[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ56580.1

[Show Plain Result]


## Summary of Sequence Search
    1::385
   13::378     5e-88  58%  429 aa  PURK_MYCTU RecName: Full=Phosphoribosylaminoimidazole carboxylase
   13::378     5e-88  58%  429 aa  PURK_MYCBO RecName: Full=Phosphoribosylaminoimidazole carboxylase
   22::386     1e-78  46%  413 aa  PURK_CORAM RecName: Full=Phosphoribosylaminoimidazole carboxylase
   14::384     8e-74  50%  439 aa  PURK_MYCLE RecName: Full=Phosphoribosylaminoimidazole carboxylase
   12::361     4e-53  41%  395 aa  PURK_SYNE7 RecName: Full=Phosphoribosylaminoimidazole carboxylase
    5::362     2e-43  33%  557 aa  PUR6_DEBOC RecName: Full=Phosphoribosylaminoimidazole carboxylase; 
    6::365     4e-43  34%  571 aa  PUR6_YEAST RecName: Full=Phosphoribosylaminoimidazole carboxylase; 
    6::363     1e-42  36%  543 aa  PUR6_PICME RecName: Full=Phosphoribosylaminoimidazole carboxylase; 
    6::364     1e-42  34%  570 aa  PUR6_CANGA RecName: Full=Phosphoribosylaminoimidazole carboxylase; 
   11::354     6e-40  38%  380 aa  PURK_BACSU RecName: Full=Phosphoribosylaminoimidazole carboxylase
   64::366     1e-38  34%  552 aa  PUR6_SCHPO RecName: Full=Phosphoribosylaminoimidazole carboxylase; 
    5::344     1e-38  38%  377 aa  PURK_VIBVY RecName: Full=Phosphoribosylaminoimidazole carboxylase
    5::344     2e-38  38%  377 aa  PURK_VIBVU RecName: Full=Phosphoribosylaminoimidazole carboxylase
    8::364     5e-38  34%  388 aa  PURK_SYNY3 RecName: Full=Phosphoribosylaminoimidazole carboxylase
    5::344     7e-38  34%  377 aa  PURK_VIBCH RecName: Full=Phosphoribosylaminoimidazole carboxylase
    6::365     6e-36  32%  568 aa  PUR6_CANAL RecName: Full=Phosphoribosylaminoimidazole carboxylase; 
    5::347     3e-35  31%  370 aa  PURK_VIBF1 RecName: Full=Phosphoribosylaminoimidazole carboxylase
    3::339     7e-35  32%  360 aa  PURK_PSEAE RecName: Full=Phosphoribosylaminoimidazole carboxylase
    5::346     9e-35  33%  377 aa  PURK_VIBPA RecName: Full=Phosphoribosylaminoimidazole carboxylase
    7::371     2e-34  32%  582 aa  PUR6_CRYNE RecName: Full=Phosphoribosylaminoimidazole carboxylase; 
   12::355     6e-34  31%  362 aa  PURK_BRUME RecName: Full=Phosphoribosylaminoimidazole carboxylase
    7::371     8e-34  30%  582 aa  PUR6_CRYNV RecName: Full=Phosphoribosylaminoimidazole carboxylase; 
   17::361     2e-33  33%  557 aa  PUR6_VIGAC RecName: Full=Phosphoribosylaminoimidazole carboxylase,
    4::334     4e-33  31%  365 aa  PURK_AQUAE RecName: Full=Phosphoribosylaminoimidazole carboxylase
   12::360     1e-30  27%  375 aa  PURK_STAS1 RecName: Full=Phosphoribosylaminoimidazole carboxylase
   12::358     4e-30  28%  375 aa  PURK_STAES RecName: Full=Phosphoribosylaminoimidazole carboxylase
   12::358     5e-30  28%  375 aa  PURK_STAEQ RecName: Full=Phosphoribosylaminoimidazole carboxylase
   12::355     9e-30  28%  374 aa  PURK_STAHJ RecName: Full=Phosphoribosylaminoimidazole carboxylase
   84::327     4e-29  34%  362 aa  PURK_HAEIN RecName: Full=Phosphoribosylaminoimidazole carboxylase
    4::324     6e-29  35%  355 aa  PURK_ECOLI RecName: Full=Phosphoribosylaminoimidazole carboxylase
   12::358     1e-28  28%  374 aa  PURK_STAAW RecName: Full=Phosphoribosylaminoimidazole carboxylase
   12::358     1e-28  28%  374 aa  PURK_STAAS RecName: Full=Phosphoribosylaminoimidazole carboxylase
   12::358     1e-28  28%  374 aa  PURK_STAAC RecName: Full=Phosphoribosylaminoimidazole carboxylase
   12::358     1e-28  26%  374 aa  PURK_STAAR RecName: Full=Phosphoribosylaminoimidazole carboxylase
   12::358     2e-28  28%  374 aa  PURK_STAAN RecName: Full=Phosphoribosylaminoimidazole carboxylase
   12::358     2e-28  28%  374 aa  PURK_STAAM RecName: Full=Phosphoribosylaminoimidazole carboxylase
    9::343     3e-25  34%  365 aa  PURK_SULSO RecName: Full=Phosphoribosylaminoimidazole carboxylase
   16::373     2e-15  29%  394 aa  PURT_PELPD RecName: Full=Phosphoribosylglycinamide
    8::360     5e-15  26%  389 aa  PURT_SYNS3 RecName: Full=Phosphoribosylglycinamide
   15::372     3e-14  25%  393 aa  PURT_PELCD RecName: Full=Phosphoribosylglycinamide
   67::305     3e-13  27%  389 aa  PURT_BACV8 RecName: Full=Phosphoribosylglycinamide
   15::370     4e-13  24%  388 aa  PURT_METM7 RecName: Full=Phosphoribosylglycinamide
   15::370     8e-13  24%  388 aa  PURT_METMP RecName: Full=Phosphoribosylglycinamide
   13::317     1e-12  25%  391 aa  PURT_SYNY3 RecName: Full=Phosphoribosylglycinamide
   66::361     1e-12  25%  388 aa  PURT_BACTN RecName: Full=Phosphoribosylglycinamide
  117::367     2e-12  27%  389 aa  PURT_SYNPW RecName: Full=Phosphoribosylglycinamide
   76::379     2e-12  26%  398 aa  PURT_SULAC RecName: Full=Phosphoribosylglycinamide
   15::310     4e-12  25%  388 aa  PURT_METVS RecName: Full=Phosphoribosylglycinamide
   91::368     5e-12  27%  392 aa  PURT_SYNS9 RecName: Full=Phosphoribosylglycinamide
    7::365     8e-12  25%  392 aa  PURT_CHLTE RecName: Full=Phosphoribosylglycinamide
   75::370     1e-11  24%  388 aa  PURT_METM5 RecName: Full=Phosphoribosylglycinamide
   16::365     1e-11  24%  391 aa  PURT_META3 RecName: Full=Phosphoribosylglycinamide
   13::372     2e-11  25%  392 aa  PURT_GEOMG RecName: Full=Phosphoribosylglycinamide
   70::360     5e-11  23%  393 aa  PURT_PROMA RecName: Full=Phosphoribosylglycinamide
   16::311     5e-11  25%  388 aa  PURT_NITSB RecName: Full=Phosphoribosylglycinamide
   73::370     3e-10  24%  389 aa  PURT_METJA RecName: Full=Phosphoribosylglycinamide
  117::367     4e-10  29%  388 aa  PURT_SYNPX RecName: Full=Phosphoribosylglycinamide
    7::366     4e-10  24%  389 aa  PURT_CHLPD RecName: Full=Phosphoribosylglycinamide
  116::360     5e-10  29%  388 aa  PURT_PROMM RecName: Full=Phosphoribosylglycinamide
    1::363     6e-10  23%  391 aa  PURT_ANAVT RecName: Full=Phosphoribosylglycinamide
   15::366     8e-10  23%  393 aa  PURT_PASMU RecName: Full=Phosphoribosylglycinamide
  182::358     1e-09  28%  387 aa  PURT_LEPBL RecName: Full=Phosphoribosylglycinamide
  182::358     1e-09  28%  387 aa  PURT_LEPBJ RecName: Full=Phosphoribosylglycinamide
   17::374     1e-09  22%  393 aa  PURT_DESMR RecName: Full=Phosphoribosylglycinamide
   77::372     1e-09  21%  393 aa  PURT_THICR RecName: Full=Phosphoribosylglycinamide
  117::360     1e-09  26%  392 aa  PURT_SYNSC RecName: Full=Phosphoribosylglycinamide
   66::304     1e-09  25%  388 aa  PURT_BACFN RecName: Full=Phosphoribosylglycinamide
   17::374     2e-09  23%  393 aa  PURT_DESVV RecName: Full=Phosphoribosylglycinamide
   17::374     2e-09  23%  393 aa  PURT_DESVH RecName: Full=Phosphoribosylglycinamide
    1::363     3e-09  23%  391 aa  PURT_ANASP RecName: Full=Phosphoribosylglycinamide
   67::369     3e-09  27%  387 aa  PURT_ANADE RecName: Full=Phosphoribosylglycinamide
   77::366     4e-09  24%  393 aa  PURT_HAES1 RecName: Full=Phosphoribosylglycinamide
   84::366     4e-09  25%  393 aa  PURT_AZOSB RecName: Full=Phosphoribosylglycinamide
   81::302     5e-09  27%  386 aa  PURT_FLAPJ RecName: Full=Phosphoribosylglycinamide
   69::369     5e-09  25%  390 aa  PURT_ERYLH RecName: Full=Phosphoribosylglycinamide
   63::378     7e-09  26%  399 aa  PURT_BIFLO RecName: Full=Phosphoribosylglycinamide
   15::373     9e-09  25%  392 aa  PURT_SALAR RecName: Full=Phosphoribosylglycinamide
  117::360     9e-09  28%  392 aa  PURT_PROM3 RecName: Full=Phosphoribosylglycinamide
   66::304     9e-09  25%  388 aa  PURT_BACFR RecName: Full=Phosphoribosylglycinamide
   15::355     9e-09  23%  392 aa  PURT_AERHH RecName: Full=Phosphoribosylglycinamide
   17::373     1e-08  23%  393 aa  PURT_DESDG RecName: Full=Phosphoribosylglycinamide
   15::366     1e-08  22%  393 aa  PURT_MANSM RecName: Full=Phosphoribosylglycinamide
  260::361     1e-08  33%  386 aa  PURT_FRATW RecName: Full=Phosphoribosylglycinamide
  260::361     1e-08  33%  386 aa  PURT_FRATT RecName: Full=Phosphoribosylglycinamide
  260::361     1e-08  33%  386 aa  PURT_FRATN RecName: Full=Phosphoribosylglycinamide
  260::361     1e-08  33%  386 aa  PURT_FRAT1 RecName: Full=Phosphoribosylglycinamide
   20::366     1e-08  28%  411 aa  PURT_CORJK RecName: Full=Phosphoribosylglycinamide
   69::312     1e-08  25%  384 aa  PURT_BACA2 RecName: Full=Phosphoribosylglycinamide
  263::364     2e-08  36%  393 aa  PURT_SYNR3 RecName: Full=Phosphoribosylglycinamide
   84::372     2e-08  29%  393 aa  PURT_PSEU5 RecName: Full=Phosphoribosylglycinamide
   96::379     2e-08  23%  401 aa  PURT_HALWD RecName: Full=Phosphoribosylglycinamide
  264::363     3e-08  30%  391 aa  PURT_SYNP6 RecName: Full=Phosphoribosylglycinamide
  264::363     3e-08  30%  391 aa  PURT_SYNE7 RecName: Full=Phosphoribosylglycinamide
   21::387     3e-08  27%  429 aa  PURT_PYRFU RecName: Full=Phosphoribosylglycinamide
   18::322     3e-08  25%  404 aa  PURT_BURXL RecName: Full=Phosphoribosylglycinamide
   83::310     4e-08  23%  387 aa  PURT_SULNB RecName: Full=Phosphoribosylglycinamide
   15::333     4e-08  22%  392 aa  PURT_AERS4 RecName: Full=Phosphoribosylglycinamide
  108::258     4e-08  31% 1065 aa  CARB_LYSSC RecName: Full=Carbamoyl-phosphate synthase large chain; 
   16::310     6e-08  24%  387 aa  PURT_SULDN RecName: Full=Phosphoribosylglycinamide
   73::371     7e-08  21%  390 aa  PURT_PROMP RecName: Full=Phosphoribosylglycinamide
  260::361     7e-08  32%  386 aa  PURT_FRATO RecName: Full=Phosphoribosylglycinamide
  260::361     7e-08  32%  386 aa  PURT_FRATH RecName: Full=Phosphoribosylglycinamide
  260::361     7e-08  32%  386 aa  PURT_FRATF RecName: Full=Phosphoribosylglycinamide
   15::366     7e-08  22%  393 aa  PURT_ACTPJ RecName: Full=Phosphoribosylglycinamide
  268::378     1e-07  33%  400 aa  PURT_XANC5 RecName: Full=Phosphoribosylglycinamide
   84::373     1e-07  25%  392 aa  PURT_SALPC RecName: Full=Phosphoribosylglycinamide
   84::373     1e-07  25%  392 aa  PURT_SALCH RecName: Full=Phosphoribosylglycinamide
   81::369     1e-07  22%  390 aa  PURT_MARAV RecName: Full=Phosphoribosylglycinamide
   15::366     1e-07  22%  393 aa  PURT_HAEDU RecName: Full=Phosphoribosylglycinamide
   96::371     1e-07  26%  400 aa  PURT_XANCP RecName: Full=Phosphoribosylglycinamide
   96::371     1e-07  26%  400 aa  PURT_XANCB RecName: Full=Phosphoribosylglycinamide
   96::371     1e-07  26%  400 aa  PURT_XANC8 RecName: Full=Phosphoribosylglycinamide
   17::366     1e-07  24%  395 aa  PURT_STRM5 RecName: Full=Phosphoribosylglycinamide
   73::380     2e-07  28%  401 aa  PURT_RALEJ RecName: Full=Phosphoribosylglycinamide
  126::304     2e-07  26%  387 aa  PURT_LEPIN RecName: Full=Phosphoribosylglycinamide
  126::304     2e-07  26%  387 aa  PURT_LEPIC RecName: Full=Phosphoribosylglycinamide
   70::378     2e-07  24%  400 aa  PURT_XANAC RecName: Full=Phosphoribosylglycinamide
  264::371     2e-07  29%  391 aa  PURT_PROM9 RecName: Full=Phosphoribosylglycinamide
  264::371     2e-07  31%  391 aa  PURT_PROM0 RecName: Full=Phosphoribosylglycinamide
   15::380     2e-07  26%  400 aa  PURT_MYCVP RecName: Full=Phosphoribosylglycinamide
   15::380     2e-07  26%  400 aa  PURT_MYCGI RecName: Full=Phosphoribosylglycinamide
   21::385     3e-07  27%  430 aa  PURT_PYRHO RecName: Full=Phosphoribosylglycinamide
   71::371     3e-07  22%  390 aa  PURT_PROM5 RecName: Full=Phosphoribosylglycinamide
  705::873     3e-07  26% 1160 aa  CARB_SCHPO RecName: Full=Carbamoyl-phosphate synthase
  101::258     3e-07  27% 1069 aa  CARB_CLOBA RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     3e-07  29% 1071 aa  CARB_BACSU RecName: Full=Carbamoyl-phosphate synthase
   17::366     4e-07  24%  395 aa  PURT_STRMK RecName: Full=Phosphoribosylglycinamide
   84::373     4e-07  24%  392 aa  PURT_SALPB RecName: Full=Phosphoribosylglycinamide
   84::373     4e-07  24%  392 aa  PURT_SALNS RecName: Full=Phosphoribosylglycinamide
   85::328     4e-07  29%  402 aa  PURT_IGNH4 RecName: Full=Phosphoribosylglycinamide
  110::379     4e-07  27%  399 aa  PURT_BIFAA RecName: Full=Phosphoribosylglycinamide
   15::366     4e-07  21%  393 aa  PURT_ACTP7 RecName: Full=Phosphoribosylglycinamide
   15::366     4e-07  21%  393 aa  PURT_ACTP2 RecName: Full=Phosphoribosylglycinamide
  661::729     4e-07  35% 1113 aa  CARB_ASHGO RecName: Full=Carbamoyl-phosphate synthase
  132::385     5e-07  31%  429 aa  PURT_PYRKO RecName: Full=Phosphoribosylglycinamide
  266::365     5e-07  29%  392 aa  PURT_PASHA RecName: Full=Phosphoribosylglycinamide
   15::320     5e-07  29%  392 aa  PURT_ERWT9 RecName: Full=Phosphoribosylglycinamide
  267::374     5e-07  29%  393 aa  PURT_DESAD RecName: Full=Phosphoribosylglycinamide
  101::258     5e-07  27% 1069 aa  CARB_CLOBB RecName: Full=Carbamoyl-phosphate synthase large chain; 
   84::373     6e-07  24%  392 aa  PURT_SALTY RecName: Full=Phosphoribosylglycinamide
   84::373     6e-07  24%  392 aa  PURT_SALTI RecName: Full=Phosphoribosylglycinamide
   84::373     6e-07  24%  392 aa  PURT_SALSV RecName: Full=Phosphoribosylglycinamide
   84::373     6e-07  24%  392 aa  PURT_SALPK RecName: Full=Phosphoribosylglycinamide
   84::373     6e-07  24%  392 aa  PURT_SALPA RecName: Full=Phosphoribosylglycinamide
   84::373     6e-07  24%  392 aa  PURT_SALDC RecName: Full=Phosphoribosylglycinamide
   81::387     6e-07  28%  429 aa  PURT_PYRAB RecName: Full=Phosphoribosylglycinamide
  101::258     6e-07  26% 1057 aa  CARB_STAES RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     6e-07  26% 1057 aa  CARB_STAEQ RecName: Full=Carbamoyl-phosphate synthase large chain; 
  264::365     8e-07  31%  391 aa  PURT_PROMS RecName: Full=Phosphoribosylglycinamide
   84::366     8e-07  26%  393 aa  PURT_AZOVD RecName: Full=Phosphoribosylglycinamide
  108::258     8e-07  29% 1065 aa  CARB_BACCL RecName: Full=Carbamoyl-phosphate synthase
  267::364     1e-06  29%  394 aa  PURT_TOLAT RecName: Full=Phosphoribosylglycinamide
   73::380     1e-06  27%  401 aa  PURT_RALEH RecName: Full=Phosphoribosylglycinamide
  267::368     1e-06  31%  400 aa  PURT_HAHCH RecName: Full=Phosphoribosylglycinamide
  121::242     1e-06  26% 1056 aa  CARB_LACRJ RecName: Full=Carbamoyl-phosphate synthase large chain; 
  121::242     1e-06  26% 1056 aa  CARB_LACRD RecName: Full=Carbamoyl-phosphate synthase large chain; 
  267::363     1e-06  30%  393 aa  PURT_VIBCM RecName: Full=Phosphoribosylglycinamide
  265::361     1e-06  30%  391 aa  PURT_VIBCH RecName: Full=Phosphoribosylglycinamide
  123::384     1e-06  27%  403 aa  PURT_RHOSR RecName: Full=Phosphoribosylglycinamide
   73::380     1e-06  28%  400 aa  PURT_RALME RecName: Full=Phosphoribosylglycinamide
  267::366     1e-06  30%  393 aa  PURT_PSEU2 RecName: Full=Phosphoribosylglycinamide
  267::366     1e-06  30%  393 aa  PURT_PSESM RecName: Full=Phosphoribosylglycinamide
   84::366     1e-06  21%  393 aa  PURT_PSEPK RecName: Full=Phosphoribosylglycinamide
  267::366     1e-06  30%  393 aa  PURT_PSEFS RecName: Full=Phosphoribosylglycinamide
  267::366     1e-06  30%  393 aa  PURT_PSE14 RecName: Full=Phosphoribosylglycinamide
  265::364     1e-06  32%  391 aa  PURT_PHOPR RecName: Full=Phosphoribosylglycinamide
  117::372     1e-06  24%  393 aa  PURT_DESVM RecName: Full=Phosphoribosylglycinamide
   73::380     1e-06  31%  401 aa  PURT_CUPTR RecName: Full=Phosphoribosylglycinamide
  268::378     2e-06  32%  400 aa  PURT_XANOP RecName: Full=Phosphoribosylglycinamide
  267::366     2e-06  29%  393 aa  PURT_PSEPW RecName: Full=Phosphoribosylglycinamide
  267::366     2e-06  29%  393 aa  PURT_PSEPG RecName: Full=Phosphoribosylglycinamide
  267::366     2e-06  30%  393 aa  PURT_PSEPF RecName: Full=Phosphoribosylglycinamide
   66::312     2e-06  23%  384 aa  PURT_BACSU RecName: Full=Phosphoribosylglycinamide
  108::258     2e-06  27% 1072 aa  CARB_BACCN RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     2e-06  29% 1072 aa  CARB_BACC2 RecName: Full=Carbamoyl-phosphate synthase large chain; 
   97::317     2e-06  29%  387 aa  PURT_WOLSU RecName: Full=Phosphoribosylglycinamide
  267::366     2e-06  30%  393 aa  PURT_PSEF5 RecName: Full=Phosphoribosylglycinamide
  267::366     2e-06  29%  393 aa  PURT_PSEE4 RecName: Full=Phosphoribosylglycinamide
   84::366     2e-06  22%  393 aa  PURT_PSEAE RecName: Full=Phosphoribosylglycinamide
   84::366     2e-06  22%  393 aa  PURT_PSEAB RecName: Full=Phosphoribosylglycinamide
   84::366     2e-06  22%  393 aa  PURT_PSEA8 RecName: Full=Phosphoribosylglycinamide
  701::770     2e-06  33% 1176 aa  CARB_TRICU RecName: Full=Carbamoyl-phosphate synthase
  101::258     2e-06  27% 1069 aa  CARB_CLOB8 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     2e-06  29% 1072 aa  CARB_BACWK RecName: Full=Carbamoyl-phosphate synthase large chain; 
  268::378     3e-06  32%  400 aa  PURT_XANOR RecName: Full=Phosphoribosylglycinamide
