGY-FRISYATSM------------------------------------------
AAT_PYRKO       SR-GVAVFPGMAFGDYPNFIRISLS---------------------------------------------
DAPT2_ANAVT     DK--------------------------------------------------------------------
DAPAT_MOOTA     EKAGVIITP-------------------------------------------------------------
DAPT2_ANASP     DKCGIVVPPGVGYGAS------------------------------------------------------
DAPAT_SYNFM     ----------------------------------------------------------------------
DAPAT_GLOVI     ----------------------------------------------------------------------
YFBQ_SHIFL      ----------------------------------------------------------------------
YFBQ_ECOLI      ----------------------------------------------------------------------
YFBQ_ECOL6      ----------------------------------------------------------------------
DAPAT_DESVV     ET-GVVVTPGNGFG--------------------------------------------------------
DAPAT_DESVH     ET-GVVVTPGNGFG--------------------------------------------------------
Y286_HAEIN      ----------------------------------------------------------------------
DAPAT_AQUAE     ----------------------------------------------------------------------
DAPAT_CARHZ     ----------------------------------------------------------------------
PATA_BACSU      EDAGVALVPGSSF---------------------------------------------------------
DAPAT_DESDG     ----------------------------------------------------------------------
1A112_ARATH     ----------------------------------------------------------------------
DAPAT_PROMA     ----------------------------------------------------------------------
ATTY_TRYCR      ----------------------------------------------------------------------
DAPAT_DESAD     KETGVVVTPGNGFGES------------------------------------------------------
HIS8_GRABC      ----------------------------------------------------------------------
DAPAT_EUBE2     ----------------------------------------------------------------------
PATR_STRCO      ----------------------------------------------------------------------
DAPAT_HALOH     ----------------------------------------------------------------------
DAPAT_SYNPW     ----------------------------------------------------------------------
AAT2_METJA      KEKFVALTPGIGFGKGKNYIRISYANS-------------------------------------------
DAPAT_SYNS9     ----------------------------------------------------------------------
DAPAT_DESVM     EKTGVVLTPGNGFG--------------------------------------------------------
YFDZ_ECOLI      NEAKVCVSPGIGFGD-------------------------------------------------------
DAPAT_DEHSC     ----------------------------------------------------------------------
DAPAT_DEHSB     ----------------------------------------------------------------------
PATR_STRAW      ----------------------------------------------------------------------
ATTY_MOUSE      ----------------------------------------------------------------------
DAPAT_SYNR3     ----------------------------------------------------------------------
DAPAT_DEHE1     ----------------------------------------------------------------------
YBDL_ECOLI      ----------------------------------------------------------------------
KAT3_DANRE      ----------------------------------------------------------------------
DAPAT_ARATH     ----------------------------------------------------------------------
ATTY_RAT        ----------------------------------------------------------------------
KAT1_HUMAN      KNKGLVAIPVSIFYSVPH----------------------------------------------------
PATR_STRGG      ----------------------------------------------------------------------
KAT1_MOUSE      KNKGLSAIPVSTFYSQPH----------------------------------------------------
DAPAT_PROM4     ----------------------------------------------------------------------
ATTY_HUMAN      ----------------------------------------------------------------------
Y1391_METJA     ----------------------------------------------------------------------
AATC_RHIME      EKADVAVAPGIGFGE-------------------------------------------------------
ALA2_HORVU      ----------------------------------------------------------------------
DAPAT_SYNS3     ----------------------------------------------------------------------
BNA3_YEAST      NELGVVAIPPTEFYIKEHLLRFAVCKDDAYLENAVERLKLL-----------------------------
KAT1_RAT        ----------------------------------------------------------------------
HIS8_LACPL      ----------------------------------------------------------------------
HIS8_ARTAT      ----------------------------------------------------------------------
DAPAT_NOSP7     ----------------------------------------------------------------------
HIS8_MAGSA      ----------------------------------------------------------------------
ATTY_DICDI      ----------------------------------------------------------------------
ATTY_BOVIN      ----------------------------------------------------------------------
ALA2_PANMI      ----------------------------------------------------------------------
DAPAT_DESOH     ----------------------------------------------------------------------
Y104_SULSO      ----------------------------------------------------------------------
PATR_LEIXX      ----------------------------------------------------------------------
HIS8_METAC      ----------------------------------------------------------------------
1A1L2_HUMAN     ----------------------------------------------------------------------
DAPAT_CYAP4     ----------------------------------------------------------------------
PATR_MYCSS      ----------------------------------------------------------------------
PATR_MYCSK      ----------------------------------------------------------------------
PATR_MYCSJ      ----------------------------------------------------------------------
HIS8_CHLPD      ----------------------------------------------------------------------
DAPAT_THEEB     ----------------------------------------------------------------------
AAT2_BACSU      ----------------------------------------------------------------------
HIS8_MYCUA      ----------------------------------------------------------------------
DAPAT_DESDA     ----------------------------------------------------------------------
HIS8_RHORT      ----------------------------------------------------------------------
HIS8_MYCMM      ----------------------------------------------------------------------
HIS8_CORDI      ----------------------------------------------------------------------
DAPAT_SYNP6     ----------------------------------------------------------------------
DAPAT_SYNE7     ----------------------------------------------------------------------
DAPAT_PROM3     ----------------------------------------------------------------------