  268::378     3e-06  32%  400 aa  PURT_XANOM RecName: Full=Phosphoribosylglycinamide
   75::361     3e-06  22%  391 aa  PURT_VIBF1 RecName: Full=Phosphoribosylglycinamide
  267::372     3e-06  31%  392 aa  PURT_SHIFL RecName: Full=Phosphoribosylglycinamide
  267::372     3e-06  31%  392 aa  PURT_SHIF8 RecName: Full=Phosphoribosylglycinamide
  108::258     3e-06  28% 1083 aa  CARB_PELTS RecName: Full=Carbamoyl-phosphate synthase large chain; 
  108::258     3e-06  28% 1064 aa  CARB_BACST RecName: Full=Carbamoyl-phosphate synthase
  133::283     4e-06  32% 1178 aa  PYC_HUMAN RecName: Full=Pyruvate carboxylase, mitochondrial;       
  133::283     4e-06  32% 1178 aa  PYC_BOVIN RecName: Full=Pyruvate carboxylase, mitochondrial;       
  267::365     4e-06  32%  392 aa  PURT_SHIBS RecName: Full=Phosphoribosylglycinamide
  267::365     4e-06  32%  392 aa  PURT_SHIB3 RecName: Full=Phosphoribosylglycinamide
 1107::1175    5e-06  28% 2275 aa  PYR1_EMENI RecName: Full=Protein pyrABCN;Includes:  RecName:
   77::320     5e-06  22%  392 aa  PURT_WIGBR RecName: Full=Phosphoribosylglycinamide
  117::320     5e-06  24%  392 aa  PURT_SODGM RecName: Full=Phosphoribosylglycinamide
  267::365     5e-06  32%  392 aa  PURT_SHISS RecName: Full=Phosphoribosylglycinamide
  267::365     5e-06  32%  392 aa  PURT_SHIDS RecName: Full=Phosphoribosylglycinamide
  267::365     5e-06  32%  392 aa  PURT_ECOUT RecName: Full=Phosphoribosylglycinamide
  267::365     5e-06  32%  392 aa  PURT_ECOLI RecName: Full=Phosphoribosylglycinamide
  267::365     5e-06  32%  392 aa  PURT_ECOL5 RecName: Full=Phosphoribosylglycinamide
  267::365     5e-06  32%  392 aa  PURT_ECOK1 RecName: Full=Phosphoribosylglycinamide
  267::365     5e-06  32%  392 aa  PURT_ECODH RecName: Full=Phosphoribosylglycinamide
  267::365     5e-06  32%  392 aa  PURT_ECOBW RecName: Full=Phosphoribosylglycinamide
  267::365     5e-06  32%  392 aa  PURT_ECO57 RecName: Full=Phosphoribosylglycinamide
  102::169     5e-06  33% 1094 aa  CARB_GEMAT RecName: Full=Carbamoyl-phosphate synthase large chain; 
  108::258     5e-06  27% 1072 aa  CARB_BACC3 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  108::258     5e-06  27% 1072 aa  CARB_BACC0 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  108::258     5e-06  27% 1072 aa  CARB_BACAN RecName: Full=Carbamoyl-phosphate synthase large chain; 
  108::258     5e-06  27% 1072 aa  CARB_BACAH RecName: Full=Carbamoyl-phosphate synthase large chain; 
  108::258     5e-06  27% 1072 aa  CARB_BACAC RecName: Full=Carbamoyl-phosphate synthase large chain; 
  108::258     5e-06  27% 1072 aa  CARB_BACAA RecName: Full=Carbamoyl-phosphate synthase large chain; 
  128::280     7e-06  33% 1175 aa  PYC1_CAEEL RecName: Full=Pyruvate carboxylase 1;       
   15::380     7e-06  26%  400 aa  PURT_MYCS2 RecName: Full=Phosphoribosylglycinamide
  272::377     7e-06  33%  400 aa  PURT_METCA RecName: Full=Phosphoribosylglycinamide
  267::372     7e-06  30%  392 aa  PURT_EDWI9 RecName: Full=Phosphoribosylglycinamide
  101::260     7e-06  28% 1043 aa  CARY_BACST RecName: Full=Carbamoyl-phosphate synthase
  101::258     7e-06  25% 1084 aa  CARB_SYMTH RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     7e-06  30% 1070 aa  CARB_LISW6 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  108::258     7e-06  26% 1072 aa  CARB_BACC1 RecName: Full=Carbamoyl-phosphate synthase large chain; 
 1081::1135    9e-06  29% 2214 aa  PYR1_YEAST RecName: Full=Protein URA1;Includes:  RecName:
 1115::1169    9e-06  29% 2244 aa  PYR1_SCHPO RecName: Full=Protein ura1;Includes:  RecName:
   15::354     9e-06  25%  392 aa  PURT_SHEAM RecName: Full=Phosphoribosylglycinamide
  267::374     9e-06  29%  393 aa  PURT_PARD8 RecName: Full=Phosphoribosylglycinamide
  267::320     9e-06  39%  392 aa  PURT_KLEP3 RecName: Full=Phosphoribosylglycinamide
  633::710     9e-06  30% 1049 aa  CARB_SULTO RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     9e-06  28% 1058 aa  CARB_STRS7 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  650::733     9e-06  31% 1102 aa  CARB_STRCO RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     9e-06  25% 1057 aa  CARB_STAS1 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     9e-06  23% 1057 aa  CARB_STAHJ RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     9e-06  30% 1070 aa  CARB_LISMO RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     9e-06  30% 1070 aa  CARB_LISMH RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     9e-06  30% 1070 aa  CARB_LISMF RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     9e-06  30% 1070 aa  CARB_LISMC RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     9e-06  30% 1070 aa  CARB_LISIN RecName: Full=Carbamoyl-phosphate synthase large chain; 
  100::258     9e-06  29% 1082 aa  CARB_DESAP RecName: Full=Carbamoyl-phosphate synthase large chain; 
  108::258     9e-06  27% 1072 aa  CARB_BACHK RecName: Full=Carbamoyl-phosphate synthase large chain; 
  133::283     1e-05  31% 1178 aa  PYC_RAT RecName: Full=Pyruvate carboxylase, mitochondrial;       
  133::283     1e-05  31% 1178 aa  PYC_MOUSE RecName: Full=Pyruvate carboxylase, mitochondrial;       
  267::320     1e-05  39%  392 aa  PURT_ENTS8 RecName: Full=Phosphoribosylglycinamide
  121::258     1e-05  23% 1080 aa  CARB_XANCP RecName: Full=Carbamoyl-phosphate synthase large chain; 
  632::709     1e-05  27% 1051 aa  CARB_SULIY RecName: Full=Carbamoyl-phosphate synthase large chain; 
  632::709     1e-05  27% 1051 aa  CARB_SULIN RecName: Full=Carbamoyl-phosphate synthase large chain; 
  632::709     1e-05  27% 1051 aa  CARB_SULIM RecName: Full=Carbamoyl-phosphate synthase large chain; 
  632::709     1e-05  27% 1051 aa  CARB_SULIL RecName: Full=Carbamoyl-phosphate synthase large chain; 
  632::709     1e-05  27% 1051 aa  CARB_SULIK RecName: Full=Carbamoyl-phosphate synthase large chain; 
  632::709     1e-05  27% 1051 aa  CARB_SULIA RecName: Full=Carbamoyl-phosphate synthase large chain; 
  122::222     1e-05  27% 1059 aa  CARB_STRSV RecName: Full=Carbamoyl-phosphate synthase large chain; 
  650::733     1e-05  31% 1102 aa  CARB_STRGG RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     1e-05  27% 1073 aa  CARB_HYPBU RecName: Full=Carbamoyl-phosphate synthase large chain; 
  108::258     1e-05  26% 1072 aa  CARB_BACCZ RecName: Full=Carbamoyl-phosphate synthase large chain; 
  108::258     1e-05  26% 1072 aa  CARB_BACCQ RecName: Full=Carbamoyl-phosphate synthase large chain; 
  108::258     1e-05  26% 1072 aa  CARB_BACC7 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  118::380     2e-05  27%  399 aa  PURT_THISH RecName: Full=Phosphoribosylglycinamide
  632::709     2e-05  29% 1051 aa  CARB_SULSO RecName: Full=Carbamoyl-phosphate synthase large chain; 
  107::222     2e-05  28% 1058 aa  CARB_LACPL RecName: Full=Carbamoyl-phosphate synthase
  108::258     2e-05  26% 1072 aa  CARB_BACCR RecName: Full=Carbamoyl-phosphate synthase large chain; 
  108::258     2e-05  26% 1072 aa  CARB_BACC4 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  271::378     2e-05  27%  397 aa  PURT_SULSO RecName: Full=Phosphoribosylglycinamide
   10::305     2e-05  25%  387 aa  PURT_PROM1 RecName: Full=Phosphoribosylglycinamide
  275::363     2e-05  32%  402 aa  PURT_ACIBT RecName: Full=Phosphoribosylglycinamide
  665::823     2e-05  23% 1118 aa  CARB_YEAST RecName: Full=Carbamoyl-phosphate synthase
  101::258     2e-05  28% 1058 aa  CARB_STRE4 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     2e-05  23% 1057 aa  CARB_STACT RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     2e-05  24% 1057 aa  CARB_STAAW RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     2e-05  24% 1057 aa  CARB_STAAT RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     2e-05  24% 1057 aa  CARB_STAAS RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     2e-05  24% 1057 aa  CARB_STAAR RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     2e-05  24% 1057 aa  CARB_STAAN RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     2e-05  24% 1057 aa  CARB_STAAM RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     2e-05  24% 1057 aa  CARB_STAAE RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     2e-05  24% 1057 aa  CARB_STAAC RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     2e-05  24% 1057 aa  CARB_STAA9 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     2e-05  24% 1057 aa  CARB_STAA8 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     2e-05  24% 1057 aa  CARB_STAA3 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     2e-05  24% 1057 aa  CARB_STAA2 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     2e-05  24% 1057 aa  CARB_STAA1 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::171     2e-05  31% 1106 aa  CARB_NATTJ RecName: Full=Carbamoyl-phosphate synthase large chain; 
  267::316     3e-05  40%  393 aa  PURT_YERE8 RecName: Full=Phosphoribosylglycinamide
   73::319     3e-05  25%  400 aa  PURT_VARPS RecName: Full=Phosphoribosylglycinamide
   15::333     3e-05  22%  391 aa  PURT_SHESA RecName: Full=Phosphoribosylglycinamide
   10::305     3e-05  25%  387 aa  PURT_PROMT RecName: Full=Phosphoribosylglycinamide
  267::316     3e-05  40%  392 aa  PURT_PECCP RecName: Full=Phosphoribosylglycinamide
  267::316     3e-05  40%  392 aa  PURT_ERWCT RecName: Full=Phosphoribosylglycinamide
  275::363     3e-05  30%  404 aa  PURT_ACIAD RecName: Full=Phosphoribosylglycinamide
  122::222     3e-05  27% 1059 aa  CARB_STRGC RecName: Full=Carbamoyl-phosphate synthase large chain; 
   15::333     3e-05  22%  391 aa  PURT_SHESM RecName: Full=Phosphoribosylglycinamide
  277::333     3e-05  45%  404 aa  PURT_BURVG RecName: Full=Phosphoribosylglycinamide
  277::333     3e-05  45%  404 aa  PURT_BURCM RecName: Full=Phosphoribosylglycinamide
  121::258     3e-05  23% 1080 aa  CARB_XANAC RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     3e-05  25% 1057 aa  CARB_MACCJ RecName: Full=Carbamoyl-phosphate synthase large chain; 
   98::168     3e-05  33%  482 aa  CARB1_METJA RecName: Full=Carbamoyl-phosphate synthase large chain,
  159::214     4e-05  38%  478 aa  Y4RH_RHISN RecName: Full=Uncharacterized protein y4rH;
   15::333     4e-05  22%  391 aa  PURT_SHESR RecName: Full=Phosphoribosylglycinamide
  271::370     4e-05  25%  397 aa  PURT_ALCBS RecName: Full=Phosphoribosylglycinamide
  121::258     4e-05  24% 1080 aa  CARB_XYLFA RecName: Full=Carbamoyl-phosphate synthase large chain; 
  102::258     4e-05  27% 1028 aa  CARB_THET8 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  265::361     6e-05  25%  391 aa  PURT_SHEON RecName: Full=Phosphoribosylglycinamide
  270::376     6e-05  25%  396 aa  PURT_SHEFN RecName: Full=Phosphoribosylglycinamide
  277::340     6e-05  39%  404 aa  PURT_BURTA RecName: Full=Phosphoribosylglycinamide
  277::333     6e-05  43%  404 aa  PURT_BURS3 RecName: Full=Phosphoribosylglycinamide
  277::340     6e-05  39%  404 aa  PURT_BURPS RecName: Full=Phosphoribosylglycinamide
  277::340     6e-05  39%  404 aa  PURT_BURP6 RecName: Full=Phosphoribosylglycinamide
  277::340     6e-05  39%  404 aa  PURT_BURP1 RecName: Full=Phosphoribosylglycinamide
  277::340     6e-05  39%  404 aa  PURT_BURP0 RecName: Full=Phosphoribosylglycinamide
  277::340     6e-05  39%  404 aa  PURT_BURMS RecName: Full=Phosphoribosylglycinamide
  277::340     6e-05  39%  404 aa  PURT_BURMA RecName: Full=Phosphoribosylglycinamide
  277::340     6e-05  39%  404 aa  PURT_BURM9 RecName: Full=Phosphoribosylglycinamide
  277::340     6e-05  39%  404 aa  PURT_BURM7 RecName: Full=Phosphoribosylglycinamide
  279::385     6e-05  33%  404 aa  PURT_BORPE RecName: Full=Phosphoribosylglycinamide
  121::258     6e-05  24% 1080 aa  CARB_XYLFT RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     6e-05  24% 1057 aa  CARB_STAAB RecName: Full=Carbamoyl-phosphate synthase large chain; 
  661::744     6e-05  30% 1112 aa  CARB_MYCGI RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     6e-05  24% 1068 aa  CARB_CLOBL RecName: Full=Carbamoyl-phosphate synthase large chain; 
 1033::1102    8e-05  28% 2224 aa  PYR1_DROME RecName: Full=CAD protein;AltName: Full=Protein
    6::354     8e-05  21%  391 aa  PURT_VIBVY RecName: Full=Phosphoribosylglycinamide
    6::354     8e-05  21%  391 aa  PURT_VIBVU RecName: Full=Phosphoribosylglycinamide
  121::375     8e-05  27%  402 aa  PURT_COREF RecName: Full=Phosphoribosylglycinamide
  277::333     8e-05  43%  404 aa  PURT_BURCH RecName: Full=Phosphoribosylglycinamide
  277::333     8e-05  43%  404 aa  PURT_BURCA RecName: Full=Phosphoribosylglycinamide
  614::697     8e-05  25% 1056 aa  CARB_PYRFU RecName: Full=Carbamoyl-phosphate synthase large chain; 
  121::222     8e-05  26% 1057 aa  CARB_PEDPA RecName: Full=Carbamoyl-phosphate synthase large chain; 
  661::744     8e-05  28% 1121 aa  CARB_MYCLE RecName: Full=Carbamoyl-phosphate synthase large chain; 
  119::257     8e-05  24% 1056 aa  CARB_METHJ RecName: Full=Carbamoyl-phosphate synthase large chain; 
  111::179     8e-05  34% 1093 aa  CARB_ACIC5 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  130::266     8e-05  25% 1102 aa  CARB_ACIBL RecName: Full=Carbamoyl-phosphate synthase large chain; 
  265::354     1e-04  29%  391 aa  PURT_VIBPA RecName: Full=Phosphoribosylglycinamide
 1060::1201    1e-04  23% 1500 aa  CPSM_RAT RecName: Full=Carbamoyl-phosphate synthase [ammonia],
  122::258     1e-04  27% 1060 aa  CARB_STRA5 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  122::258     1e-04  27% 1060 aa  CARB_STRA3 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  122::258     1e-04  27% 1060 aa  CARB_STRA1 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  661::744     1e-04  30% 1112 aa  CARB_MYCVP RecName: Full=Carbamoyl-phosphate synthase large chain; 
  661::744     1e-04  29% 1115 aa  CARB_MYCTU RecName: Full=Carbamoyl-phosphate synthase large chain; 
  661::744     1e-04  29% 1115 aa  CARB_MYCBO RecName: Full=Carbamoyl-phosphate synthase large chain; 
  119::257     1e-04  24% 1056 aa  CARB_METPE RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     1e-04  25% 1070 aa  CARB_EXIS2 RecName: Full=Carbamoyl-phosphate synthase large chain; 
 1034::1160    1e-04  23% 2225 aa  PYR1_MESAU RecName: Full=CAD protein;Includes:  RecName:
  275::373     1e-04  28%  393 aa  PURT_YERPY RecName: Full=Phosphoribosylglycinamide
  275::373     1e-04  28%  393 aa  PURT_YERPS RecName: Full=Phosphoribosylglycinamide
  275::373     1e-04  28%  393 aa  PURT_YERPP RecName: Full=Phosphoribosylglycinamide
  275::373     1e-04  28%  393 aa  PURT_YERPN RecName: Full=Phosphoribosylglycinamide
  275::373     1e-04  28%  393 aa  PURT_YERPG RecName: Full=Phosphoribosylglycinamide
  275::373     1e-04  28%  393 aa  PURT_YERPE RecName: Full=Phosphoribosylglycinamide
  275::373     1e-04  28%  393 aa  PURT_YERPB RecName: Full=Phosphoribosylglycinamide
  275::373     1e-04  28%  393 aa  PURT_YERPA RecName: Full=Phosphoribosylglycinamide
  279::367     1e-04  32%  405 aa  PURT_LEPCP RecName: Full=Phosphoribosylglycinamide
 1060::1129    1e-04  26% 1500 aa  CPSM_MOUSE RecName: Full=Carbamoyl-phosphate synthase [ammonia],
  642::800     1e-04  25% 1028 aa  CARB_THET2 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::222     1e-04  27% 1059 aa  CARB_STRTD RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::222     1e-04  27% 1059 aa  CARB_STRT2 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::222     1e-04  27% 1059 aa  CARB_STRT1 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  650::733     1e-04  30% 1102 aa  CARB_STRAW RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     1e-04  27% 1054 aa  CARB_RUBXD RecName: Full=Carbamoyl-phosphate synthase large chain; 
   98::181     1e-04  32% 1074 aa  CARB_METTP RecName: Full=Carbamoyl-phosphate synthase large chain; 
  121::258     1e-04  24% 1029 aa  CARB_DEIGD RecName: Full=Carbamoyl-phosphate synthase large chain; 
 1034::1088    2e-04  29% 2225 aa  PYR1_HUMAN RecName: Full=CAD protein;Includes:  RecName:
  265::354     2e-04  29%  391 aa  PURT_VIBHB RecName: Full=Phosphoribosylglycinamide
  265::361     2e-04  26%  391 aa  PURT_SHESW RecName: Full=Phosphoribosylglycinamide
  282::329     2e-04  40%  408 aa  PURT_RHOFD RecName: Full=Phosphoribosylglycinamide
  267::316     2e-04  40%  399 aa  PURT_PROMH RecName: Full=Phosphoribosylglycinamide
  129::278     2e-04  31%  699 aa  MCCA_DICDI RecName: Full=Methylcrotonoyl-CoA carboxylase subunit
  101::222     2e-04  28% 1059 aa  CARB_STRMU RecName: Full=Carbamoyl-phosphate synthase large chain; 
  102::222     2e-04  27% 1065 aa  CARB_CLOAB RecName: Full=Carbamoyl-phosphate synthase large chain; 