HIS8_METMA      ----------------------------------------------------------------------
HIS8_LEUMM      ----------------------------------------------------------------------
DAPAT_CHLFF     ----------------------------------------------------------------------
ALAT1_HUMAN     ----------------------------------------------------------------------
ALAT1_BOVIN     ----------------------------------------------------------------------
KAT3_MOUSE      ----------------------------------------------------------------------
KAT3_BOVIN      ----------------------------------------------------------------------
HIS8_METBF      ----------------------------------------------------------------------
DAPAT_SYNPX     ----------------------------------------------------------------------
DAPAT_PARUW     ----------------------------------------------------------------------
DAPAT_SYNY3     ----------------------------------------------------------------------
DAPAT_GEOSF     ----------------------------------------------------------------------
HIS8_RHOSR      ----------------------------------------------------------------------
HIS8_PELLD      ----------------------------------------------------------------------
DAPAT_TRIEI     ----------------------------------------------------------------------
DAPAT_SYNJB     ----------------------------------------------------------------------
DAPAT_SYNJA     ----------------------------------------------------------------------
DAPAT_DESAP     ----------------------------------------------------------------------
DAPAT_ACAM1     ----------------------------------------------------------------------
DAPAT_PROMM     ----------------------------------------------------------------------
AAT_STRGR       ----------------------------------------------------------------------
HIS8_UNCMA      ----------------------------------------------------------------------
HIS8_SYMTH      ----------------------------------------------------------------------
HIS8_RUBXD      ----------------------------------------------------------------------
DAPAT_SYNP2     ----------------------------------------------------------------------
ALAT2_MOUSE     ----------------------------------------------------------------------
DAPAT_LEPBL     ----------------------------------------------------------------------
DAPAT_LEPBJ     ----------------------------------------------------------------------
ALAT2_HUMAN     ----------------------------------------------------------------------
PATR_MYCA9      ----------------------------------------------------------------------
HIS8_CORGL      ----------------------------------------------------------------------
DAPAT_EUBR3     ----------------------------------------------------------------------
DAPAT_CHLTB     ----------------------------------------------------------------------
DAPAT_CHLT2     ----------------------------------------------------------------------
1A12_CUCPE      ----------------------------------------------------------------------
HIS8_CORGB      ----------------------------------------------------------------------
DAPAT_LEPIC     ----------------------------------------------------------------------
DAPAT_CHLTR     ----------------------------------------------------------------------
DAPAT_CHLTA     ----------------------------------------------------------------------
ALAT1_MOUSE     ----------------------------------------------------------------------
HIS8_ACICJ      ----------------------------------------------------------------------
DAPAT_SYNSC     ----------------------------------------------------------------------
DAPAT_CHLAB     ----------------------------------------------------------------------
1A1C_TOBAC      ----------------------------------------------------------------------
PATR_THEFY      ----------------------------------------------------------------------
ALAM_YEAST      ----------------------------------------------------------------------
HIS8_DESHY      ----------------------------------------------------------------------
DAPT1_ANAVT     ----------------------------------------------------------------------
DAPAT_LEPIN     ----------------------------------------------------------------------
1A11_CUCPE      ----------------------------------------------------------------------
Y1527_METMP     ----------------------------------------------------------------------
DAPAT_CHLCV     ----------------------------------------------------------------------
ALAT1_RAT       ----------------------------------------------------------------------
KAT3_HUMAN      ----------------------------------------------------------------------
1A12_ARATH      DRVKLNVSPGSSF---------------------------------------------------------
MTNE_BACSU      ----------------------------------------------------------------------
HIS8_MYCPA      ----------------------------------------------------------------------
HIS8_MYCA1      ----------------------------------------------------------------------
HIS8_CHLL2      ----------------------------------------------------------------------
DAPT1_ANASP     ----------------------------------------------------------------------
ALAT_SCHPO      ----------------------------------------------------------------------
ALAT2_XENTR     ----------------------------------------------------------------------
ALAM_DICDI      ----------------------------------------------------------------------
Y1479_METJA     ----------------------------------------------------------------------
PATR_CORGB      ----------------------------------------------------------------------
DAPAT_GEOMG     ----------------------------------------------------------------------
1A17_ARATH      ----------------------------------------------------------------------
HIS8_RHOBA      ----------------------------------------------------------------------
DAPAT_PELPD     ----------------------------------------------------------------------
DAPAT_GEOUR     ----------------------------------------------------------------------
ALAT2_DANRE     EETGICLVPGSGFGEGTYHFRMTI----------------------------------------------
1A11_CUCMA      ----------------------------------------------------------------------
HIS8_CHLTE      ----------------------------------------------------------------------
HIS8_AZOC5      ----------------------------------------------------------------------
DAPAT_PROM5     ----------------------------------------------------------------------
DAPAT_GEOLS     ----------------------------------------------------------------------
DAPAT_CLOPH     ----------------------------------------------------------------------