  277::365     2e-04  32%  402 aa  PURT_MYCA9 RecName: Full=Phosphoribosylglycinamide
  279::385     2e-04  32%  406 aa  PURT_BORPA RecName: Full=Phosphoribosylglycinamide
  279::385     2e-04  32%  406 aa  PURT_BORBR RecName: Full=Phosphoribosylglycinamide
  119::253     2e-04  23% 1053 aa  CARB_METLZ RecName: Full=Carbamoyl-phosphate synthase large chain; 
  102::258     2e-04  26% 1058 aa  CARB_FUSNN RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::258     2e-04  27% 1062 aa  CARB_BACHD RecName: Full=Carbamoyl-phosphate synthase
   97::221     2e-04  28%  452 aa  ACCC_BACHD RecName: Full=Biotin carboxylase;       
  265::361     3e-04  26%  391 aa  PURT_SHEPC RecName: Full=Phosphoribosylglycinamide
  265::361     3e-04  26%  391 aa  PURT_SHEB5 RecName: Full=Phosphoribosylglycinamide
  274::362     3e-04  32%  402 aa  PURT_POLSJ RecName: Full=Phosphoribosylglycinamide
  277::322     3e-04  39%  408 aa  PURT_CORGL RecName: Full=Phosphoribosylglycinamide
  277::322     3e-04  39%  408 aa  PURT_CORGB RecName: Full=Phosphoribosylglycinamide
  133::285     3e-04  30%  734 aa  MCCA_ARATH RecName: Full=Methylcrotonoyl-CoA carboxylase subunit
  661::744     3e-04  28% 1112 aa  CARB_MYCSS RecName: Full=Carbamoyl-phosphate synthase large chain; 
  661::744     3e-04  28% 1112 aa  CARB_MYCSK RecName: Full=Carbamoyl-phosphate synthase large chain; 
  661::744     3e-04  28% 1112 aa  CARB_MYCSJ RecName: Full=Carbamoyl-phosphate synthase large chain; 
  100::258     3e-04  27% 1059 aa  CARB_LEUMM RecName: Full=Carbamoyl-phosphate synthase large chain; 
  122::171     3e-04  32% 1060 aa  CARB_LACSS RecName: Full=Carbamoyl-phosphate synthase large chain; 
  279::384     4e-04  32%  405 aa  PURT_BORA1 RecName: Full=Phosphoribosylglycinamide
  288::333     4e-04  41%  414 aa  PURT_ACIAC RecName: Full=Phosphoribosylglycinamide
   85::163     4e-04  30%  324 aa  MPTN_METAC RecName: Full=Tetrahydromethanopterin:alpha-L-glutamate
  122::222     4e-04  25% 1058 aa  CARB_STRPZ RecName: Full=Carbamoyl-phosphate synthase large chain; 
  122::222     4e-04  25% 1058 aa  CARB_STRPG RecName: Full=Carbamoyl-phosphate synthase large chain; 
  122::222     4e-04  25% 1058 aa  CARB_STRP8 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  122::222     4e-04  25% 1058 aa  CARB_STRP6 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  122::222     4e-04  25% 1058 aa  CARB_STRP3 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  122::222     4e-04  25% 1058 aa  CARB_STRP1 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  119::257     4e-04  24% 1056 aa  CARB_METMJ RecName: Full=Carbamoyl-phosphate synthase large chain; 
  121::179     4e-04  30% 1061 aa  CARB_LACS1 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  122::222     4e-04  23% 1062 aa  CARB_LACJO RecName: Full=Carbamoyl-phosphate synthase large chain; 
  121::258     4e-04  22% 1076 aa  CARB_HALER RecName: Full=Carbamoyl-phosphate synthase large chain; 
  646::729     4e-04  31% 1109 aa  CARB_BEUC1 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  280::378     5e-04  28%  397 aa  PURT_SULTO RecName: Full=Phosphoribosylglycinamide
  269::315     5e-04  36%  396 aa  PURT_PSYIN RecName: Full=Phosphoribosylglycinamide
  284::379     5e-04  32%  400 aa  PURT_METFK RecName: Full=Phosphoribosylglycinamide
  273::318     5e-04  41%  399 aa  PURT_DECAR RecName: Full=Phosphoribosylglycinamide
 1057::1126    5e-04  25% 1496 aa  CPSM_RANCA RecName: Full=Carbamoyl-phosphate synthase [ammonia],
  101::258     5e-04  24% 1072 aa  CARB_THETN RecName: Full=Carbamoyl-phosphate synthase large chain; 
  101::242     5e-04  25% 1099 aa  CARB_THENN RecName: Full=Carbamoyl-phosphate synthase large chain; 
  633::710     5e-04  26% 1052 aa  CARB_SULAC RecName: Full=Carbamoyl-phosphate synthase large chain; 
  272::317     6e-04  39%  398 aa  PURT_THIDA RecName: Full=Phosphoribosylglycinamide
  274::319     6e-04  39%  401 aa  PURT_POLNA RecName: Full=Phosphoribosylglycinamide
   85::158     6e-04  30%  324 aa  MPTN_METMA RecName: Full=Tetrahydromethanopterin:alpha-L-glutamate
  121::258     6e-04  21% 1083 aa  CARB_MYXXD RecName: Full=Carbamoyl-phosphate synthase large chain; 
  122::259     6e-04  24% 1064 aa  CARB_LACLA RecName: Full=Carbamoyl-phosphate synthase large chain; 
  121::222     6e-04  22% 1062 aa  CARB_LACAC RecName: Full=Carbamoyl-phosphate synthase large chain; 
  121::258     6e-04  26% 1067 aa  CARB_HALOH RecName: Full=Carbamoyl-phosphate synthase large chain; 
  647::715     8e-04  26% 1077 aa  CARB_YERPE RecName: Full=Carbamoyl-phosphate synthase large chain; 
  108::258     8e-04  26% 1067 aa  CARB_EXISA RecName: Full=Carbamoyl-phosphate synthase large chain; 
    1::385

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSETNRTVPVVGMVGGGQLARMTHQAAIALGVDFRVLAARPTDSAARVVADVHXXXXXXXXXXXAFAKDS
PURK_MYCTU      ---TSFIAPLVAMVGGGQLARMTHQAAIALGQNLRVLVTSADDPAAQVTPNVVIGSHTDLAALRRVAAGA
PURK_MYCBO      ---TSFIAPLVAMVGGGQLARMTHQAAIALGQNLRVLVTSADDPAAQVTPNVVIGSHTDLAALRRVAAGA
PURK_CORAM      -------MPVIAVIGDGQLARMMQTAAIELGQSLRLLAGARDASAAQVCADVVLGDYTNYDDLLKAVDGA
PURK_MYCLE      --------PLVAMVGGGQLARMTHQAAIALGQTLRVLATAADEPAAQVTPDVVIGSHTDLEDLRRVALGA
PURK_SYNE7      ----------VGVIGGGQLAWMLAPAAQQLGMSLHVQTPNDHDPAVAIXXXXXXXXXXXXXXXXXXXXXC
PUR6_DEBOC      ---------IVGILGGGQLGRMIVEAANRLNIKTVVLDV-PNSPAKQINSNEHVDGSFTDLKSIILAEKC
PUR6_YEAST      ----------VGILGGGQLGRMIVEAANRLNIKTVILDAE--NSPAKQISNSNDHVNGSFSNPLKLAEKC
PUR6_PICME      ----------VGILGGGQLGRMIVEAAHRLNIKTVILENGDQAPAKQINADDHIDGSFNDPKAIALAAKC
PUR6_CANGA      ----------VGILGGGQLGRMIVEAANRLNIKTLILDA-PNSPAKQITSDHVDGSFANKEDIEALAAKC
PURK_BACSU      ---------VIGIIGGGQLGKMMAVSAKQMG--YKVAVVDPVDSPCGQVADVEITAHYNDREAIRLAEIS
PUR6_SCHPO      ------------------------------------------------------------------SKKC
PURK_VIBVY      ------------VLGAGQLARMMSLAGAPLNIQISAYDVTTGDV-------VHPXXXXXXXXXXEQAIEH
PURK_VIBVU      ------------VLGAGQLARMMSLAGAPLNIQISAYDVTTGDV-------VHPXXXXXXXXXXEQAIEY
PURK_SYNY3      ----------VGVIGGGQLAWMMAQEAPRLGLKLAVQTPGESDPAVALADKVVLTAIADGEGTRELAEHC
PURK_VIBCH      ------------VLGAGQLARMMSLAGAPLNIETIAFDVGSENIVHPLTQTV------LGHGLEQAIEQV
PUR6_CANAL      ----------VGILGGGQLGRMIVEAAHRLNIKTVILDAAKSPAKQINALDDHVDGSFTNYDSIVLAEKA
PURK_VIBF1      ------------ILGSGQLARMMSLASAPLNID--VIAYDVNSQQI-----VHPLTQQPIDLSLEQAKQV
PURK_PSEAE      ----------IGVIGGGQLGRMLALAGTPLGMNFAFLDPAP-DACAASLGEHIRADYGDQEHLRQLADEV
PURK_VIBPA      ------------VLGSGQLARMMSLAGAPLNIQISAYDVGSGNVVHPLTQQVLGHGLENAI------EQV
PUR6_CRYNE      ----------VGILGGGQLGRMTHXXXXXXXXXXXXXXXXYTPAKQTLLXXXXXXXXXXXFTSETLASAC
PURK_BRUME      ----------IGIIGGGQLGRMLAMAAARFGYETIILEPQAGCPAAQVANRQIVAAYDDPKALAELAAAS
PUR6_CRYNV      ----------VGILGGGQLGRMTHXXXXXXXXXXXXXXXXFTPAKQTLLPPPSHSHPDGPFTSEPLASAC
PUR6_VIGAC      --------------------RMMCQAASQMAIKVMVLDPQENCPASSLSYHHMVGSFDESTKVEEFAKRC
PURK_AQUAE      ----------VGILGGGQLGWMTILEGRKLGFKFHVLEDKENAPACRVA-----DRCFRTGQISEFVDSC
PURK_STAS1      ----------IGIIGGGQLGKMMAQSAQQMGYKVIVLDPNSSCPCQYVANEFINAAYDDQIALDRLGALS
PURK_STAES      ----------IGIIGGGQLGKMMAQSAQKMG--YKVIVLDPNDCPCRYVAHIHANYDDEQALNQ-LGENS
PURK_STAEQ      ----------IGIIGGGQLGKMMAQSAQKMG--YKVIVLDPNDCPCRYVAHIHANYDDEQALNQ-LGENS
PURK_STAHJ      ----------IGIIGGGQLGKMMAQSAQKMGFKVICLDPNPDSPCKSVAHEFITAAYDDEEALHELGEKS
PURK_HAEIN      ----------------------------------------------------------------------
PURK_ECOLI      ----------VCVLGNGQLGRMLRQAGEPLGI-----AVWPVGLDAEPAA---------------VPFQQ
PURK_STAAW      ----------IGIIGGGQLGKMMAQSAQKMG--YKVVVLDPSDCPCRYVA--HEFIQAKYDDEKALGQKC
PURK_STAAS      ----------IGIIGGGQLGKMMAQSAQKMG--YKVVVLDPSDCPCRYVA--HEFIQAKYDDEKALGQKC
PURK_STAAC      ----------IGIIGGGQLGKMMAQSAQKMG--YKVVVLDPSDCPCRYVA--HEFIQAKYDDEKALGQKC
PURK_STAAR      ----------IGIIGGGQLGKMMAQSAQKMGYKVAVLDPAEDCPCRYVAHEFIQAKYDDEKALNQLGQKC
PURK_STAAN      ----------IGIIGGGQLGKMMAQSAQKMG--YKVVVLDPSDCPCRYVA--HEFIQAKYDDEKALGQKC
PURK_STAAM      ----------IGIIGGGQLGKMMAQSAQKMG--YKVVVLDPSDCPCRYVA--HEFIQAKYDDEKALGQKC
PURK_SULSO      --------PKIGILGGGQLGWMIVLEGRKYPFTFYVLENDKNAPACRIA-----DRCFSPQDYKEFVDSS
PURT_PELPD      ------------LLGSGELGKEVAIEAQRLGVEV-IAVDRYADAPAMQVAHVISMQDREELKRVIGLERP
PURT_SYNS3      ----------VMLLGSGELGKEVAIAAQRLGCHV-IACDRYADAPAMQVADVLTMTDPNALKTVVNKHQP
PURT_PELCD      ------------MLGCGELGKEVVIEAQRFGIE-TIAVDRYADAPAMQVAHSHVANMLDRDALERIIKQE
PURT_BACV8      ----------------------------------------------------------------------
PURT_METM7      ------------LLGSGELGKEVIIEAQRFGVECIAVDSYENAPAMQVAHRFHVIDMKDGGALRAVIERE
PURT_METMP      ------------LLGSGELGKEVIIEAQRFGVECIAVDSYENAPAMQVAHKYHIIDMKDAGALRAVIEKE
PURT_SYNY3      ------------LLGSGELGKEFTIAAQRLGNRVIAVDRYPDAPAMQVVAEVISMLDGNALEAVVKKYQP
PURT_BACTN      ----------------------------------------------------------------------
PURT_SYNPW      ----------------------------------------------------------------------
PURT_SULAC      ----------------------------------------------------------------------
PURT_METVS      ------------LLGSGELGKEVIIEAQRLGVECIAVDSYENAPAMQVAHRYHVIDMKDSGSLRAVIERE
PURT_SYNS9      ----------------------------------------------------------------------
PURT_CHLTE      ------------LLGSGELGKEFVIAVKRLGQ--RVVAVDSYDDAAQQVADVIDMLDGRALDAIVAKHRP
PURT_METM5      ----------------------------------------------------------------------
PURT_META3      ------------LLGSGELGKEVIIEAQRLGIECVAVDSYDNAPAMQVAHRSYVIDMKDGDALKAILEKE
PURT_GEOMG      ----------VMLLGSGELGKEVVLEAQRLGVEV-IAVDRYADAPAMQVAHVVNMLDRVELGRIVARERP
PURT_PROMA      ----------------------------------------------------------------------
PURT_NITSB      ------------LLGSGELGKEVAIEAQRLGIEV-VAVDRYPNAPAHLVAHVIDMKSKEQVLEVIFREKP
PURT_METJA      -------------------------------------------------------------------EEP
PURT_SYNPX      ----------------------------------------------------------------------
PURT_CHLPD      ------------LLGSGELGKEFVIAVKRLG-HFVIAVDSYNDAPAQQVADVINMLDGAALDAIVARHQP
PURT_PROMM      ----------------------------------------------------------------------
PURT_ANAVT      MSKAIKLPQKLMLLGSGELGKEFVIAAQRLG-NYVIAVDRYANAPAMQVADVISMLSADDLEAVVTKYQP
PURT_PASMU      ----------VMMLGSGELGKEVVIELQRLGVEVIAVDRYANAPAQQVAHRAYTISMLDGEALKALVEKE
PURT_LEPBL      ----------------------------------------------------------------------
PURT_LEPBJ      ----------------------------------------------------------------------
PURT_DESMR      ------------LLGSGELGKEVAIEAQRLGVEVIAVDRYPNAPAMQVAHRRHVVSMLDAPALRSIAEKP
PURT_THICR      ----------------------------------------------------------------------
PURT_SYNSC      ----------------------------------------------------------------------
PURT_BACFN      ----------------------------------------------------------------------
PURT_DESVV      ------------LLGSGELGREVALEAMRLGVEVVAVDRYPNAPAMQVAHRSHVVSMLDGAALRAIAEKP
PURT_DESVH      ------------LLGSGELGREVALEAMRLGVEVVAVDRYPNAPAMQVAHRSHVVSMLDGAALRAIAEKP
PURT_ANASP      MSKAIKLPQKLMLLGSGELGKEFVIAAQRLG-NYVIAVDRYANAPAMQVSDVISMLSADDLEAVVTKYEP
PURT_ANADE      ----------------------------------------------------------------------
PURT_HAES1      ----------------------------------------------------------------------
PURT_AZOSB      ----------------------------------------------------------------------
PURT_FLAPJ      ----------------------------------------------------------------------
PURT_ERYLH      ----------------------------------------------------------------------
PURT_BIFLO      ----------------------------------------------------------------------
PURT_SALAR      ----------VMLLGSGELGKEVAIECQRLGIEVIAVDRYPDAPAMHVAHRSHVINMLDGEALRAVEKPH
PURT_PROM3      ----------------------------------------------------------------------
PURT_BACFR      ----------------------------------------------------------------------
PURT_AERHH      ------------LLGSGELGKEVAIELQRFGIEV-IAADRYADAPAMQVAHAHVLDMLDGAALRALVNEP
PURT_DESDG      ------------LLGSGELGKEVAIEAMRLGAEVVAVDRYAGAPAMQVAHRSHVISMLDADALRRLIAEE
PURT_MANSM      ----------VMMLGSGELGKEVVIELQRLGVEVIAVDRYKNAPAQQVAHRSYTISMLDGEALKALVEKE
PURT_FRATW      ----------------------------------------------------------------------
PURT_FRATT      ----------------------------------------------------------------------
PURT_FRATN      ----------------------------------------------------------------------
PURT_FRAT1      ----------------------------------------------------------------------
PURT_CORJK      ------------LLGASELGRELAIALQRLGIEVHA-ADRYAGAPAHLVANAHVLDIHDEDAIRQLVREP
PURT_BACA2      ----------------------------------------------------------------------
PURT_SYNR3      ----------------------------------------------------------------------
PURT_PSEU5      ----------------------------------------------------------------------
PURT_HALWD      ----------------------------------------------------------------------
PURT_SYNP6      ----------------------------------------------------------------------
PURT_SYNE7      ----------------------------------------------------------------------
PURT_PYRFU      ------------LLGSGELGKEIAIEAQRLGVEV-VAVDRYANAPAMQVAHVGNMMDKDFLWSVVEREKP
PURT_BURXL      ----------VMLLGAGELGKEVIIALQRLGVEVIAVDRYPNAPGHQVAHRAHVIDMTDRAALRALVEQE
PURT_SULNB      ----------------------------------------------------------------------
PURT_AERS4      ------------LLGSGELGKEVAIELQRFGIEVIAADRYPNAPAMQVAHKAHVLDMLDGNALRALVTKP
CARB_LYSSC      ----------------------------------------------------------------------
PURT_SULDN      ------------LLGSGELGREVAIEAQRLGLEV-IAVDRYQNAPAHSVAHVVNMQDKDALLEIIYREKP
PURT_PROMP      ----------------------------------------------------------------------
PURT_FRATO      ----------------------------------------------------------------------
PURT_FRATH      ----------------------------------------------------------------------
PURT_FRATF      ----------------------------------------------------------------------
PURT_ACTPJ      ----------VMMLGSGELGKEVVIELQRLGVEVIAVDRYENAPAQQVAHRAYTISMLDGAALRALAEKE
PURT_XANC5      ----------------------------------------------------------------------
PURT_SALPC      ----------------------------------------------------------------------
PURT_SALCH      ----------------------------------------------------------------------
PURT_MARAV      ----------------------------------------------------------------------
PURT_HAEDU      ----------VMMLGSGELGKEVVIELQRLGVEVIAVDRYANAPAQQVAHRAYTISMLDDDALRAVVEQE
PURT_XANCP      ----------------------------------------------------------------------
PURT_XANCB      ----------------------------------------------------------------------
PURT_XANC8      ----------------------------------------------------------------------
PURT_STRM5      ------------LLGSGELGKEVAIELQRLGVEV-IAADRYADAPAMQVA--HRSHVIDMLDAMALRA--
PURT_RALEJ      ------------------------------------------------------------------AEKP
PURT_LEPIN      ----------------------------------------------------------------------
PURT_LEPIC      ----------------------------------------------------------------------
PURT_XANAC      ----------------------------------------------------------------------
PURT_PROM9      ----------------------------------------------------------------------
PURT_PROM0      ----------------------------------------------------------------------
PURT_MYCVP      ----------VMLLGSGELGREVLIALQRLGVETIAVDRYDNAPGQQVAHHARTIAMTDPDQLRALAERP
PURT_MYCGI      ----------VMLLGSGELGREVLIALQRLGVETIAVDRYDNAPGQQVAHHARTIAMTDPEQLRALAERP
PURT_PYRHO      ------------LLGSGELGKEIAIEAQRLGVEV-VAVDRYANAPAMQVAHVGNMMDKDFLWSVVEREKP
PURT_PROM5      --------------------------------------------------------------------EP
CARB_SCHPO      ---------------------------------------------------------------------S
CARB_CLOBA      ----------------------------------------------------------------------
CARB_BACSU      ----------------------------------------------------------------------
PURT_STRMK      ------------LLGSGELGKEVAIELQRLGVEV-IAADRYADAPAMQVA--HRSHVIDMLDAMALRA--
PURT_SALPB      ----------------------------------------------------------------------
PURT_SALNS      ----------------------------------------------------------------------
PURT_IGNH4      ----------------------------------------------------------------------
PURT_BIFAA      ----------------------------------------------------------------------
PURT_ACTP7      ----------VMMLGSGELGKEVVIELQRLGVEVIAVDRYENAPAQQVAHRAYTISMLDGAALRALVEKE
PURT_ACTP2      ----------VMMLGSGELGKEVVIELQRLGVEVIAVDRYENAPAQQVAHRAYTISMLDGAALRALVEKE
CARB_ASHGO      ----------------------------------------------------------------------
PURT_PYRKO      ----------------------------------------------------------------------
PURT_PASHA      ----------------------------------------------------------------------
PURT_ERWT9      ----------VMLLGSGELGKEVALECQRLGVEV-IAVDRYADAPAMQVAHVIXXXXXXXXXXXXXXEKP
PURT_DESAD      ----------------------------------------------------------------------
CARB_CLOBB      ----------------------------------------------------------------------
PURT_SALTY      ----------------------------------------------------------------------
PURT_SALTI      ----------------------------------------------------------------------
PURT_SALSV      ----------------------------------------------------------------------
PURT_SALPK      ----------------------------------------------------------------------
PURT_SALPA      ----------------------------------------------------------------------
PURT_SALDC      ----------------------------------------------------------------------
PURT_PYRAB      ----------------------------------------------------------------------
CARB_STAES      ----------------------------------------------------------------------
CARB_STAEQ      ----------------------------------------------------------------------
PURT_PROMS      ----------------------------------------------------------------------
PURT_AZOVD      ----------------------------------------------------------------------
CARB_BACCL      ----------------------------------------------------------------------
PURT_TOLAT      ----------------------------------------------------------------------
PURT_RALEH      ------------------------------------------------------------------AEKP
PURT_HAHCH      ----------------------------------------------------------------------
CARB_LACRJ      ----------------------------------------------------------------------
CARB_LACRD      ----------------------------------------------------------------------
PURT_VIBCM      ----------------------------------------------------------------------
PURT_VIBCH      ----------------------------------------------------------------------
PURT_RHOSR      ----------------------------------------------------------------------
PURT_RALME      ------------------------------------------------------------------AERP
PURT_PSEU2      ----------------------------------------------------------------------
PURT_PSESM      ----------------------------------------------------------------------
PURT_PSEPK      ----------------------------------------------------------------------
PURT_PSEFS      ----------------------------------------------------------------------
PURT_PSE14      ----------------------------------------------------------------------
PURT_PHOPR      ----------------------------------------------------------------------
PURT_DESVM      ----------------------------------------------------------------------
PURT_CUPTR      ------------------------------------------------------------------AEKP
PURT_XANOP      ----------------------------------------------------------------------
PURT_PSEPW      ----------------------------------------------------------------------
PURT_PSEPG      ----------------------------------------------------------------------
PURT_PSEPF      ----------------------------------------------------------------------
PURT_BACSU      -------------------------------------------------------------------ENP
CARB_BACCN      ----------------------------------------------------------------------
CARB_BACC2      ----------------------------------------------------------------------
PURT_WOLSU      ----------------------------------------------------------------------
PURT_PSEF5      ----------------------------------------------------------------------
PURT_PSEE4      ----------------------------------------------------------------------
PURT_PSEAE      ----------------------------------------------------------------------
PURT_PSEAB      ----------------------------------------------------------------------
PURT_PSEA8      ----------------------------------------------------------------------
CARB_TRICU      ----------------------------------------------------------------------
CARB_CLOB8      ----------------------------------------------------------------------
CARB_BACWK      ----------------------------------------------------------------------
PURT_XANOR      ----------------------------------------------------------------------
PURT_XANOM      ----------------------------------------------------------------------
PURT_VIBF1      ----------------------------------------------------------------------
PURT_SHIFL      ----------------------------------------------------------------------
PURT_SHIF8      ----------------------------------------------------------------------
CARB_PELTS      ----------------------------------------------------------------------
CARB_BACST      ----------------------------------------------------------------------
PYC_HUMAN       ----------------------------------------------------------------------
PYC_BOVIN       ----------------------------------------------------------------------
PURT_SHIBS      ----------------------------------------------------------------------
PURT_SHIB3      ----------------------------------------------------------------------
PYR1_EMENI      ----------------------------------------------------------------------
PURT_WIGBR      ----------------------------------------------------------------------
PURT_SODGM      ----------------------------------------------------------------------
PURT_SHISS      ----------------------------------------------------------------------
PURT_SHIDS      ----------------------------------------------------------------------
PURT_ECOUT      ----------------------------------------------------------------------
PURT_ECOLI      ----------------------------------------------------------------------
PURT_ECOL5      ----------------------------------------------------------------------
PURT_ECOK1      ----------------------------------------------------------------------
PURT_ECODH      ----------------------------------------------------------------------
PURT_ECOBW      ----------------------------------------------------------------------
PURT_ECO57      ----------------------------------------------------------------------
CARB_GEMAT      ----------------------------------------------------------------------
CARB_BACC3      ----------------------------------------------------------------------
CARB_BACC0      ----------------------------------------------------------------------
CARB_BACAN      ----------------------------------------------------------------------
CARB_BACAH      ----------------------------------------------------------------------
CARB_BACAC      ----------------------------------------------------------------------
CARB_BACAA      ----------------------------------------------------------------------
PYC1_CAEEL      ----------------------------------------------------------------------
PURT_MYCS2      ----------VMLLGSGELGREVLIALQRLGVETIAVDRYENAPGHQVAHHARTIAMSDPDQLRALAERP
PURT_METCA      ----------------------------------------------------------------------
PURT_EDWI9      ----------------------------------------------------------------------
CARY_BACST      ----------------------------------------------------------------------
CARB_SYMTH      ----------------------------------------------------------------------
CARB_LISW6      ----------------------------------------------------------------------
CARB_BACC1      ----------------------------------------------------------------------
PYR1_YEAST      ----------------------------------------------------------------------
PYR1_SCHPO      ----------------------------------------------------------------------
PURT_SHEAM      ------------LLGSGELGKEVAIELQRLGVEVIAVDRYPNAPAMQVAHRSHVINMLDGEALKALSEKP
PURT_PARD8      ----------------------------------------------------------------------
PURT_KLEP3      ----------------------------------------------------------------------
CARB_SULTO      ----------------------------------------------------------------------
CARB_STRS7      ----------------------------------------------------------------------
CARB_STRCO      ----------------------------------------------------------------------
CARB_STAS1      ----------------------------------------------------------------------
CARB_STAHJ      ----------------------------------------------------------------------
CARB_LISMO      ----------------------------------------------------------------------
CARB_LISMH      ----------------------------------------------------------------------
CARB_LISMF      ----------------------------------------------------------------------
CARB_LISMC      ----------------------------------------------------------------------
CARB_LISIN      ----------------------------------------------------------------------
CARB_DESAP      ----------------------------------------------------------------------
CARB_BACHK      ----------------------------------------------------------------------
PYC_RAT         ----------------------------------------------------------------------
PYC_MOUSE       ----------------------------------------------------------------------
PURT_ENTS8      ----------------------------------------------------------------------
CARB_XANCP      ----------------------------------------------------------------------
CARB_SULIY      ----------------------------------------------------------------------
CARB_SULIN      ----------------------------------------------------------------------
CARB_SULIM      ----------------------------------------------------------------------
CARB_SULIL      ----------------------------------------------------------------------
CARB_SULIK      ----------------------------------------------------------------------
CARB_SULIA      ----------------------------------------------------------------------
CARB_STRSV      ----------------------------------------------------------------------
CARB_STRGG      ----------------------------------------------------------------------
CARB_HYPBU      ----------------------------------------------------------------------
CARB_BACCZ      ----------------------------------------------------------------------
CARB_BACCQ      ----------------------------------------------------------------------
CARB_BACC7      ----------------------------------------------------------------------
PURT_THISH      ----------------------------------------------------------------------
CARB_SULSO      ----------------------------------------------------------------------
CARB_LACPL      ----------------------------------------------------------------------
CARB_BACCR      ----------------------------------------------------------------------
CARB_BACC4      ----------------------------------------------------------------------
PURT_SULSO      ----------------------------------------------------------------------
PURT_PROM1      ------------LLGSGELGKEVAIAAKRLGC-YVIACDRYNDAPAMQIADVFNMNNGSELKEVIYKCNP
PURT_ACIBT      ----------------------------------------------------------------------
CARB_YEAST      ----------------------------------------------------------------------
CARB_STRE4      ----------------------------------------------------------------------
CARB_STACT      ----------------------------------------------------------------------
CARB_STAAW      ----------------------------------------------------------------------
CARB_STAAT      ----------------------------------------------------------------------
CARB_STAAS      ----------------------------------------------------------------------
CARB_STAAR      ----------------------------------------------------------------------
CARB_STAAN      ----------------------------------------------------------------------
CARB_STAAM      ----------------------------------------------------------------------
CARB_STAAE      ----------------------------------------------------------------------
CARB_STAAC      ----------------------------------------------------------------------
CARB_STAA9      ----------------------------------------------------------------------
CARB_STAA8      ----------------------------------------------------------------------
CARB_STAA3      ----------------------------------------------------------------------
CARB_STAA2      ----------------------------------------------------------------------
CARB_STAA1      ----------------------------------------------------------------------
CARB_NATTJ      ----------------------------------------------------------------------
PURT_YERE8      ----------------------------------------------------------------------
PURT_VARPS      ------------------------------------------------------------------AEKP
PURT_SHESA      ------------LLGCGELGKEVAIELQRLGVEVIGVDRYPNAPAMQIAHRSHVINMLDAKALRAIIEKP
PURT_PROMT      ------------LLGSGELGKEVAIAAKRLGC-YVIACDRYNDAPAMQIADVFNMNNGSELKEVIYKCNP
PURT_PECCP      ----------------------------------------------------------------------
PURT_ERWCT      ----------------------------------------------------------------------
PURT_ACIAD      ----------------------------------------------------------------------
CARB_STRGC      ----------------------------------------------------------------------
PURT_SHESM      ------------LLGCGELGKEVAIELQRLGVEVIGVDRYPNAPAMQIAHRSHVINMLDAKALRAIIEKP
PURT_BURVG      ----------------------------------------------------------------------
PURT_BURCM      ----------------------------------------------------------------------
CARB_XANAC      ----------------------------------------------------------------------
CARB_MACCJ      ----------------------------------------------------------------------
CARB1_METJA     ----------------------------------------------------------------------
Y4RH_RHISN      ----------------------------------------------------------------------
PURT_SHESR      ------------LLGCGELGKEVAIELQRLGVEVIGVDRYPNAPAMQIAHRSHVINMLDAKALRAIIEKP
PURT_ALCBS      ----------------------------------------------------------------------
CARB_XYLFA      ----------------------------------------------------------------------
CARB_THET8      ----------------------------------------------------------------------
PURT_SHEON      ----------------------------------------------------------------------
PURT_SHEFN      ----------------------------------------------------------------------
PURT_BURTA      ----------------------------------------------------------------------
PURT_BURS3      ----------------------------------------------------------------------
PURT_BURPS      ----------------------------------------------------------------------
PURT_BURP6      ----------------------------------------------------------------------
PURT_BURP1      ----------------------------------------------------------------------
PURT_BURP0      ----------------------------------------------------------------------
PURT_BURMS      ----------------------------------------------------------------------
PURT_BURMA      ----------------------------------------------------------------------
PURT_BURM9      ----------------------------------------------------------------------
PURT_BURM7      ----------------------------------------------------------------------
PURT_BORPE      ----------------------------------------------------------------------
CARB_XYLFT      ----------------------------------------------------------------------
CARB_STAAB      ----------------------------------------------------------------------
CARB_MYCGI      ----------------------------------------------------------------------
CARB_CLOBL      ----------------------------------------------------------------------
PYR1_DROME      ----------------------------------------------------------------------
PURT_VIBVY      ---TRESATRVLLLGSGELGKEVAIECQRLGLEV-IACDRYPDAPAMQVAHVFDMLDASELEKVIAAEQP
PURT_VIBVU      ---TRESATRVLLLGSGELGKEVAIECQRLGLEV-IACDRYPDAPAMQVAHVFDMLDASELEKVIAAEQP
PURT_COREF      ----------------------------------------------------------------------
PURT_BURCH      ----------------------------------------------------------------------
PURT_BURCA      ----------------------------------------------------------------------
CARB_PYRFU      -----------------------------------------------------------------FERPI
CARB_PEDPA      ----------------------------------------------------------------------
CARB_MYCLE      ----------------------------------------------------------------------
CARB_METHJ      ----------------------------------------------------------------------
CARB_ACIC5      ----------------------------------------------------------------------
CARB_ACIBL      ----------------------------------------------------------------------
PURT_VIBPA      ----------------------------------------------------------------------
CPSM_RAT        ----------------------------------------------------------------------