1A16_ARATH      ----------------------------------------------------------------------
HIS8_SILPO      ----------------------------------------------------------------------
DAPAT_GEOSL     ----------------------------------------------------------------------
DAPAT_CYAA5     TTHVVGT-PGSGFG--------------------------------------------------------
DAPAT_CLOTH     ----------------------------------------------------------------------
1A1C_PHAAU      ----------------------------------------------------------------------
1A12_SOLLC      ----------------------------------------------------------------------
PATR_CORGL      ----------------------------------------------------------------------
HIS8_METNO      ----------------------------------------------------------------------
DAPAT_DESAH     ----------------------------------------------------------------------
DAPAT_CHLPN     ----------------------------------------------------------------------
ALAT2_XENLA     ----------------------------------------------------------------------
PATR_MYCVP      ----------------------------------------------------------------------
PATR_CORDI      ----------------------------------------------------------------------
KAT3_RAT        ----------------------------------------------------------------------
HIS8_PROVI      ----------------------------------------------------------------------
HIS8_PELPB      ----------------------------------------------------------------------
HIS8_MOOTA      ----------------------------------------------------------------------
HIS8_LACF3      ----------------------------------------------------------------------
AAT3_BACSU      ----------------------------------------------------------------------
1A1C_DIACA      ----------------------------------------------------------------------
1A14_SOLLC      ----------------------------------------------------------------------
1A11_PRUMU      ----------------------------------------------------------------------
KAT_DICDI       ----------------------------------------------------------------------
HIS8_METS4      ----------------------------------------------------------------------
HIS8_CHLP8      ----------------------------------------------------------------------
DAPAT_MICAN     ----------------------------------------------------------------------
DAPAT_HELMI     ----------------------------------------------------------------------
CBL_BACSU       ----------------------------------------------------------------------
1A1C_SOYBN      ----------------------------------------------------------------------
1A110_ARATH     ----------------------------------------------------------------------
HIS8_COREF      ----------------------------------------------------------------------
DAPAT_PROMP     ----------------------------------------------------------------------
DAPAT_BACV8     ----------------------------------------------------------------------
PATR_PROAC      ----------------------------------------------------------------------
HIS8_LEUCK      ----------------------------------------------------------------------
DAPAT_PROMS     ----------------------------------------------------------------------
HIS8_RHOPT      ----------------------------------------------------------------------
HIS8_RHOPA      ----------------------------------------------------------------------
HIS8_MYCS2      ----------------------------------------------------------------------
DAPAT_GEOBB     ----------------------------------------------------------------------
HIS8_THEPX      ----------------------------------------------------------------------
HIS8_DINSH      ----------------------------------------------------------------------
DAPAT_METTH     ----------------------------------------------------------------------
DAPAT_CYAP7     ----------------------------------------------------------------------
PATR_MYCS2      ----------------------------------------------------------------------
PATR_MYCBT      ----------------------------------------------------------------------
PATR_MYCBP      ----------------------------------------------------------------------
PATR_MYCBO      ----------------------------------------------------------------------
HIS8_HALMA      ----------------------------------------------------------------------
1A1L1_BOVIN     ----------------------------------------------------------------------
HIS8_HALLT      ----------------------------------------------------------------------
DAPAT_PROM9     ----------------------------------------------------------------------
DAPAT_CYAP8     ----------------------------------------------------------------------
1A18_ARATH      ----------------------------------------------------------------------
HIS8_THEP3      ----------------------------------------------------------------------
DAPAT_DESPS     ----------------------------------------------------------------------
HIS8_RHOP2      ----------------------------------------------------------------------
HIS8_MYCLE      ----------------------------------------------------------------------
HIS8_MYCLB      ----------------------------------------------------------------------
HIS8_BEII9      ----------------------------------------------------------------------
HIS8_BACHD      ----------------------------------------------------------------------
DAPAT_PROMT     ----------------------------------------------------------------------
DAPAT_PROM1     ----------------------------------------------------------------------
YDT4_SCHPO      ----------------------------------------------------------------------
PATR_MYCTU      ----------------------------------------------------------------------
PATR_MYCTA      ----------------------------------------------------------------------
PATR_MYCPA      ----------------------------------------------------------------------
PATR_MYCA1      ----------------------------------------------------------------------
HIS8_NITWN      ----------------------------------------------------------------------
DAPAT_PARD8     ----------------------------------------------------------------------
HIS8_SPHAL      ----------------------------------------------------------------------
HIS8_MARMM      ----------------------------------------------------------------------
HIS8_BREBN      ----------------------------------------------------------------------
HIS8_ANOFW      ----------------------------------------------------------------------
DAPAT_GEOSM     ----------------------------------------------------------------------
1A12_CUCMA      ----------------------------------------------------------------------
PATR_RHOSR      ----------------------------------------------------------------------