CARB_STRA5      ----------------------------------------------------------------------
CARB_STRA3      ----------------------------------------------------------------------
CARB_STRA1      ----------------------------------------------------------------------
CARB_MYCVP      ----------------------------------------------------------------------
CARB_MYCTU      ----------------------------------------------------------------------
CARB_MYCBO      ----------------------------------------------------------------------
CARB_METPE      ----------------------------------------------------------------------
CARB_EXIS2      ----------------------------------------------------------------------
PYR1_MESAU      ----------------------------------------------------------------------
PURT_YERPY      ----------------------------------------------------------------------
PURT_YERPS      ----------------------------------------------------------------------
PURT_YERPP      ----------------------------------------------------------------------
PURT_YERPN      ----------------------------------------------------------------------
PURT_YERPG      ----------------------------------------------------------------------
PURT_YERPE      ----------------------------------------------------------------------
PURT_YERPB      ----------------------------------------------------------------------
PURT_YERPA      ----------------------------------------------------------------------
PURT_LEPCP      ----------------------------------------------------------------------
CPSM_MOUSE      ----------------------------------------------------------------------
CARB_THET2      ----------------------------------------------------------------------
CARB_STRTD      ----------------------------------------------------------------------
CARB_STRT2      ----------------------------------------------------------------------
CARB_STRT1      ----------------------------------------------------------------------
CARB_STRAW      ----------------------------------------------------------------------
CARB_RUBXD      ----------------------------------------------------------------------
CARB_METTP      ----------------------------------------------------------------------
CARB_DEIGD      ----------------------------------------------------------------------
PYR1_HUMAN      ----------------------------------------------------------------------
PURT_VIBHB      ----------------------------------------------------------------------
PURT_SHESW      ----------------------------------------------------------------------
PURT_RHOFD      ----------------------------------------------------------------------
PURT_PROMH      ----------------------------------------------------------------------
MCCA_DICDI      ----------------------------------------------------------------------
CARB_STRMU      ----------------------------------------------------------------------
CARB_CLOAB      ----------------------------------------------------------------------
PURT_MYCA9      ----------------------------------------------------------------------
PURT_BORPA      ----------------------------------------------------------------------
PURT_BORBR      ----------------------------------------------------------------------
CARB_METLZ      ----------------------------------------------------------------------
CARB_FUSNN      ----------------------------------------------------------------------
CARB_BACHD      ----------------------------------------------------------------------
ACCC_BACHD      ----------------------------------------------------------------------
PURT_SHEPC      ----------------------------------------------------------------------
PURT_SHEB5      ----------------------------------------------------------------------
PURT_POLSJ      ----------------------------------------------------------------------
PURT_CORGL      ----------------------------------------------------------------------
PURT_CORGB      ----------------------------------------------------------------------
MCCA_ARATH      ----------------------------------------------------------------------
CARB_MYCSS      ----------------------------------------------------------------------
CARB_MYCSK      ----------------------------------------------------------------------
CARB_MYCSJ      ----------------------------------------------------------------------
CARB_LEUMM      ----------------------------------------------------------------------
CARB_LACSS      ----------------------------------------------------------------------
PURT_BORA1      ----------------------------------------------------------------------
PURT_ACIAC      ----------------------------------------------------------------------
MPTN_METAC      ----------------------------------------------------------------------
CARB_STRPZ      ----------------------------------------------------------------------
CARB_STRPG      ----------------------------------------------------------------------
CARB_STRP8      ----------------------------------------------------------------------
CARB_STRP6      ----------------------------------------------------------------------
CARB_STRP3      ----------------------------------------------------------------------
CARB_STRP1      ----------------------------------------------------------------------
CARB_METMJ      ----------------------------------------------------------------------
CARB_LACS1      ----------------------------------------------------------------------
CARB_LACJO      ----------------------------------------------------------------------
CARB_HALER      ----------------------------------------------------------------------
CARB_BEUC1      ----------------------------------------------------------------------
PURT_SULTO      ----------------------------------------------------------------------
PURT_PSYIN      ----------------------------------------------------------------------
PURT_METFK      ----------------------------------------------------------------------
PURT_DECAR      ----------------------------------------------------------------------
CPSM_RANCA      ----------------------------------------------------------------------
CARB_THETN      ----------------------------------------------------------------------
CARB_THENN      ----------------------------------------------------------------------
CARB_SULAC      ----------------------------------------------------------------------
PURT_THIDA      ----------------------------------------------------------------------
PURT_POLNA      ----------------------------------------------------------------------
MPTN_METMA      ----------------------------------------------------------------------
CARB_MYXXD      ----------------------------------------------------------------------
CARB_LACLA      ----------------------------------------------------------------------
CARB_LACAC      ----------------------------------------------------------------------
CARB_HALOH      ----------------------------------------------------------------------
CARB_YERPE      ----------------------------------------------------------------------
CARB_EXISA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DVVTFDHEHVPQPVLRELHDAGIVLRPGPEALHHAQDKLVMRTRLSELGAPCPRWRGITSLDEVTEFAGQ
PURK_MYCTU      DVLTFDHEHVPNELLEKLVADGVNVAPSPQALVHAQDKLVMRQRLAAAGVAVPRYAGIKDPDEIDVFAAR
PURK_MYCBO      DVLTFDHEHVPNELLEKLVADGVNVAPSPQALVHAQDKLVMRQRLAAAGVAVPRYAGIKDPDEIDVFAAR
PURK_CORAM      TAVTFDHEHVPNEHLTALIDAGYNDQPQPAALINAQDKLVMRERLAELGAPVPRFAPIESAQDAYDFWTL
PURK_MYCLE      DALTFDHEHVPTELLDKLVAEGINVAPSPQALVHAQDKLVXXXXXXXXXXXXXXFMALDSVDDLAELTGS
PURK_SYNE7      DVITFENEFVDLPALTELEETGVRFRPRPAAIASLLDKLDQRQLLTRLGLPTPRFXXXXXXXXXXXXXXX
PUR6_DEBOC      DILTVEIEHVDVEALKYVKEKGVEIYPLPDTIKLIQDKYLQKEHLIQHGISVTESVAVPSNDELIEIGNK
PUR6_YEAST      DVLTIEIEHVDVPTLKNLQHPKLKIYPSPETIRLIQDKYIQKEHLIKNGIAVTQSVPVEQASETSNVGRD
PUR6_PICME      DVLTVEIEHVDTDALVEVQKAGIKIFPSPETISLIKDKYLQKEHLIKNGIXXXXXXXXXXXXXXXXXXXK
PUR6_CANGA      DVMTVEIEHVDVNALKEVQKQKLEIYPTPETIGLIQDKYVQKQHLVKNRIPVPSITVENSKESLIKTGSS
PURK_BACSU      DIITYEFENIDYDALHWLKDHAY-LPQGSELLLITQNRETEKKAIQSAGCEVAPYSIVKTKNELKQAVQE
PUR6_SCHPO      TLLTTEIEHINTDALAAVTKS-VAVEPSPATLRCIQDKYLQKQHLQVFKIALPEFCDAPDQESVEKAGQE
PURK_VIBVY      DVITAEFEHIPHDILAICQASGKFL-PSSEAIKAGGDRRLEKTLLDHAGVRNANYYVIETREDFNKAIEH
PURK_VIBVU      DVITAEFEHIPHDVLAICQASGKFL-PSSEAIKAGGDRRLEKALLDHAGVRNANYYVIETREDFNKAIEH
PURK_SYNY3      GVITFENEFVDLPSLEKLAQQGITFHPRLDALAPLLDKWEQRHFLQNLGLPVPDFWALESLP-----AQL
PURK_VIBCH      DVITAEFEHIPHPILDLCARSG-KLYPSAEAIKAGGDRRLEKALLDRAQVANARYTMIRSRDDLTSAIAE
PUR6_CANAL      DVLTVEIEHVDVDALIKVQEKKVEIYPLPETIRLIQDKYLQKNHLIKHDVAVTESVAVNTVDDLLHIGEK
PURK_VIBF1      DVITAEFEHIPHHILDICSVSG-KFQPTPDAIKAGGDRRLEKKLLDNAHVANAKYHNINTKQDFLNAIDT
PURK_PSEAE      DLVTFEFESVPAETVAFLSQF-VPVYPNAESLRIARDRWFEKSMFKDLGIPTPDFXXXXXXXXXXXXXXX
PURK_VIBPA      DAITAEFEHIPHDVLDICELSGKFL-PSTAAIKAGGDRRVEKALLDNAGVRNAKHYVIETREDFERAIEH
PUR6_CRYNE      DILTVEIEHVNADVLEAVEKEGLCVQPSPQTIRLIQNKYDQKKYLAERGAPFEELPANPTEEDFKAIAGR
PURK_BRUME      DVITYEFENVPVSAADKLAETALVLPP-PAALEISQDRFTEKQFLNESGIETAPWRLVDDEETXXXXXXX
PUR6_CRYNV      DILTVEIEHVNADVLEAVEKEGLCVQPSPKTIRLIQNKYDQKKYLAEKGAPFEELPANPTEEDFKAIAGR
PUR6_VIGAC      GVLTVEIEHVDVDTLEKLEKQGVDCQPKASTVRIIQDKYQQKVALLPAWIPLPEFMKIDDLK--AKKWDS
PURK_AQUAE      DIITYEFEHIKDEVLEKCESK---LIPNPQALYVKKSRIREKLFLKKHGFPVPEFL-VIKRDEIIDALKS
PURK_STAS1      DVITYEFENISANQLQALASKYNIPQ-GYQAIQLLQDRLTEKQTLQDSGSNIAPFLQLTDYDDLVKAVDS
PURK_STAES      DVVTYEFENISSEQLKKLTQLYHIPQ-GYQAIELLQDRLTEKQTLLEANTQIVPFVQIQTNQDLLKAIEK
PURK_STAEQ      DVVTYEFENISSEQLKKLTKLYHIPQ-GYQAIELLQDRLTEKQTLLEANTQIVPFVQIQTNQDLLKAIEK
PURK_STAHJ      DVITYEFENISAEQLIRLTQK-FNIPQGYQAIQLLQDRLTEKQTLQKAGSKIVPFLPIKEEKDLNVVINQ
PURK_HAEIN      ------------------------------------DRFTQKSLLDELNLSTSPWCLLKDKNQWNDLFQT
PURK_ECOLI      SVITAEIERWPETALRELHPAFV----NRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDR
PURK_STAAW      DVITYEFENISAQQLKLLCEKYNIPQ-GYQAIQLLQDRLTEKETLKSAGTKVVPFISVKESTDIDKAIET
PURK_STAAS      DVITYEFENISAQQLKLLCEKYNIPQ-GYQAIQLLQDRLTEKETLKSAGTKVVPFISVKESTDIDKAIET
PURK_STAAC      DVITYEFENISAQQLKLLCEKYNIPQ-GYQAIQLLQDRLTEKETLKSAGTKVVPFISVKESTDIDKAIET
PURK_STAAR      DVITYEFENISAQQLKLLCEKYNIPQ-GYQAIQLLQDRLTEKETLKSAGTKVVPFISVKESKDIDKAIET
PURK_STAAN      DVITYEFENISAQQLKLLCEKYNIPQ-GYQAIQLLQDRLTEKETLKSAGTKVVPFISVKESTDIDKAIET
PURK_STAAM      DVITYEFENISAQQLKLLCEKYNIPQ-GYQAIQLLQDRLTEKETLKSAGTKVVPFISVKESTDIDKAIET
PURK_SULSO      DVITFEFEHVYEKALEYAEYSGKLL-PRLNSVELKRERYKEKLFYRQHNLPTPRFYGEEALKILREEFNN
PURT_PELPD      DLIVPEIEAIDTEFLLELEQGGQRVIPTARATNLTMNREIRRLAAEELGLPTARYAFAASLEEMRGHVAQ
PURT_SYNS3      DVLIPEIEALAVDALQALEDTGICVIPTARATAVTMNRDRIRNLAAELGLRTARFAYASDAQELQRAAAP
PURT_PELCD      DLIVPEIEAINTTFLLELEQQGFRIIPTARATNLTMNREIRRLAAEDLNLPTAAYRFASSYEEFCQAVEE
PURT_BACV8      DIIVPEIEAIRTERLYHLEQEGIQVVPSARAVNFTMNRKAIRDLAAELGLKTAKYFYAKSLEELQEAAKE
PURT_METM7      DLIVPEIEAINTDTLKELETEGYHVVPTANATKLTMDREIRRLAFEKLGLRTAKYEFAESLEELKEAVQR
PURT_METMP      DLIVPEIEAINTDTLKEMESEGYHVVPTANATKLTMDREIRRLAFEKLGLRTAKYEFAENLEELKEAVTR
PURT_SYNY3      DWIVPEVEAIRTEKLLELEAGGYRVIPTAQATNLTMNRRIRELAAQQLGVRTARYNYATSLAELEEVSQA
PURT_BACTN      DIIVPEIEAIRTERLYDFEKEGIQVVPSARAVNFTMNRKAIRDLAAELGLKTANYFYAKTLDELKEAAAK
PURT_SYNPW      ----------------------------------------------ELALRTARFAYAASAEELHAEAPA
PURT_SULAC      DAVIAEIEAINTETLSKIEMDGIKVMPNARAVKICMDRIELRRFAAEVKVPTTAYGFATSPEEVKKMCKD
PURT_METVS      DLIVPEIEAINTDTLKEMETEGYHVVPTANAAKLTMDREGIRRLASELGLRTAKYEFADSLDELKEAVKR
PURT_SYNS9      ---------------------GITVIPTARATAFTMNRDQIRDLASELGLHTARFAYASNAAELKKVAAP
PURT_CHLTE      DIIVPEIEAIRTERFYDYEKQGIQVVPSARAANFTMNRKAIRDLAADLGLRTANYRYASSLEELRSAVGE
PURT_METM5      DLIVPEIEAINTDTLKEMETEGYHVVPTANATKLTMDREIRRLAFEKLGLRTAKYEFAENLEELKEAVQR
PURT_META3      DYIIPEIEAINTDILIEMEEFGHQVVPTANAAKITMDREGIRRLASELNIPTAKYEFAESLEELKKAVKK
PURT_GEOMG      HLIVPEIEAIDTPYLLELEQEGYTVIPTARAANLTMNREIRRLAAEELGLPTAAYRFAASIESFRAAVKD
PURT_PROMA      DVVIPEIEALAVEALKDIEKEGINVIPNARATAITMNRDQIRNLAAELAIKTANYGYASNIEELKEVSKK
PURT_NITSB      DYILPEIEAINIEALFEAEERGFRVIPNAEAVNKTMNKNIRKFAAEELGLKTSQYRFVSSFEGLQEAART
PURT_METJA      DYIVPEIEAINTDALIDAEKMGYTVIPTAEATKITMNRLIRRLAAEKLGLKTAKYEFADSLEELRDAVEK
PURT_SYNPX      ----------------------------------------------ELALRSARFAYAASAEELRAEAPA
PURT_CHLPD      DVIVPEIEAIRTERFYDYEKEGIQVVPSARAANFTMNRKAIRDLASELGLRTATYRYAASKEELKRAIGE
PURT_PROMM      ---------------------------------------------AELALLTPKFAYAGSAEELKHAAEP
PURT_ANAVT      DFIIPEIEAIRTEKLQEFEDRGITVIPTAAATNYTMNRDRIRELAEELGIRTAKYGYAITLEELIAVSDE
PURT_PASMU      DYIVPEVEAIATATLVELEQAGFTVIPTAKATQLTMNREIRRLAAEELGLPTSNYQFVDNFDDFKRAVEK
PURT_LEPBL      ----------------------------------------------------------------------
PURT_LEPBJ      ----------------------------------------------------------------------
PURT_DESMR      DYIVPEIEAIATEELIKLEAEGYPVVPTARAARLTMDREIRRLAAEELGLVTSPYRFADTREEFLAACDA
PURT_THICR      DYIVPEIEAIATDTLAKLEQEGFNIVPSAKATQLTMNREIRRLAAEDLGIPTSPYAFADNKEDFTAAVDA
PURT_SYNSC      ----------------------------------------------ELNLRTARFAYASSAEELKAVAEP
PURT_BACFN      DIIVPEIEAIRTERLYDFEKEGIQVVPSARAVNYTMNRKAIRDLAAELGLKTAKYYYAKSXXXXXXXXXX
PURT_DESVV      YCIVPEIEAIATGTLLELEQEGYRVVPTARAARLTMDREIRRLAAEELGLPTSPYRFASTEEEYRAAIET
PURT_DESVH      YCIVPEIEAIATGTLLELEQEGYRVVPTARAARLTMDREIRRLAAEELGLPTSPYRFASTEEEYRAAIET
PURT_ANASP      DFIIPEIEAIRTEKLQEFEDRGITVIPTAAATNYTMNRDRIRELAEELGIRTAKYGYAVTLEELIAVSDN
PURT_ANADE      DVIVPEIEAIRTERLQAYEAQGVQVVPSARAAAFTMNRRAIRDLAAELGLATARYAYASTPEAFRAAVHE
PURT_HAES1      DYIVPEVEAIATSTLVELEQAGFNVVPTAKATQLTMNREGIRRLAAELKLPTSNYQFVDNFDDFQSAVEN
PURT_AZOSB      -------EAIATATLVELEAEGYTVIPTARAAQLTMNREIRRLAAEELGLPTSPYRFADSYEDYAAAVAA
PURT_FLAPJ      ----------------EYEKQGITVVPSAKAANFTMNRKAIRDLAAELGLKTANYRYATSAEELQKGVQA
PURT_ERYLH      DYVVPEIEAIRTEVLAEIEADGFNVVPSAYATQMTMNRDAIRDLAAELGITTSRYRYAKNLEEVRAAAEF
PURT_BIFLO      DIIVPEVEAIATDVLAGTAAAGAQVVPSAEIAAICMDRERLRVLAEELGLPTTPYRFAGSLEELRAGASE
PURT_SALAR      YIVP-EIEAIATDTLRDLEDEGLNVVPCARATQLTMNREIRRLAAEELGLPTSTYRFADSEASFRDAVAA
PURT_PROM3      ----------------------------------------------ELALLTPKFAYAGSAEELRHAAEP
PURT_BACFR      DIIVPEIEAIRTERLYDFEKEGIQVVPSARAVNYTMNRKAIRDLAAELGLKTAKYYYXXXXXXXXXXXXI
PURT_AERHH      DLIIPELEAIATDTLAALEQEGVKVVPNARATQLTMNREGIRRLAAELGLPTSPYHFAQSKEEFVAAVDT
PURT_DESDG      DFVVPEIEAIATDVLEELESDSLTVVPTARAARLTMNREIRRLAAEELGLRTSPYRFAQTEDEYRRAVEE
PURT_MANSM      DYIVPEVEAIATATLVELEQKGFTVVPTAKATQLTMNREIRRLAAEELGLPTSNYQFVDNFTDFKSAVEN
PURT_FRATW      ----------------------------------------------------------------------
PURT_FRATT      ----------------------------------------------------------------------
PURT_FRATN      ----------------------------------------------------------------------
PURT_FRAT1      ----------------------------------------------------------------------
PURT_CORJK      HFVIPDSETIPAEVLQEI-ETNEVASVVPTALANTMNREGIRTFAHDLGLPNSTFRFASTADELARAAEE
PURT_BACA2      DLIVPEVEAIATDELLKLEEEGFHVIPNARAAKLTMDREGIRRLAAELHLPTAGYEFANTYEEFKEAAET
PURT_SYNR3      ----------------------------------------------------------------------
PURT_PSEU5      -------EAIATATLVELEREGYTVIPTARAAQLTMNREIRRLAAEELGLPTSPYRFADTLDECRAAAMA
PURT_HALWD      --------------LKRLETQGYDVVPTAQATRLTMDREWIREAAEEVGVTTNEYAFADNYDTYRKAVED
PURT_SYNP6      ----------------------------------------------------------------------
PURT_SYNE7      ----------------------------------------------------------------------
PURT_PYRFU      DAIIPEIEAINLDALFEFEKEGYFVVPNAKATWIAMHRERLRTLVKEAKVPTSRYMYATTLDELYEACEK
PURT_BURXL      HLIVPEIEAIATDELAAIESAGLAVIPTARATQLTMNREIRRLAAEELGLPTSPYAFADSLDELRAGIAK
PURT_SULNB      -------EAISISALFEAEKRGFHVIPNAEAVNKTMNRKNIRVFAAELDLKTSGYEFVTTLDGLKAAGER
PURT_AERS4      DLIIPEIEAIATDTLAQLEQEGVKVVPNARATQLTMNREIRRLAAEELGLPTSPYRFAQSKEEFIAAVEA
CARB_LYSSC      -----------------LDELGIILGTKLDAIHKAEDRDLFRNLMYELGAPVPESDIIHSLDEAKRFVVK
PURT_SULDN      DYILPEIEAISIDALFEAEDKGYNVIPNANAVSKTMNRKNIRTFAAELELKTGAYEFVTTKEMLVSAAGR
PURT_PROMP      DFVVPEIEALSIEALKELEDEGINIVPNARTVEITMNRDKIRDLASELNIKTAKFSYVFNVDELEIKSSE
PURT_FRATO      ----------------------------------------------------------------------
PURT_FRATH      ----------------------------------------------------------------------
PURT_FRATF      ----------------------------------------------------------------------
PURT_ACTPJ      DFIVPEVEAIATATLVELEQEGYNVVPTAKATQLTMNREIRRLAAEELGLKTSPYRFVDNLEDFKQAVAE
PURT_XANC5      ----------------------------------------------------------------------
PURT_SALPC      -------EAIATDTLRELEDEGLNVVPCARATQLTMNREIRRLAAEELGLPTSTYRFADSEASFHDAVAA
PURT_SALCH      -------EAIATDTLRELEDEGLNVVPCARATQLTMNREIRRLAAEELGLPTSTYRFADSEASFHDAVAA
PURT_MARAV      -------EAIATPELVKLEQEGYRVIPSARAVNLTMNREIRRLAAEELGLPTSPYRFAGTREEYLQAVAE
PURT_HAEDU      DFIVPEVEAIATETLVELEQKGYQVVPTAKATQLTMNREIRRLAAEELGLPTSPYRFVDNFADFQQAVLA
PURT_XANCP      ------------------HEQGQKVIPTARAARLTMDREGIRRLAAELGLPTSPYRFVDTAAEYREAIAT
PURT_XANCB      ------------------HEQGQKVIPTARAARLTMDREGIRRLAAELGLPTSPYRFVDTAAEYREAIAT
PURT_XANC8      ------------------HEQGQKVIPTARAARLTMDREGIRRLAAELGLPTSPYRFVDTAAEYREAIAT
PURT_STRM5      -LIAQEQPHLVVPEIEAIHEQGLRVIPTARAARLTMDREGIRRLAAELGLPTSPYRFVDTEAEYRAAVAA
PURT_RALEJ      QLVVPEIEAIATPMLESLEAAGVVVIPTARAARLTMDREGIRRLAAELGLPTSPYKFCDSLEELTAIDGG
PURT_LEPIN      ----------------------------------------------------------SSIDELIKATEI
PURT_LEPIC      ----------------------------------------------------------SSIDELIKATEI
PURT_XANAC      -LIANERPHLIVPEIEAIHTEALVVIPTARAARLTMDREGIRRLAAELGLPTSPYRFVDTVEEYRDAIAA
PURT_PROM9      ----------------------------------------------------------------------
PURT_PROM0      ----------------------------------------------------------------------
PURT_MYCVP      DLVVPEIEAIATPALEALEAEGVTVIPTARAARLTMDREGIRRLAAELGLPTSPYRFCDSLEELTAIEGG
PURT_MYCGI      DLVVPEIEAIATPALEALEAEGVVVIPTARAARLTMDREGIRRLAAELGLPTSPYRFCDSLEELAAIDGT
PURT_PYRHO      DAIIPEIEAINLDALFEFEKDGYFVVPNARATWIAMHRERLRTLVKEAKVPTSRYMYATTLDELYEACEK
PURT_PROM5      DFVVPEIEALSIEALKELEEEGINIVPNARTVEITMNRHKIRDLASELNIKTANFSYVFNAEELEMKSSE
CARB_SCHPO      GIVVSVGGQLPQNIALKLQETGAVLGTDPLMIDSAEDRHKFSQILDKIGVDQPAWKELTSVAEASKFANA
CARB_CLOBA      ----------------ELHDAGIVIGTSIESIKEGEDRELFRDMMNRIGEPVIKSEIVTDLQAGIDFANK
CARB_BACSU      ----------------ELSERGVLAECGVEAIQQAEDRDLFRTLMNELNEPVPESEIIHSLEEAEKFVSQ
PURT_STRMK      -LIAQEQPHLVVPEIEAIHEQGLRVIPTARAARLTMDREGIRRLAAELGLPTSPYRFVDTEAEYRAAVAA
PURT_SALPB      -------EAIATDTLRELEGEGLNVVPCARATQLTMNREIRRLAAEELGLPTSTYRFADSEASFHDAVAA
PURT_SALNS      -------EAIATDTLRELEGEGLNVVPCARATQLTMNREIRRLAAEELGLPTSTYRFADSEASFHDAVAA
PURT_IGNH4      -------EAINTDALVDLEKEGYFVVPNARAVKITMNRIELRRLAAEVGVPTTRYAFAHNEDEAAEACEK
PURT_BIFAA      ----------------------------------------------ELGLPTTPYRFAGSLEELREGAQI
PURT_ACTP7      DFIVPEVEAIATATLVELEQEGYNVVPTAKATQLTMNREIRRLAAEELGLKTSPYRFVDNLEDFKQAVAE
PURT_ACTP2      DFIVPEVEAIATATLVELEQEGYNVVPTAKATQLTMNREIRRLAAEELGLKTSPYRFVDNLEDFKQAVAE
CARB_ASHGO      ----------PQNIASQLYEQGAILGTSPEDIDKAEDRHKFSTILDTLGLDQPRWSELKSLSEVKHFLDD
PURT_PYRKO      --------------------------------------------------PTSRYTYASTLDELYEACEK
PURT_PASHA      ----------------------------------------------------------------------
PURT_ERWT9      DFVVPEIEAIATDMLVELEKQGQHVVPTARAAKLTMDREIRRLAAEELWVPTSDYRFADGYDAFQAAAEA
PURT_DESAD      ----------------------------------------------------------------------
CARB_CLOBB      ----------------ELHDSGIVIGTSIESIKEGEDRELFRDMMNRIGEPVIKSEIVTDLQSGIDFANK
PURT_SALTY      -------EAIATDTLRELEGEGLNVVPCARATQLTMNREIRRLAAEELGLPTSTYRFADSEASFHDAVAA
PURT_SALTI      -------EAIATDTLRELEGEGLNVVPCARATQLTMNREIRRLAAEELGLPTSTYRFADSEASFHDAVAA
PURT_SALSV      -------EAIATDTLRELEGEGLNVVPCARATQLTMNREIRRLAAEELGLPTSTYRFADSEASFHDAVAA
PURT_SALPK      -------EAIATDTLRELEGEGLNVVPCARATQLTMNREIRRLAAEELGLPTSTYRFADSEASFHDAVAA
PURT_SALPA      -------EAIATDTLRELEGEGLNVVPCARATQLTMNREIRRLAAEELGLPTSTYRFADSEASFHDAVAA
PURT_SALDC      -------EAIATDTLRELEGEGLNVVPCARATQLTMNREIRRLAAEELGLPTSTYRFADSEASFHDAVAA
PURT_PYRAB      DAIIPEIEAINLDALFEFEKEGYFVVPNARATWIAMHRERLRTLVKEAKVPTSRYMYATTLDELYEACEK
CARB_STAES      ----------------QLHDSGVLLGTELESIQQAEDREMFRTLMNDLNVPVPESDIVNTVEQAFEFKEQ
CARB_STAEQ      ----------------QLHDSGVLLGTELESIQQAEDREMFRTLMNDLNVPVPESDIVNTVEQAFEFKEQ
PURT_PROMS      ----------------------------------------------------------------------
PURT_AZOVD      -------EAIATATLVELESEGFTVIPSARAANLTMNREIRRLAAEELGLPTSPYRFADSFEEYRAAAEA
CARB_BACCL      -----------------LEECGVILGTKLEAIEKAEDREQFRALMNELGEPVPESAIIHSLEEAYAFVEQ
PURT_TOLAT      ----------------------------------------------------------------------
PURT_RALEH      HLVVPEIEAIATPMLETLEAAGTVVIPTARAARLTMDREGIRRLAAELGLPTSPYKFCDSLDELAAIDGG
PURT_HAHCH      ----------------------------------------------------------------------
CARB_LACRJ      -----------------------------DSIDEAEDREKFKELMNELGEPVPASQTVNTVDEAVEFAHQ
CARB_LACRD      -----------------------------DSIDEAEDREKFKELMNELGEPVPASQTVNTVDEAVEFAHQ
PURT_VIBCM      ----------------------------------------------------------------------
PURT_VIBCH      ----------------------------------------------------------------------
PURT_RHOSR      ---------------------------------------IRRLAAEELGLPTSPYEFAESLEEVRAATER
PURT_RALME      DLVVPEIEAIATPMLEALEAAGVVVIPTARAARLTMDREGIRRLAAELGLPTSPYKFCDSLEELAAIDGG
PURT_PSEU2      ----------------------------------------------------------------------
PURT_PSESM      ----------------------------------------------------------------------
PURT_PSEPK      -------EAIATATLVELENEGFTVVPTARATQLTMNREIRRLAAEELDLPTSPYHFADTYEDYAKAVAD
PURT_PSEFS      ----------------------------------------------------------------------
PURT_PSE14      ----------------------------------------------------------------------
PURT_PHOPR      ----------------------------------------------------------------------
PURT_DESVM      ---------------------------------------IRRLAAEELGLPTSPYRFAETEAEYREAVAA
PURT_CUPTR      HLVVPEIEAIATPMLETLEAAGTVVIPTARAARLTMDREGIRRLAAELGLPTSPYKFCDSLEELAAIDGG
PURT_XANOP      ----------------------------------------------------------------------
PURT_PSEPW      ----------------------------------------------------------------------
PURT_PSEPG      ----------------------------------------------------------------------
PURT_PSEPF      ----------------------------------------------------------------------
PURT_BACSU      DLIVPEVEAIATDELLKLEEEGFHVIPNARAAKLTMDREIRRXXXXXXXXXXXXYEFANTYDEFIQAAAQ
CARB_BACCN      -----------------LEECGVILGTKLSAIEQAEDRDLFRTLMQELNEPTPPSEIVHTLDEAYEFVKE
CARB_BACC2      ----------------ELAKSGILEECGVEAIEQAEDRDLFRTLMQELNEPIPSSTIIHTLEEAHEFVKE
PURT_WOLSU      ---------------------GFCVIPSAKAVSLTMNRKGIRTAAEEVGVKTSQYRFVKTLDELRSAAEE
PURT_PSEF5      ----------------------------------------------------------------------
PURT_PSEE4      ----------------------------------------------------------------------
PURT_PSEAE      -------EAIATATLVELEAEGYTVVPTARAAQLTMNREIRRLAAEELGLPTSPYHFADTFEDYRRGVER
PURT_PSEAB      -------EAIATATLVELEAEGYTVVPTARAAQLTMNREIRRLAAEELGLPTSPYHFADTFEDYRRGVER
PURT_PSEA8      -------EAIATATLVELEAEGYTVVPTARAAQLTMNREIRRLAAEELGLPTSPYHFADTFEDYRRGVER
CARB_TRICU      ---------LPQNIALRLKKAGVVLGTDPEMIDSAEDRHKFSSILDSIGVDQPAWTEASSLASAKEFANR
CARB_CLOB8      ----------------ELHDSGIVIGTSIASIKEGEDRELFRDMMNRIGEPVIKSEIVTDLTAGLEFANK
CARB_BACWK      ----------------ELAKSGILEECGVEAIEQAEDRDLFRTLMQELNEPIPSSTIIHTLEEAHEFVKE
PURT_XANOR      ----------------------------------------------------------------------
PURT_XANOM      ----------------------------------------------------------------------
PURT_VIBF1      DFVVPEIEAIATDKLVELEKQGLNVVPTANATKLTMNREIRRLAAEELQLPTSPYRFVDSYEELVEAVKF
PURT_SHIFL      ----------------------------------------------------------------------
PURT_SHIF8      ----------------------------------------------------------------------
CARB_PELTS      -----------------LQDYGVELLGTPESIKKAENRELFKNLMLEIGEPVPRSTIAGSVEECLAFAGE
CARB_BACST      -----------------LEECGVILGTKLEAIEKAEDREQFRALMNELGEPVPESAIIHSLEEAYAFVEQ
PYC_HUMAN       -------------------DAGVFIGPSPEVVRKMGDKVEARXXXXXXXXXXXXXTDITSLHEAHEFSNT
PYC_BOVIN       -------------------DAGVFIGPSPEVVRKMGDKVEARXXXXXXXXXXXXXTDITSLHEAHEFSNT
PURT_SHIBS      ----------------------------------------------------------------------
PURT_SHIB3      ----------------------------------------------------------------------
PYR1_EMENI      ----------PNNIALPLHRLNVILGTSPEMIDGAENRYKFSRMLDRIGVDQPAWKELTSIEEAREFCDK
PURT_WIGBR      DFIVPEIEAISTNALIELEKNGYNIVPSAKTIHITMNRKLIRVLVSKLNILTSEYQFASSFDELKIKTKV
PURT_SODGM      ---------------------------------------IRRLAAETLSLPTSRYRFAADRAELDKAVEA
PURT_SHISS      ----------------------------------------------------------------------
PURT_SHIDS      ----------------------------------------------------------------------
PURT_ECOUT      ----------------------------------------------------------------------
PURT_ECOLI      ----------------------------------------------------------------------
PURT_ECOL5      ----------------------------------------------------------------------
PURT_ECOK1      ----------------------------------------------------------------------
PURT_ECODH      ----------------------------------------------------------------------
PURT_ECOBW      ----------------------------------------------------------------------
PURT_ECO57      ----------------------------------------------------------------------
CARB_GEMAT      -----------------LHDSGVLAKYGCEAIRVAEDRKLFGEAMEKIGLRCPTGRTVTSLEEALSAVEE
CARB_BACC3      -----------------LEECGVILGTKLSAIEQAEDRDLFRTLMQELNEPTPPSEIIHNLDEAYGFVNE
CARB_BACC0      -----------------LEECGVILGTKLSAIEQAEDRDLFRTLMQELNEPTPPSEIIHNLDEAYGFVNE
CARB_BACAN      -----------------LEECGVILGTKLSAIEQAEDRDLFRTLMQELNEPTPPSEIIHNLDEAYGFVNE
CARB_BACAH      -----------------LEECGVILGTKLSAIEQAEDRDLFRTLMQELNEPTPPSEIIHNLDEAYGFVNE
CARB_BACAC      -----------------LEECGVILGTKLSAIEQAEDRDLFRTLMQELNEPTPPSEIIHNLDEAYGFVNE
CARB_BACAA      -----------------LEECGVILGTKLSAIEQAEDRDLFRTLMQELNEPTPPSEIIHNLDEAYGFVNE
PYC1_CAEEL      -------------------NAGIVIGPSPDVMARMGDKVAARQAAIEAGVQVPGTPGITTADEAVEFAKQ
PURT_MYCS2      DLVVPEIEAIATPVLEALEAEGVTVIPTARATRLTMDREGIRRLAAELGVPTSPYRFCDSLAELAAIDDE
PURT_METCA      ----------------------------------------------------------------------
PURT_EDWI9      ----------------------------------------------------------------------
CARY_BACST      ----------------QLHEAGVLKKYGVRLLGTPIEAITFRALMHELGEPVPESEIVTSVEEAVAFAEQ
CARB_SYMTH      ----------------QLEEAGVLARYGVRAIRRAEDRAEFRALMKEIGEPVPESAIVTTPEEALAFGEE
CARB_LISW6      ----------------ELSAAGIVLGTDLTAIKKAEDREAFRDLMNELGEPVPESDIIHNLDEAYSFVER
CARB_BACC1      -----------------LEECGVILGTKLSAIEQAEDRDLFRTLMQDLNEPTPPSEIIHNLDEAYSFVNE
PYR1_YEAST      -----------------------ILGTSPDMIDSAENRYKFSRMLDQIGVDQPAWKELTSMDEAESFAEK
PYR1_SCHPO      -----------------------ILGTSPEMIDGAENRFKFSRMLDDIGVDQPKWKELTSFDEADKFCDT
PURT_SHEAM      HLVIPEIEAIATQTLVELEAEGLKVVPTARATRLTMDREGIRRLAAELALPTSPYVFCDSLTELQAALKV
PURT_PARD8      ----------------------------------------------------------------------
PURT_KLEP3      ----------------------------------------------------------------------
CARB_SULTO      -VATFTGGQIGNNISKKLEEEGILLGTSGRSIDTAEDREKFSKLLDKLGIKQPEWISARSLEEVKEFISK
CARB_STRS7      ----------------ELSKAGILQELGVEAIDQAEDRDLFKQLMKELGEPIPESEIVTTVEGAISFANA
CARB_STRCO      ----------PLGLSQALKDNGVVVGTSPEAIHAAEDRGAFGRVLAEAGLPAPKHGTATTFGEAKAIADE
CARB_STAS1      ----------------QLHDSGELLGTELESIQQAEDRELFRTLMNDLGVPVPESDIVNTVEQAFAFKEE
CARB_STAHJ      ----------------QLHDSGVLLGTELKSIQQAEDRELFRSLMNDLNVPVPESDIVNTVEQAFAFKDE
CARB_LISMO      ----------------ELSAAGIVLGTDLTAIKKAEDREAFRDLMNELGEPVPESDIIHNLDEAYAFVER
CARB_LISMH      ----------------ELSAAGIVLGTDLTAIKKAEDREAFRDLMNELGEPVPESDIIHNLDEAYTFVER
CARB_LISMF      ----------------ELSAAGIVLGTDLTAIKKAEDREAFRDLMNELGEPVPESDIIHNLDEAYTFVER
CARB_LISMC      ----------------ELSAAGIVLGTDLTAIKKAEDREAFRDLMNELGEPVPESDIIHNLDEAYTFVER
CARB_LISIN      ----------------ELSAAGIVLGTDLTAIKKAEDREAFRDLMNELGEPVPESDIIHNLDEAYTFVER
CARB_DESAP      ---------------KQVADAGILDQYGVESIKRAEDREHFKNMCLEIGEPVPESSIISDVDAAVAFARK
CARB_BACHK      -----------------LEECGVILGTKLSAIEQAEDRDLFRTLMQELNEPTPPSEIIHNLDEAYGFVKE
PYC_RAT         -------------------DAGVFIGPSPEVVRKMGDKVEARXXXXXXXXXXXXXTNINSLHEAHEFSNT
PYC_MOUSE       -------------------DAGVFIGPSPEVVRKMGDKVEARXXXXXXXXXXXXXTDISSLHEAHEFSNT
PURT_ENTS8      ----------------------------------------------------------------------
CARB_XANCP      -----------------------------EAIRMAEDRELFRVAMGEIGLDCPRAEVAHTLEEALDIQTR
CARB_SULIY      -VATFSGGQIGNSIAKELEENGVLLGTSGSSVDIAENREKFSKLLDKLGISQPNWVSATSLEEIKKFVNE
CARB_SULIN      -VATFSGGQIGNSIAKELEENGVLLGTSGSSVDIAENREKFSKLLDKLGISQPNWVSATSLEEIKKFVNE
CARB_SULIM      -VATFSGGQIGNSIAKELEENGVLLGTSGSSVDIAENREKFSKLLDKLGISQPNWVSATSLEEIKKFVNE
CARB_SULIL      -VATFSGGQIGNSIAKELEENGVLLGTSGSSVDIAENREKFSKLLDKLGISQPNWVSATSLEEIKKFVNE
CARB_SULIK      -VATFSGGQIGNSIAKELEENGVLLGTSGSSVDIAENREKFSKLLDKLGISQPNWVSATSLEEIKKFVNE
CARB_SULIA      -VATFSGGQIGNSIAKELEENGVLLGTSGSSVDIAENREKFSKLLDKLGISQPNWVSATSLEEIKKFVNE
CARB_STRSV      ------------------------------AIDQAEDRDLFKQLMEELGQPIPESEIVNTVDEALEFAAG
CARB_STRGG      ----------PLGLSQALKDNGVVVGTSPEAIHAAEDRGAFGRVLAEAGLPAPKHGTATTFAEAKAIADE
CARB_HYPBU      ----------------ELHRRGILSRYGIEGIEKALSRGKFRETMMKAGLPVPPSTPATSVEEALRAANE
CARB_BACCZ      -----------------LEECGVILGTKLSAIEQAEDRDLFRTLMQDLNEPTPPSEIIHNLDEAYGFVNE
CARB_BACCQ      -----------------LEECGVILGTKLSAIEQAEDRDLFRTLMQDLNEPTPPSEIIHNLDEAYGFVNE
CARB_BACC7      -----------------LEECGVILGTKLSAIEQAEDRDLFRTLMQDLNEPTPPSEIIHNLDEAYGFVNE
PURT_THISH      ---------------------------------------IRRLAAEELGLQTSRYAFADSLESLTAIDGG
CARB_SULSO      -VATFSGGQIGNSIAKELEENGVLLGTSGSSVDIAENREKFSKLLDKLGISQPDWISATSLGEIKKFANE
CARB_LACPL      -------------ILDELHIE--LLGTKLSAIDQAEDREQFKALMEELGEPVPASGIARTVDEALAFAKQ
CARB_BACCR      -----------------LDECGVILGTKLSAIEQAEDRDLFRTLMQDLNEPTPPSEIIHNLDEAYGFVNE
CARB_BACC4      -----------------LDECGVILGTKLSAIEQAEDRDLFRTLMQDLNEPTPPSEIIHNLDEAYGFVNE
PURT_SULSO      ----------------------------------------------------------------------
PURT_PROM1      DIIIPEIEALAVDVLKEIEQK-ITVIPNSRATATTMNRDKIRDLASELNIRTAKFSYAVNQSELDLHAET
PURT_ACIBT      ----------------------------------------------------------------------
CARB_YEAST      ---------LPQNIALKLYDNGCIMGTNPNDIDRAENRHKFSSILDSIDVDQPEWSELTSVEEAKLFASK
CARB_STRE4      ----------------ELSKAGILQELGVEAIDQAEDRDLFKQLMKELGEPIPESEIVTTVEAAIGFANA
CARB_STACT      ----------------QLHDSGVLLGTKLSSIQQAEDRELFRSLMNELDVPVPESDIVNTVEQAFAFKEQ
CARB_STAAW      ----------------QLHESGVLLGTELTSIQQAEDREMFRTLMNDLNVPVPESDIVNTVEQAFKFKEQ
CARB_STAAT      ----------------QLHESGVLLGTELTSIQQAEDREMFRTLMNDLNVPVPESDIVNTVEQAFKFKEQ
CARB_STAAS      ----------------QLHESGVLLGTELTSIQQAEDREMFRTLMNDLNVPVPESDIVNTVEQAFKFKEQ
CARB_STAAR      ----------------QLHESGVLLGTELTSIQQAEDREMFRTLMNDLNVPVPESDIVNTVEQAFKFKEQ
CARB_STAAN      ----------------QLHESGVLLGTELTSIQQAEDREMFRTLMNDLNVPVPESDIVNTVEQAFKFKEQ
CARB_STAAM      ----------------QLHESGVLLGTELTSIQQAEDREMFRTLMNDLNVPVPESDIVNTVEQAFKFKEQ
CARB_STAAE      ----------------QLHESGVLLGTELTSIQQAEDREMFRTLMNDLNVPVPESDIVNTVEQAFKFKEQ
CARB_STAAC      ----------------QLHESGVLLGTELTSIQQAEDREMFRTLMNDLNVPVPESDIVNTVEQAFKFKEQ
CARB_STAA9      ----------------QLHESGVLLGTELTSIQQAEDREMFRTLMNDLNVPVPESDIVNTVEQAFKFKEQ
CARB_STAA8      ----------------QLHESGVLLGTELTSIQQAEDREMFRTLMNDLNVPVPESDIVNTVEQAFKFKEQ
CARB_STAA3      ----------------QLHESGVLLGTELTSIQQAEDREMFRTLMNDLNVPVPESDIVNTVEQAFKFKEQ
CARB_STAA2      ----------------QLHESGVLLGTELTSIQQAEDREMFRTLMNDLNVPVPESDIVNTVEQAFKFKEQ
CARB_STAA1      ----------------QLHESGVLLGTELTSIQQAEDREMFRTLMNDLNVPVPESDIVNTVEQAFKFKEQ
CARB_NATTJ      ----------------ELVDSGILLGTTMSSIKKAEDRDVFKTTMNDIGEPIPESKIVSTVDQAKDFAKN
PURT_YERE8      ----------------------------------------------------------------------
PURT_VARPS      TLVVPEIEAIATPMLQQLEDAGVVVIPTARAARLTMDREGIRRLAAELGVPTSPYKFCDSLAELAAIDAG
PURT_SHESA      HLVIPEIEAIATQTLVEMETEGLNVVPTARATQLTMDREGIRRLAAELGLPTSPYFFCDTETEFNQAIGK
PURT_PROMT      DIIIPEIEALAVDVLKEIEQK-ITVIPNSRATAITMNRDKIRDLASELNIRTAKFSYAVNQSELDLHAET
PURT_PECCP      ----------------------------------------------------------------------
PURT_ERWCT      ----------------------------------------------------------------------
PURT_ACIAD      ----------------------------------------------------------------------
CARB_STRGC      ------------------------------AIDQAEDRDLFKQLMEELGQPIPESEIVNTVDEALEFAAG
PURT_SHESM      HLVIPEIEAIATQTLVEMEAEGLNVVPTARATQLTMDREGIRRLAAELGLPTSPYFFCDTETEFNQAIGK
PURT_BURVG      ----------------------------------------------------------------------
PURT_BURCM      ----------------------------------------------------------------------
CARB_XANAC      -----------------------------EAIRMAEDRELFRVAMGEIGLDCPTAAVAHTLEEALEIQTR
CARB_MACCJ      ----------------QLHEAGILLGTKLSSIEQAEDRDLFRNLMNELNEPVPESDIVNTVQQAIDFATS
CARB1_METJA     ----------------ELHRRGILDKYGIKLLGSAEDRELFAEAMAEINEPVTKCKAVNSVDEAVEFAEE
Y4RH_RHISN      --------------------------PDPESIEQCCNKAAQRQVLAAAGVPVPGYRSATTAAEVQCVAAE
PURT_SHESR      HLVIPEIEAIATQTLVEMEAEGLNVVPTARATQLTMDREGIRRLAAELGLPTSPYFFCDTETEFNQAIGK
PURT_ALCBS      ----------------------------------------------------------------------
CARB_XYLFA      -----------------------------EAIRMAEDRELFRVAMQEIGLECPKAEVAKSLERALEIQAK
CARB_THET8      -----------------LHEEGILQKYGAEAIRKGEDREAFQEAMQRIGLEVPRGQLVGSVEEGLHFARE
PURT_SHEON      ----------------------------------------------------------------------
PURT_SHEFN      ----------------------------------------------------------------------
PURT_BURTA      ----------------------------------------------------------------------
PURT_BURS3      ----------------------------------------------------------------------
PURT_BURPS      ----------------------------------------------------------------------
PURT_BURP6      ----------------------------------------------------------------------
PURT_BURP1      ----------------------------------------------------------------------
PURT_BURP0      ----------------------------------------------------------------------
PURT_BURMS      ----------------------------------------------------------------------
PURT_BURMA      ----------------------------------------------------------------------
PURT_BURM9      ----------------------------------------------------------------------
PURT_BURM7      ----------------------------------------------------------------------
PURT_BORPE      ----------------------------------------------------------------------
CARB_XYLFT      -----------------------------EAIRMAEDRELFRVAMQEIGLECPKAEVAKSLERALEIQAK
CARB_STAAB      ----------------QLHESGVLLGTELTSIQQAEDREMFRTLMNYLNVPVPESDIVNTVEQAFKFKEQ
CARB_MYCGI      ----------PLGLAERLEKAGVIVGTKPEAIDLAEDRGEFGEVLRRAGLPAPRFGMATSFDQARRIAAE
CARB_CLOBL      ----------------ELYDKGILKKYGVESIKEGEDRELFRNVMSRINEPVIQSEIVTDMEDGKDFANK
PYR1_DROME      ---------LPNNIAMDLHQQAKVLGTSPESIDCAENRFKFSRMLDRKGILQPRWKELTNLQSAIEFCEE
PURT_VIBVY      AFVVPEIEAIATDKLVELEEQGLNVVPSAKATKLTMNREIRRLAAEELGLTTSPYRFADNYQQFVEAVEA
PURT_VIBVU      AFVVPEIEAIATDKLVELEEQGLNVVPSAKATKLTMNREIRRLAAEELGLTTSPYRFADNYQQFVEAVEA
PURT_COREF      ---------------------------------------IRRLASEELGLPTSGYEFCSTFEEFTAAAER
PURT_BURCH      ----------------------------------------------------------------------
PURT_BURCA      ----------------------------------------------------------------------
CARB_PYRFU      GVVAFAGGQLANSLAKKLENAGVLLGTSGKSVDKAENRAKFSKLLEKLGIPQPEWISAESIDEAIKLAKK
CARB_PEDPA      -----------------------------DAIDQAEDRERFRALMNDLNEPVPDSGIATTVEEAVSFADQ
CARB_MYCLE      ----------PLGLAQRLADAGVIVGTSPEAIDLAEDRGAFGDVLTAAGLPAPKYGTATTFAQARRIAAE
CARB_METHJ      -----------------------------KAIYEGEDREKFRDLMNRIGEPVPRSVIVSSLDQLEHAASV
CARB_ACIC5      ----------------ELADAGILDKYGVEAIKKAEDRLLFKDAMTRIGLDVPRSALVNNIRDGLEFATK
CARB_ACIBL      ------------------------------AIKKAEDRLLFKDAMAKIGLDVPRSALINNLKDGLEFSGK
PURT_VIBPA      ----------------------------------------------------------------------
CPSM_RAT        ---------IPNNLAVPLYKNGVIMGTSPLQIDRAEDRSIFSAVLDELKVAQAPWKAVNTLNEALEFANS
CARB_STRA5      ------------------------------AIDKAEDRDLFKQLMEELNQPIPESEIVNSVEEAIQFAEQ
CARB_STRA3      ------------------------------AIDKAEDRDLFKQLMEELNQPIPESEIVNSVEEAIQFAEQ
CARB_STRA1      ------------------------------AIDKAEDRDLFKQLMEELNQPIPESEIVNSVEEAIQFAEQ
CARB_MYCVP      ----------PLGLAERLEKAGVIVGTLPEAIDLAEDRGEFGEVLRRAGLPAPRFGMATSFDQARRIAAE
CARB_MYCTU      ----------PLGLAHRLADAGVIVGTPPEAIDLAEDRGAFGDLLSAAGLPAPKYGTATTFAQARRIAEE
CARB_MYCBO      ----------PLGLAHRLADAGVIVGTPPEAIDLAEDRGAFGDLLSAAGLPAPKYGTATTFAQARRIAEE
CARB_METPE      -----------------------------EAIYQGEDREKFKALMQKIGEPVPRSMILNRLDQLGEVIEK
CARB_EXIS2      ----------------ELDRLGVLAEYGVEAIEEAEDRDLFRKLMFKLGHGVPESEIVHTVEEAEQFCAK
PYR1_MESAU      -----------------------VLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQT
PURT_YERPY      ----------------------------------------------------------------------
PURT_YERPS      ----------------------------------------------------------------------
PURT_YERPP      ----------------------------------------------------------------------
PURT_YERPN      ----------------------------------------------------------------------
PURT_YERPG      ----------------------------------------------------------------------
PURT_YERPE      ----------------------------------------------------------------------
PURT_YERPB      ----------------------------------------------------------------------
PURT_YERPA      ----------------------------------------------------------------------
PURT_LEPCP      ----------------------------------------------------------------------
CPSM_MOUSE      ---------IPNNLAVPLYKNGVIMGTSPLQIDRAEDRSIFSAVLDELKVAQAPWKAVNTLNEALEFANS
CARB_THET2      ----------PLKLAKGLEEAGVRLLGTPSAIHQAEDREAFHALCQRLGIPQPEGRVAQSPEEALRLAPE
CARB_STRTD      ----------------ELSKAGILDELGVEAIDQAEDRDLFKQLMEELEQPIPESEIVNTVEEAVAFATE
CARB_STRT2      ----------------ELSKAGILDELGVEAIDQAEDRDLFKQLMEELEQPIPESEIVNTVEEAVAFATE
CARB_STRT1      ----------------ELSKAGILDELGVEAIDQAEDRDLFKQLMEELEQPIPESEIVNTVEEAVAFATE
CARB_STRAW      ----------PLGLSQALKDNGVVVGTPPEAIHAAEDRGAFGQVLAEAGLPAPKHGTATTFAGAKAIADE
CARB_RUBXD      ----------------ELSEAGVLEEYGVQLLQKAEDRQLFREAMERIGLRVPESRTVRSVPEAEELAER
CARB_METTP      -------------ITSELAEMGVLEKYGVEVLQEAEDRDLFKKAMERIGEPVPRSIAVTSLEEAEEAMKE
CARB_DEIGD      -----------------------------EAIHKGEDREAFQAAMKKIGVETARGKMVHSLEEAIEYQKE
PYR1_HUMAN      -----------------------VLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQT
PURT_VIBHB      ----------------------------------------------------------------------
PURT_SHESW      ----------------------------------------------------------------------
PURT_RHOFD      ----------------------------------------------------------------------
PURT_PROMH      ----------------------------------------------------------------------
MCCA_DICDI      ----------------------IFIGPPSDAIKAMGSKSASKDIMIKAGVPTPGYHGEDSMSVLKSEAAK
CARB_STRMU      ----------------ELSRAGILDELGVEAIDQAEDRDLFKQLMEDLEQPIPESDIVNSVDEAVAFAAK
CARB_CLOAB      -----------------LNDAGVLLGINSEAIKKAEDREEFKNLMEEIDEPVPKSIIATHIDECIDFVNK
PURT_MYCA9      ----------------------------------------------------------------------
PURT_BORPA      ----------------------------------------------------------------------
PURT_BORBR      ----------------------------------------------------------------------
CARB_METLZ      -----------------------------EAIYHGEDRDLFKKLMLEIGEPIPKSFILTKIEQLDEAYEE
CARB_FUSNN      -----------------LHESGILDECGVEILKQAEDRELFRDLMNELNEPVPDSAIVHTLEEAENFVKE
CARB_BACHD      ----------------ELDQAGILKEYNVELLQQAEDRDLFRALMKELNEPVPDSEIIHTLEEAYTFVER
ACCC_BACHD      -------------------EAGIFIGPSPEVIERMGSKIAARTAMQTAGVPVIPGSDVALADEAVHLARK
PURT_SHEPC      ----------------------------------------------------------------------
PURT_SHEB5      ----------------------------------------------------------------------
PURT_POLSJ      ----------------------------------------------------------------------
PURT_CORGL      ----------------------------------------------------------------------
PURT_CORGB      ----------------------------------------------------------------------
MCCA_ARATH      -------------------DSGLTIGPPASAIRDMGDKSASKRIMGAAGVPLPGYHGHEQIDHMKSEAEK
CARB_MYCSS      ----------PLGLAERLEQAGVIVGTSPKAIDLAEDRGAFGEVLRTAGLPAPRFGLATTFDQARRIAAD
CARB_MYCSK      ----------PLGLAERLEQAGVIVGTSPKAIDLAEDRGAFGEVLRTAGLPAPRFGLATTFDQARRIAAD
CARB_MYCSJ      ----------PLGLAERLEQAGVIVGTSPKAIDLAEDRGAFGEVLRTAGLPAPRFGLATTFDQARRIAAD
CARB_LEUMM      ---------------KDLSEAGILLGTKLSAIEEAEDREEFKALMERLNEPIPESIIATTLEESLNFADT
CARB_LACSS      ------------------------------AIDQAEDRELFKNLMNQLNEPIPESAIAHSLDDAQEFVKQ
PURT_BORA1      ----------------------------------------------------------------------
PURT_ACIAC      ----------------------------------------------------------------------
MPTN_METAC      -------------ILRELEAGGVTVMNSPEAIQNAANKYHASYLLARAGLPVPETVAVQSVEAALRAASG
CARB_STRPZ      ------------------------------AIDQAEDRDLFKQLMQELDQPIPESTIVKTVDEAVTFARD
CARB_STRPG      ------------------------------AIDQAEDRDLFKQLMQELDQPIPESTIVKTVDEAVTFARD
CARB_STRP8      ------------------------------AIDQAEDRDLFKQLMQELDQPIPESTIVKTVDEAVTFARD
CARB_STRP6      ------------------------------AIDQAEDRDLFKQLMQELDQPIPESTIVKTVDEAVTFARD
CARB_STRP3      ------------------------------AIDQAEDRDLFKQLMQELDQPIPESTIVKTVDEAVTFARD
CARB_STRP1      ------------------------------AIDQAEDRDLFKQLMQELDQPIPESTIVKTVDEAVTFARD
CARB_METMJ      -----------------------------EAIYRGEDREQFRDLMNAIGEPVPRSMILEHMNQIDEAIRE
CARB_LACS1      -----------------------------DAIDQAEDRQRFKDLMQELNEPVPDSKTVETVQEALDFAAE
CARB_LACJO      ------------------------------SIEQAEDREKFKELCKELGEPVPPSTTVNTVEEALEFGDR
CARB_HALER      -----------------------------DAINMAEDRDLFDQAMKRIGLECPKAKVAHSMDEAWQIQSE
CARB_BEUC1      ----------PLSLATRLADAGLIWGTPPEAIDAAEDRGVFGEVLVAAGLPAPAFGTATSLAQARAVADR
PURT_SULTO      ----------------------------------------------------------------------
PURT_PSYIN      ----------------------------------------------------------------------
PURT_METFK      ----------------------------------------------------------------------
PURT_DECAR      ----------------------------------------------------------------------
CPSM_RANCA      ---------IPNNLAVPLYKNGVIMGTSPMQIDRAEDRSIFSAVLDELQIAQAPWKAVNSLDDALQFTKT
CARB_THETN      ----------------KLKEAGILLGTSVESIKTAEDRELFKRKMQEIGEPVAESVTVTNVEDALKFAKN
CARB_THENN      ----------------ELAESGILDRYGVESIKKAEDRELFKKTMEEAGLEVLRSRLVNNLTDALETARE
CARB_SULAC      -VATFAGGQIGNTISKKLEENGVLLGTSGHSVDIAEDREKFSRLLDKLGIKQPDWISARSIEEVRKFVEM
PURT_THIDA      ----------------------------------------------------------------------
PURT_POLNA      ----------------------------------------------------------------------
MPTN_METMA      -------------ILRELEAEGVSVINSPEAIQNAANKYHASYLLAKAGLPVPETVAVQSLEAALKVISE
CARB_MYXXD      -----------------------------DAINKAEDRQLFKAAMQKIGVALPKSGYATTLDQAMSLVED
CARB_LACLA      ------------------------------AIDQAEDRELFKELCERIGEPLCASDIATTVDEAVEIADK
CARB_LACAC      -----------------------------KSIEQAEDREQFKNLCKELGEPVPPSKTVNTVEAAVEFGDE
CARB_HALOH      -----------------------------EAIQKAEDRNLFRELLDDIGEPFIESKIVDNLKEAVQTAQQ
CARB_YERPE      ----------PLKLARELEAAGVIIGTSPDAIDRAEDRERFQQAVNRLGLKQPANATVATIEQAVEKATG
CARB_EXISA      -----------------LRDCGVLLGTKLSAIVQAEDREQFRNLMFELGHGVPESEIVHTLESAWGFAER


                         +         .         .         .         .         *         .:210
query           TGWPVVLKAARGGYDGKGVWVVGDXXXXXXXXXXXXXXQVPLLVEEKIAFRRELAVQVARSPYGQVAAYP
PURK_MYCTU      VDAPIVVKAVRGGYDGRGVXXXXXXXXXXXXXXECLADGVAVLVEERVDLRRELSALVARSPFGQGAAWP
PURK_MYCBO      VDAPIVVKAVRGGYDGRGVXXXXXXXXXXXXXXECLADGVAVLVEERVDLRRELSALVARSPFGQGAAWP
PURK_CORAM      TSGQVCLKARRGGYDGKGVWFPNNESELTALVSDLSRRGVALMAEEKVGWSRELSVLVARTPSGEVATWP
PURK_MYCLE      KDAPMVVKAVRGGYDGRGVQMVRDSAHAREVASGYLVDGMPXXXXXXXXXXXXXSALVARSPFGQGAAWP
PURK_SYNE7      XGFPVVLKQRRHGYDGKGTQVLRSLAELQQALQSYG--DTPLLLEEFIPFEQELAVMVARSQSGAIATFP
PUR6_DEBOC      FNYPFMLKSRTLAYDGRGNYVVKTKESIPEALEFLKDR--PLYAEKWCPFNKELAVMVVRSIEGEVFAYP
PUR6_YEAST      LGFPFVLKSRTLAYDGRGNFVVKNKEMIPEALEVLKDR--PLYAEKWAPFTKELAVMIVRSVNGLVFSYP
PUR6_PICME      YGFPYMLKSRTMAYDGRGNFVVKDKSYIPEALKVLDDR--PLYAEKWAPFSKELAVMVVRSIDGQVYSYP
PUR6_CANGA      LGYPFVLKSRTLAYDGRGNFVVKSEEDIEKGLEFLANR--PLYAEKWASFKKELSVMIIRSLDGRVYSYP
PURK_BACSU      LRLPAVLKTCRGGYDGKGQFVIKXXXXXXXXXXXXXHGTC--ILESWVSFKMELSVIVVRSVNGEISTFP
PUR6_SCHPO      FGYPFVLKSKTLAYDGRGNYVVHQPSEIPTAIKALGDR--PLYVEKFVPFSMEIAVMVVRSLDGKVYAYP
PURK_VIBVY      VGIPMVLKSALGGYDGRGQWRLKDAAQIETLWQEMAACIAAIVAEEFVPFQREVSLIGARGKEGQIEVYP
PURK_VIBVU      VGIPMVLKSALGGYDGKGQWRLKDAAQIETLWQEMAACIAAIVAEEFVPFQREVSLIGARGKEGQIEVYP
PURK_SYNY3      PDFPWVLKARRHGYDGQGTQIINSPADLPDLSKAPPG---SWMVESFVPYERELAVIGVRNARGEMEIYP
PURK_VIBCH      IGLPMVLKSALGGYDGKGQWRLKEPTQIESVWQELAQYEQAIVAEEFVAFDREVSLVGARNLVGDVVVYP
PUR6_CANAL      FGYPYMLKSRTLAYDGRGNFVVKDKSYCEKALEFLKDR--PLYAEKWCPFTKELAVMVVRSLEGEVFAYP
PURK_VIBF1      VGIPMVLKSALGGYDGKGQWRLKDVSQVDSIWEEMDELNQAIVAEQFIPFNREVSLIGARNKNGQMVTYP
PURK_PSEAE      XXXXXXXKTRTLGYDGKGQKVLRQPADVQGAFAELG--SVPCILEGFVPFTGEVSLVAVRARDGETRFYP
PURK_VIBPA      VGIPMVLKSALGGYDGKGQWRLKEAAQIETIWAEMAECIAAIVAEEFVPFNREVSLVGARGKDGSVEVYP
PUR6_CRYNE      LGLPLMLKAKTLAYDGRGNSPLKSASSGDIQASLKFLGDRPLYAEGWAPFVKEVAVMVVRNKEGEVRSYD
PURK_BRUME      XXXXXXXXXXXXXYDGKGQVRLASLDETQACNAFAAINKAPAILEGFVEFEREVSVIAARDRSGNVAIFD
PUR6_CRYNV      LGLPLMLKAKTLAYDGRGNSPLKSTSSEDIQASLKFLGDRPLYAEGWAPFVKEVAVMVVRNKEGEVQSYD
PUR6_VIGAC      LDIHFMIKSRRLAYDGRGNFVAKSEEELSSAVDALGGFDRGLYAEKWAPFVKELAVIVARGRDNSISCYP
PURK_AQUAE      FKLPVVIKAEKLGYDGKGQYRI-KKLEDANQVVKNHDKEESFIIEEFVKFEAEISCIGVRDREGKTYFYP
PURK_STAS1      IGYPFIVKTRFGGYDGKGQVLVKDATHLDEARQLIQAQEC--VAEQYLNLSKEVSLTVTIGTNNQITYFP
PURK_STAES      LGFPFIVKTRFGGYDGKGQILVRNDSELDEAYQLVEKQEC--VAEQYLDIQKEVSLTVTIGNEQQTTYFP
PURK_STAEQ      LGFPFIVKTRFGGYDGKGQILVRNDSELDEAYQLVEKQEC--VAEQYLDIQKEVSLTVTIGNEQQTTYFP
PURK_STAHJ      LGYPFIVKTRFGGYDGKGQVLVKNEESIQEAKDLIS--QQECVAEQFLDIALEVSLTVTIGNQKQITYFP
PURK_HAEIN      VGEKVVVKRRTGGYDGRGQWIIRDENRADITDDLFGE----VIAEKFIPFDYEVSIVGARFKNGEKRFYP
PURK_ECOLI      LGELAIVKRRTGGYDGRGQWRL----------RANETEQLPAIVEQGINFSGEVSLVGARGFDGSTVFYP
PURK_STAAW      LGYPFIVKTRFGGYDGKGQVLINNEKDLQEGFKLIETSEC--VAEKYLNIKKEVSLTVTRGNNNQITFFP
PURK_STAAS      LGYPFIVKTRFGGYDGKGQVLINNEKDLQEGFKLIETSEC--VAEKYLNIKKEVSLTVTRGNNNQITFFP
PURK_STAAC      LGYPFIVKTRFGGYDGKGQVLINNEKDLQEGFKLIETSEC--VAEKYLNIKKEVSLTVTRGNNNQITFFP
PURK_STAAR      LGYPFIVKTRFGGYDGKGQVLINNEKDLQEGIKLIETSEC--VAEKYLNIKKEVSLTVTRGNNNQITYFP
PURK_STAAN      LGYPFIVKTRFGGYDGKGQVLINNEKDLQEGFKLIETSEC--VAEKYLNIKKEVSLTVTRGNNNQITFFP
PURK_STAAM      LGYPFIVKTRFGGYDGKGQVLINNEKDLQEGFKLIETSEC--VAEKYLNIKKEVSLTVTRGNNNQITFFP
PURK_SULSO      VG---VIKESKGGYDGKGQYFIFNDVEKYQFLRXXXXXXXXXXXXX---FDFEASIIIARDKRGVFISYP
PURT_PELPD      IGCPCVIKPIMSS-SGKGQSVLRDPSQVDEAWRYAMEGSDTVIIEEFIQFDYEITLLTVRHCNG-TSFCP
PURT_SYNS3      LGWPVVVKPVMSS-SGKGQSVVHSAAELDKAWEIAMAGSAQVIVEEFLDFDLEITLLTIRQHDGTTLFCP
PURT_PELCD      IGLPCVIKPIMSS-SGKGQSTVKTPDDIEKAWNYARQGAERVIIEAFIPFDYEITLLTVRHVDGTSYCPP
PURT_BACV8      IGFPCVVKPLMSS-SGKGQSLVKSADELEQAWHYGCEGSKELIIEEFIQFDSEITLLTVTQKNGPTLFCP
PURT_METM7      IGIPCVIKPIMSS-SGKGQSTIKSERDIEKSWDYAKSAATKVIVEEFIKFDYEITLLTARTSEGTKFCEP
PURT_METMP      IGIPCIIKPIMSS-SGKGQSTIKSESDIKTAWNYAKSAATKVIVEEFIKFDYEITLLTARTAEGTRFCEP
PURT_SYNY3      IGFPNVVKPVMSS-SGKGQSVVNNAGEVQQAWSAAIAGQTKVIVEEFIPFELEITLLTIRQWQGETLFCD
PURT_BACTN      IGFPCVVKPLMSS-SGKGQSLVKSADELEHAWEYGCSGSRELIIEEFIKFDSEITLLTVTQKNGPTLFCP
PURT_SYNPW      LGWPVVVKPVMSS-SGKGQSVVGLNEAWEAAMANARGTSTHVIVEEFLRFDLEITLLTIRQRDGSTLFCP
PURT_SULAC      VGYPCIIKPQMSS-SGHGHEVIYDESQVEEKFKEALTHSKTVIVEEYVKIDRELTVLTYRYPLGGVATYP
PURT_METVS      IGIPCIIKPIMSS-SGKGQSTVKSEFDIEKSWDYAKSATTKVIVEEFVNFDYEITLLTARTAFGTKFCEP
PURT_SYNS9      LGWPVVVKPVMSS-SGKGQSVVQTPEQLDQAWEAAMANSNQVIVEEFLEFDLEITLLTIRQRNGETLFCP
PURT_CHLTE      VGLPCVVKPLMSS-SGKGQSTVRSEAEIEAAWSYSQSGKAEVIVEAFVPFHTEITLLTVTQKNGPTLFCP
PURT_METM5      IGIPCIIKPIMSS-SGKGQSTIGDIEKSWDYAKSAARGGTKVIVEEFIKFDYEITLLTARTAEGTRFCEP
PURT_META3      IGAPCIVKPIMSS-SGKGQSTVKSEKDEDIEYAWNYAQAKKVIVEEFINFDYEITLLTARTAHGTVYCPP
PURT_GEOMG      IGLPCVVKPIXXXXXXXGAWTYA--------MEGGRGASDTVIVEEFIPFDYEITLLTVRHAGGTTFCPP
PURT_PROMA      VGFPLLVKPVMSS-SGKGQSLIKDKNDLEKAWDLAIKESKQVIIEEYINFDLEITLLTIKQSNHQTIFCP
PURT_NITSB      LGFPCVIKPVMSS-SGHGQSIAADLERSWEIAKEARGDASELIVEEFIDFDYEITLLTARNETGTVFCPP
PURT_METJA      LGLPCVVKPIMSS-SGKGQSVVRSEEDIEKAWKIAKEGARGIIVEEFINFDYEITLLTARTAEGTKFCEP
PURT_SYNPX      LGWPVVVKPVMSS-SGKGQSVVGLDQAWDAAMAGARGTSPRVIVEEFLRFDLEITLLTIRQHNGETLFCA
PURT_CHLPD      VGVPCVVKPLMSS-SGKGQSTVKTEADIEHAWSYSQSGRVEVIVEAFVPFHTEITLLTVTQKNGPTLFCP
PURT_PROMM      LGWPVVVKPVMSS-SGKGQSVVGLRQAWQAAMAGSRGNSPRVIVEEFLHFDLEITLLTIRQEDGSTLFCE
PURT_ANAVT      IGFPNVVKPVMSS-SGKGQSVVAEKAWNYAIANSRGDSQKXXXXXXXXXXXXXTLLTIKQWDSPTIFCSP
PURT_PASMU      IGIPCVVKPIMSS-SGHGQSILKSVEQIPSAWEYXXXXXXXVIVEGFVKFDYEITLLTVRHVHGTSFLAP
PURT_LEPBL      -----------------------------------------IIVEEFISFKSEITLLTVTQKNGKTLFCP
PURT_LEPBJ      -----------------------------------------IIVEEFISFKSEITLLTVTQKNGKTLFCP
PURT_DESMR      VGFPCVVKPVMSS-SGKGQSVARDAASAEASWDYAQTAGRAVIVEGFVDFDYEITLLTVRHAGGTSFCAP
PURT_THICR      IGIPCVVKPIMSS-SGKGQSVIKSTADIDSAWHYAQEGKGKVIIEGFVDFDYEITLLTIRHKNGTSFCAP
PURT_SYNSC      LGWPVVVKPVMSS-SGKGQSVVDCADDLPKAWEAAMAGSTQVIVEEFLHFDLEITLLTIRQRNGETLFCA
PURT_BACFN      IGFPCVVKPLMSS-SGKGQSLVKSAAELEHAWEYGCNGSRELIIEEFIKFDSEITLLTVTQKNGPTLFCP
PURT_DESVV      VGLPCVVKPVMSS-SGKGQSLVRTPADIDSAWAYAQTGGRAVIVEGFVDFDYEITLLTVRHAGGVTFCDP
PURT_DESVH      VGLPCVVKPVMSS-SGKGQSLVRTPADIDSAWAYAQTGGRAVIVEGFVDFDYEITLLTVRHAGGVTFCDP
PURT_ANASP      IGFPNVVKPVMSS-SGKGQSVVAEKAWDYAIANSRGDSQKXXXXXXXXXXXXXTLLTIKQWNAPTIFCSP
PURT_ANADE      IGLPCVVKPLMSS-SGKGQSVVGDLEAAWAYAMSGTRGDLEVIVEEFIPFDSEITLLTVTQRRGETLFCP
PURT_HAES1      LGIPCVIKPIMSS-SGHGQSILKSKDDLQKAWDYXXXXXXXVIVEGFVKFDYEITLLTVRHAEGTSFLAP
PURT_AZOSB      LGFPCVVKPIRGPDDVKKAWDYAQEGGRAGKGR--------VIVEGFIDFDYEITLLTVRHAGGTTFCAP
PURT_FLAPJ      VGMPCVVKPLMSS-SGKGIKTVEDIEKAWNYAVEGSRGDVEVIVEAFVKFNSEITLTVAQNNNPTLFCAP
PURT_ERYLH      TGYPCVIKPVMSS-SGKGQSTVRSADKLEEAWDYAVANRKRVIVEQFIDFDYEITLLTVRHKDGITFCPP
PURT_BIFLO      VGYPCVVKPVMSS-SGHGQSVVRSADAIDAAWTEAQEGRRAVIVEALAPLERELTVLTVSSSAGIVTCAP
PURT_SALAR      VGFPCIVKPVMSS-SGKGQSFIRSPEQLAQAWKYXXXXXXXVIVEGVVKFDFEITLLTVSAVDGVYFCAP
PURT_PROM3      LGWPVVVKPVMSS-SGKGQSVVGLRQAWQAAMAGSRGNSPRVIVEEFLHFDLEITLLTIRQEDGSTLFCE
PURT_BACFR      IGFPCVVKPLMSS-SGKGQSLVKSAAELEHAWEYGCNGSRELIIEEFIKFDSEITLLTVTQKNGPTLFCP
PURT_AERHH      IGLPCVVKPVMSS-SGKGQSVLRDLAKLDESWTHAQEGRGKVIVEGFVPFEYEITLLTVRAVDGIHFCQP
PURT_DESDG      LGMPCVVKPVMSS-SGKGQSVVADAWTYAQSGGRAGGGRV--IVESFVDFDYEITLLTVRHCNGTSFCEP
PURT_MANSM      IGIPCVVKPIMSS-SGHGQSIIKSFDQIQQAWDYXXXXXXXVIVEGFVKFDYEITLLTVRHIGGTSFLAP
PURT_FRATW      ----------------------------------------------------------------------
PURT_FRATT      ----------------------------------------------------------------------
PURT_FRATN      ----------------------------------------------------------------------
PURT_FRAT1      ----------------------------------------------------------------------
PURT_CORJK      IGYPCVVKPVMSS-SGAGQSYVGGVDELEAAWNAALKHSRTVMVEQYIPFDYEVTILAVRSATGREATWP
PURT_BACA2      IGFPCVVKPLMSS-SGKGQSVCGLKSCWDMAMEGGRVKNGRVIVEEFIPFESEITLLTVRAANGTSFCAP
PURT_SYNR3      ----------------------------------------------------------------------
PURT_PSEU5      LGFPCLVKPVMSS-SGKGQSVLRSDADIDAAWEYXXXXXXXVIVEGFIDFDYEITLLTVRHAGGTSFCEP
PURT_HALWD      IGIPVVVKPTMSS-SGKGQSIVRESAEINGAWETARAGSRSVIIEELVEFDSEFTLLTVRHADGTTFCPP
PURT_SYNP6      ----------------------------------------------------------------------
PURT_SYNE7      ----------------------------------------------------------------------
PURT_PYRFU      IGYPCHTKAIMSS-SGKGSYFVRGPEDIPKAWEEAKTKAEKIIVEEHIDFDTELAVRHFDENGEIVTTFP
PURT_BURXL      VGYPCVVKPVMSS-SGKGQSVLGDADVEPAWQYAMAGGRVNVIVEGFIDFEYELTVRAINPASGEVSTYD
PURT_SULNB      IGFPCVIKPSSSGHGQSIAKTANDIERSWEIAKEARGDASELIVEEFVPFDYEITLLTVRNETGTTFCEP
PURT_AERS4      IGLPCVVKPVMSS-SGKGQSVLRDLAKLDESWTYAQEGRGKVIVEGFVPFEYEITLLTVRAVDGIHFCDP
CARB_LYSSC      IGYPVIVRPATLGGTGGGICYNDQDLEEIVTSGLKYSPVTQCLLEKSIAGYKEIEYEVMRDAVDNAIVVC
PURT_SULDN      LGFPCVIKPSSSGHGQSVARSASDIDASWEIAKEARGDASELIVEAFVDFDYEITMLTARNGKETVFCEP
PURT_PROMP      IGFPLLIKPLMSS-SGKGQSLVNRKEDLLLAWNDALKNSVGVILEEFLNFDYEFTLLTIRKTSGEIFCEP
PURT_FRATO      ----------------------------------------------------------------------
PURT_FRATH      ----------------------------------------------------------------------
PURT_FRATF      ----------------------------------------------------------------------
PURT_ACTPJ      IGIPCVVKPIMSS-SGHGQSVIKSEDQIQQAWDYSQEGGRAVIVEGFIKFDYEITQLTVRHVNGTSFLAP
PURT_XANC5      ----------------------------------------------------------------------
PURT_SALPC      VGFPCIVKPVMSS-SGKGQSFIRSAEQLAQAWEYXXXXXXXVIVEGVVKFDFEITLLTVSAVDGVHFCAP
PURT_SALCH      VGFPCIVKPVMSS-SGKGQSFIRSAEQLAQAWEYXXXXXXXVIVEGVVKFDFEITLLTVSAVDGVHFCAP
PURT_MARAV      VGLPLVVKPVMSS-SGKGQSTVKTEADIERAWEYAQTGKGRVIVEGFVDFDYEITLLTVRHKEGITFCEP
PURT_HAEDU      VGVPCVVKPIMSS-SGHGQSIIKSLDQIQQAWDYSQXXXXXVIVEGFIKFDYEITLLTVRHINGTSFLAP
PURT_XANCP      VGLPCVVKPVMSS-SGKGQSTLRSEADIDAAWDYAQTGGRACIVEGFIDFDYEITLLTVRHAGGTSFCDP
PURT_XANCB      VGLPCVVKPVMSS-SGKGQSTLRSEADIDAAWDYAQTGGRACIVEGFIDFDYEITLLTVRHAGGTSFCDP
PURT_XANC8      VGLPCVVKPVMSS-SGKGQSTLRSEADIDAAWDYAQTGGRACIVEGFIDFDYEITLLTVRHAGGTSFCDP
PURT_STRM5      IGLPCVVKPVMSS-SGKGQSTLRSEADIAPAWEYAQTGGRACIVEGFIDFDYEITLLTVRHAGGTSFCAP
PURT_RALEJ      IGYPCVVKPVMSS-SGKGQSKIGVKAAWDYAMAGGRVSHGRVIVEGFIDFDYEITLLTVRA----LGADG
PURT_LEPIN      LGFPCVVKPLMSS-SGKGQSVIQSREEISKAWEASQTKAAEIIVEEFIPFESEITLLTVTQKNGKTLFCP
PURT_LEPIC      LGFPCVVKPLMSS-SGKGQSVIQSREEISKAWEASQTKAAEIIVEEFIPFESEITLLTVTQKNGKTLFCP
PURT_XANAC      VGLPCVVKPVMSS-SGKGQSTLRSEADIDAAWEYAQTGGRACIVEGFIDFDYEITLLTVRHAGGTSYCDP
PURT_PROM9      ----------------------------------------------------------------------
PURT_PROM0      ----------------------------------------------------------------------
PURT_MYCVP      IGYPCVVKPVMSS-SGKGQSKIGVAAAWEYAMSGSRVSNTRIIVEGFVDFDYEITLLTVRAR----GADG
PURT_MYCGI      VGYPCVVKPVMSS-SGKGQSKIGPEDVAPAWEYAMSGSRVSIIVEGFVDFDYEITLLTARGASGEVQTQ-
PURT_PYRHO      IGYPCHTKAGKGSYFVKGPEDIPKAWEEAKTKARGSAEKI--IVEEHIDFDTELAVRHFDENGEIVTTFP
PURT_PROM5      IGFPLLLKPLMSS-SGKGQSLVKDLLLAWEDALKNSRGKIEVILEEFLNFDYEFTLLTVRKSSGEVFCEP
CARB_SCHPO      VGYPVLVRPSY-VLSGAAMSVIRDESSLKDKLENASAVSPPVVITKFIEGARELDVDAVASK-GKLLVHA
CARB_CLOBA      IGYPVIVRPAYTGGSGGGIADDEEELRTILESGLQLSTIGQVLLEKSVKGWKEIEYEVMRDSYGNCITVC
CARB_BACSU      IGFPVIVRPAYTGGTGGGICSNETELKEIVENGLKLSPVHQCLLEKSIAGYKEIEYEVMRDSQDHAIVVC
PURT_STRMK      IGLPCVVKPVMSS-SGKGQSTLRSEAEIAPAWEYAQTGGRACIVEGFIDFDYEITLLTVRHAGGTSFCAP
PURT_SALPB      VGFPCIVKPVMSS-SGKGQSFIHSAEQLAQAWEYXXXXXXXVIVEGVVKFDFEITLLTVSAVDGVHFCAP
PURT_SALNS      VGFPCIVKPVMSS-SGKGQSFIRSAEQLAQAWEYXXXXXXXVIVEGVVKFDFEITLLTVSAVDGVHFCAP
PURT_IGNH4      VGYPCLIKPEMSS-SGHGHTLASSPEEAREGFKRALKESERAIVEEFVEIDRELTALTYRHDTGETVPLP
PURT_BIFAA      VGYPCVVKPIMSS-SGHGQSVVRSADAIDAAWTEAQEGRRAVIVEALAPLDYELTVLTVSSSAGIVTCAP
PURT_ACTP7      IGIPCVVKPIMSS-SGHGQSVIKSEDQIQQAWDYSQEGGRAVIVEGFIKFDYEITQLTVRHVNGTSFLAP
PURT_ACTP2      IGIPCVVKPIMSS-SGHGQSVIKSEDQIQQAWDYSQEGGRAVIVEGFIKFDYEITQLTVRHVNGTSFLAP
CARB_ASHGO      VGYPVLVR--------------------------------------------------------------
PURT_PYRKO      IGYPCHTKAGKGSYFVKGPEDVPKAWEEAKKKARGSAEK--LIVEEHIDFDTELAVRHYDENGEVVTTFP
PURT_PASHA      ----------------------------------------------------------------------
PURT_ERWT9      IGFPCIVKPVMSS-SGKGQSFIREASQLMAAWEYXXXXXXXVIVEGVVKFDFEITLLTISAVDGIHFCAP
PURT_DESAD      ----------------------------------------------------------------------
CARB_CLOBB      IGYPVIVRPAYTGGSGGGIADDEEELRIILESGLQLSTIGQVLLEKSVKGWKEIEYEVMRDSYGNCITVC
PURT_SALTY      VGFPCIVKPVMSS-SGKGQSFIRSAEQLAQAWEYXXXXXXXVIVEGVVKFDFEITLLTVSAVDGVHFCAP
PURT_SALTI      VGFPCIVKPVMSS-SGKGQSFIRSAEQLAQAWEYXXXXXXXVIVEGVVKFDFEITLLTVSAVDGVHFCAP
PURT_SALSV      VGFPCIVKPVMSS-SGKGQSFIRSAEQLAQAWEYXXXXXXXVIVEGVVKFDFEITLLTVSAVDGVHFCAP
PURT_SALPK      VGFPCIVKPVMSS-SGKGQSFIRSAEQLAQAWEYXXXXXXXVIVEGVVKFDFEITLLTVSAVDGVHFCAP
PURT_SALPA      VGFPCIVKPVMSS-SGKGQSFIRSAEQLAQAWEYXXXXXXXVIVEGVVKFDFEITLLTVSAVDGVHFCAP
PURT_SALDC      VGFPCIVKPVMSS-SGKGQSFIRSAEQLAQAWEYXXXXXXXVIVEGVVKFDFEITLLTVSAVDGVHFCAP
PURT_PYRAB      IGYPCHTKAGKGSYFVKGPEDIPKAWEEAKTKARGSAEKI--IVEEHIDFDTELAVRHFDENGEIVTTFP
CARB_STAES      VGYPLIVRPATMGGTGGGICHNDAELKEVVSNGLHYSPATQCLIEKSIAGYKEIEYEVMRDKNDNAIVVC
CARB_STAEQ      VGYPLIVRPATMGGTGGGICHNDAELKEVVSNGLHYSPATQCLIEKSIAGYKEIEYEVMRDKNDNAIVVC
PURT_PROMS      ----------------------------------------------------------------------
PURT_AZOVD      LGFPCVVKAQEGGRAGKG----------------------RVIVEGFIDFDYEITLLTVRHAGETTFCAP
CARB_BACCL      IGYPVIVRPATLGGTGGGICTNEEELVEIVSTGLKLSPVHQCLLERSIAGYKEIEYEVMRDANDNAIVVC
PURT_TOLAT      ----------------------------------------------------------------------
PURT_RALEH      IGYPCVVKPVMSS-SGKGQSKIGVKAAWDYAMAGGRVSHGRVIVEGFIDFDYEITLLTVRAASGQVETQA
PURT_HAHCH      ----------------------------------------------------------------------
CARB_LACRJ      CGYPVIVRPATMGGTGGGICHNDAEMRTVAKNGLELSPVTQCLIEKSIAGYKEIEFEVMRDAADNVMVVC
CARB_LACRD      CGYPVIVRPATMGGTGGGICHNDAEMRTVAKNGLELSPVTQCLIEKSIAGYKEIEFEVMRDAADNVMVVC
PURT_VIBCM      ----------------------------------------------------------------------
PURT_VIBCH      ----------------------------------------------------------------------
PURT_RHOSR      IGFPCVIKPVMSS-SGKGQSTVRDTGGVETAWEYALAGYGRVIVEGFVDFDYEITQLTVRAADGEVGTFE
PURT_RALME      IGYPCVVKPVMSS-SGKGQSKIGPADVKAAWDYAMAGGRVSVIVEGFIDFDYEITLLTVRA----VGANG
PURT_PSEU2      ----------------------------------------------------------------------
PURT_PSESM      ----------------------------------------------------------------------
PURT_PSEPK      LGYPCVVKPVMSS-SGKGQSLLRSDADLQKSWDYAQEGKGRVIVEGFIDFEYEITLLTVRHVGGTTFLEP
PURT_PSEFS      ----------------------------------------------------------------------
PURT_PSE14      ----------------------------------------------------------------------
PURT_PHOPR      ----------------------------------------------------------------------
PURT_DESVM      VGLPCVVKPVMSS-SGKGQSTVRTEADVMKAWEYAQTGGRAVIVEGFVDFDYEITQLTVRHAGGTTFCDP
PURT_CUPTR      IGYPCVVKPVMSS-SGKGQSKIGVKAAWDYAMAGGRVSHGRVIVEGFIDFDYEITLLTVRA----IGASG
PURT_XANOP      ----------------------------------------------------------------------
PURT_PSEPW      ----------------------------------------------------------------------
PURT_PSEPG      ----------------------------------------------------------------------
PURT_PSEPF      ----------------------------------------------------------------------
PURT_BACSU      IGFPCVVKPLMSS-SGKGQSVCSEADLESCWETAMEGGRVKVIVEEFIPFESEITLLTVRAVNGTAFCEP
CARB_BACCN      IGYPVIVRPATLGGTGGGICHNEEELIEIVTSGLKHSPVTQCLLEKSIAGFKEIEYEVMRDANDNAIVVC
CARB_BACC2      IGYPVIVRPATMGGTGGGICSNEEELIEIVSGGLKHSPVTQCLLEKSIAGCKEIEYEVMRDSNDNAIVVC
PURT_WOLSU      IGYPCVIKPSSSGHGQSVCRMXXXXXXXXXXXXXXRGDSSELIVEEFIPFDYEITLLTLNNGKKITFCDP
PURT_PSEF5      ----------------------------------------------------------------------
PURT_PSEE4      ----------------------------------------------------------------------
PURT_PSEAE      VGYPCVVKPIMSS-SGKGQSVLKGPDDLQAAWDYAQEGKGRVIVEGFIDFDYEITLLTVRHVDGTTFCAP
PURT_PSEAB      VGYPCVVKPIMSS-SGKGQSVLKGPDDLQAAWDYAQEGKGRVIVEGFIDFDYEITLLTVRHVDGTTFCAP
PURT_PSEA8      VGYPCVVKPIMSS-SGKGQSVLKGPDDLQAAWDYAQEGKGRVIVEGFIDFDYEITLLTVRHVDGTTFCAP
CARB_TRICU      VGYPVLIR--------------------------------------------------------------
CARB_CLOB8      IGYPVIVRPAYTGGSGGGIADDEEQLRTILESGLQLSTIGQVLLEKSVKGWKEVEYEVMRDSYGNCITVC
CARB_BACWK      IGYPVIVRPATMGGTGGGICNNEEELIEIVSGGLKHSPVTQCLLEKSIAGCKEIEYEVMRDSNDNAIVVC
PURT_XANOR      ----------------------------------------------------------------------
PURT_XANOM      ----------------------------------------------------------------------
PURT_VIBF1      VGMPCVIKPVMSS-SGKGQSVIKTEADIRTSWDYAQDGGRSVIVEGFVDFDYEISLLTVRAVDGVHFCAP
PURT_SHIFL      ----------------------------------------------------------------------
PURT_SHIF8      ----------------------------------------------------------------------
CARB_PELTS      IGYPVIVRPAYTGGTGGGIACREQELVEIAGRGLKMSMIGQVLLEQSVAGWKEIEYEVMRDGADNCITVC
CARB_BACST      IGYPVIVRPATLGGTGGGICTNEEELVEIVSTGLKLSPVHQCLLERSIAGYNQIEYEVMRDANDNAIVVC
PYC_HUMAN       YGFPIIFKAAYGG-GGRGMRVVHSYEELEENYTRAYSEALALFVEKFIEKPRHIEVQILGDQYGNILLYE
PYC_BOVIN       YGFPIIFKAAYGG-GGRGMRVVHSYEELEENYTRAYSEALALFVEKFIEKPRHIEVQILGDQYGNILLYE
PURT_SHIBS      ----------------------------------------------------------------------
PURT_SHIB3      ----------------------------------------------------------------------
PYR1_EMENI      VGYPVLVR--------------------------------------------------------------
PURT_WIGBR      IGYPCLIKPIMSS-SGKGQSVINEKELRHSWEKSQTYGRTSLIIEKIIPFDFEITLLVVNSVDGMHFCLP
PURT_SODGM      IGYPFIIKPVMSS-SGKGQSLVRDAAQLDAAWQYAQLGGRAVIVEGLVAFDFEITLLTINAVDGIHFCAP
PURT_SHISS      ----------------------------------------------------------------------
PURT_SHIDS      ----------------------------------------------------------------------
PURT_ECOUT      ----------------------------------------------------------------------
PURT_ECOLI      ----------------------------------------------------------------------
PURT_ECOL5      ----------------------------------------------------------------------
PURT_ECOK1      ----------------------------------------------------------------------
PURT_ECODH      ----------------------------------------------------------------------
PURT_ECOBW      ----------------------------------------------------------------------
PURT_ECO57      ----------------------------------------------------------------------
CARB_GEMAT      TGFPAIIR--------------------------------------------------------------
CARB_BACC3      IGYPVIVRPATLGGTGGGICHNEEELIEIVTSGLKHSPVTQCLLEKSIAGCKEIEYEVMRDSNDNAIVVC
CARB_BACC0      IGYPVIVRPATLGGTGGGICHNEEELIEIVTSGLKHSPVTQCLLEKSIAGCKEIEYEVMRDSNDNAIVVC
CARB_BACAN      IGYPVIVRPATLGGTGGGICHNEEELIEIVTSGLKHSPVTQCLLEKSIAGCKEIEYEVMRDSNDNAIVVC
CARB_BACAH      IGYPVIVRPATLGGTGGGICHNEEELIEIVTSGLKHSPVTQCLLEKSIAGCKEIEYEVMRDSNDNAIVVC
CARB_BACAC      IGYPVIVRPATLGGTGGGICHNEEELIEIVTSGLKHSPVTQCLLEKSIAGCKEIEYEVMRDSNDNAIVVC
CARB_BACAA      IGYPVIVRPATLGGTGGGICHNEEELIEIVTSGLKHSPVTQCLLEKSIAGCKEIEYEVMRDSNDNAIVVC
PYC1_CAEEL      YGTPIILKAAYXXXXXXXXXVVEEAFRRSYSEAQAAFGDGSLFVEKFVERPRHIEVQLLGDHHGNIVLYE
PURT_MYCS2      IGYPCVVKPVMSS-SGKGQSKIGPDEVAAAWEYAMAGGRVSIIVEGFVDFDYEITLLTARGADGEIATQP
PURT_METCA      ----------------------------------------------------------------------
PURT_EDWI9      ----------------------------------------------------------------------
CARY_BACST      IGFPIIIRPALGGTGGG----IAENMEQFLALVEKGLNESPILIERSVAGFKEIEYEVMRDQSNTCITVC
CARB_SYMTH      VGYPLIVRPAYTGGTGGGIAHDREEMRDIVTRGLKLSPVTQCLVERSLLGWKEIEYEVMRDGAGNAITIC
CARB_LISW6      IGYPVIVRPAYTGGSGGGICHNEQELIETVTSGLKLSPVTQCLLEKSIAGFKEVEYEVMRDANNNAMVVC
CARB_BACC1      IGYPVIVRPATLGGTGGGICHNEEELIEIVTSGLKHSPVTQCLLEKSIAGCKEIEYEVMRDSNDNAIVVC
PYR1_YEAST      VGYPVLVR--------------------------------------------------------------
PYR1_SCHPO      VGYPVLVR--------------------------------------------------------------
PURT_SHEAM      TGIPCVVKPVMSS-SGKGQSVIGDVQKAWDYAQSGGRAEGRIIVEGFIDFDYEITLLTISAVDGIHFCAP
PURT_PARD8      ----------------------------------------------------------------------
PURT_KLEP3      ----------------------------------------------------------------------
CARB_SULTO      VGYPVLIR--------------------------------------------------------------
CARB_STRS7      IGYPVIVRPATLGGTGGGICTNEEALRDIVENGLKLSPVTQCLIERSIAGFKEIEYEVMRDAADNALVVC
CARB_STRCO      IGYPVLVRPSY-VLGGRGMEIVYD----------------------------------------------
CARB_STAS1      VGYPLIVRPATMGGTGGGICHNDAEFKEIVTNGLHYSPATQCLIEKSIAGFKEIEYEVMRDKNDNAIVVC
CARB_STAHJ      VGYPLIVRPATMGGTGGGICYNDEELKEVVSNGLHYSPATQCLIEKSIAGYKEIEYEVMRDKNDNAIVVC
CARB_LISMO      IGYPVIVRPAYTGGSGGGICHNEQELIETVTSGLKLSPVTQCLLEKSIAGFKEVEYEVMRDANNNAMVVC
CARB_LISMH      IGYPVIVRPAYTGGSGGGICHNEQELIETVTSGLKLSPVTQCLLEKSIAGFKEVEYEVMRDANNNAMVVC
CARB_LISMF      IGYPVIVRPAYTGGSGGGICHNEQELIETVTSGLKLSPVTQCLLEKSIAGFKEVEYEVMRDANNNAMVVC
CARB_LISMC      IGYPVIVRPAYTGGSGGGICHNEQELIETVTSGLKLSPVTQCLLEKSIAGFKEVEYEVMRDANNNAMVVC
CARB_LISIN      IGYPVIVRPAYTGGSGGGICHNEQELIETVTSGLKLSPVTQCLLEKSIAGFKEVEYEVMRDANNNAMVVC
CARB_DESAP      IGYPVVVRPAYTGGTGGGVAFSEDELREIAVRGLTMSIIHQVLVEKCVLGWKEIEYEVMRDAAGNCITIC
CARB_BACHK      IGYPVIVRPATLGGTGGGICHNEEELIEIVTSGLKHSPVTQCLLEKSIAGCKEIEYEVMRDSNDNAIVVC
PYC_RAT         YGFPIIFKAAYGG-GGRGMRVVHSYEELEENYTRAYSEALALFVEKFIEKPRHIEVQILGDQYGNILLYE
PYC_MOUSE       FGFPIIFKAAYGG-GGRGMRVVHSYEELEENYTRAYSEALALFVEKFIEKPRHIEVQILGDQYGNILLYE
PURT_ENTS8      ----------------------------------------------------------------------
CARB_XANCP      VGYPTIIRPSTLGGSGGGIAYNREELIDIVGRGLELSPTTEVLVEESVLGWKEFEMEVVRDTADNCIIVC
CARB_SULIY      VGFPVLVR--------------------------------------------------------------
CARB_SULIN      VGFPVLVR--------------------------------------------------------------
CARB_SULIM      VGFPVLVR--------------------------------------------------------------
CARB_SULIL      VGFPVLVR--------------------------------------------------------------
CARB_SULIK      VGFPVLVR--------------------------------------------------------------
CARB_SULIA      VGFPVLVR--------------------------------------------------------------
CARB_STRSV      IGYPVIVRPATLGGTGGGICSNEEELQEIAENGLKLSPVTQCLIERSIAGFKEIEYEVMR----------
CARB_STRGG      IGYPVLVRPSY-VLGGRGMEIVYD----------------------------------------------
CARB_HYPBU      IGYPVIVRVSFNGGGGSLVAWSREELERWLVRAFAFSGTGEVLVEKYLHYWKEIEYEVVRDQYGNMVAVA
CARB_BACCZ      IGYPVIVRPATLGGTGGGICHNEEELIEIVTSGLKHSPVTQCLLEKSIAGCKEIEYEVMRDSNDNAIVVC
CARB_BACCQ      IGYPVIVRPATLGGTGGGICHNEEELIEIVTSGLKHSPVTQCLLEKSIAGCKEIEYEVMRDSNDNAIVVC
CARB_BACC7      IGYPVIVRPATLGGTGGGICHNEEELIEIVTSGLKHSPVTQCLLEKSIAGCKEIEYEVMRDSNDNAIVVC
PURT_THISH      IGYPCIIKPVMSS-SGKGQSLVADASELTRAWDYARSAQGRVIVEAVVEFDFEITLLTVRSRGGDGNCAP
CARB_SULSO      VGFPVLVR--------------------------------------------------------------
CARB_LACPL      AGYPVIVRPATMGGTGGGIAETPQQLHDITENGLALSPVTQVLIEQSIAGYKEIEFEVMR----------
CARB_BACCR      IGYPVIVRPATLGGTGGGICHNEEELIEIVTSGLKHSPVTQCLLEKSIAGCKEIEYEVMRDSNDNAIVVC
CARB_BACC4      IGYPVIVRPATLGGTGGGICHNEEELIEIVTSGLKHSPVTQCLLEKSIAGCKEIEYEVMRDSNDNAIVVC
PURT_SULSO      ----------------------------------------------------------------------
PURT_PROM1      IGYPLLIKPVMSS-SGKGQSLVKNKNELAQAWNLAIEKSRKIILEEFIDFDLEITLLTIRQSNGKTLFCA
PURT_ACIBT      ----------------------------------------------------------------------
CARB_YEAST      VNYPVLIRPSY-VLSGAAMSVVNEELKAKLTLASDVSPDHPVVMSKFIEGAQEIDVD-AVAYNGNVLVHA
CARB_STRE4      IGYPVIVRPATLGGTGGGICSNEEVLRDIVENGLKLSPVTQCLIERSIAGFKEIEYEVMRDAADNALVVC
CARB_STACT      VGYPLIVRPATMGGTGGGICHNDEELKEVVTNGLHYSPATQCLIEKSIAGFKEIEYEVMRDKNDNAIVVC
CARB_STAAW      VGYPLIVRPATMGGTGGGICHNDEELHEIVSNGLHYSPATQCLLEKSIAGFKEIEYEVMRDKNDNAIVVC
CARB_STAAT      VGYPLIVRPATMGGTGGGICHNDEELHEIVSNGLHYSPATQCLLEKSIAGFKEIEYEVMRDKNDNAIVVC
CARB_STAAS      VGYPLIVRPATMGGTGGGICHNDEELHEIVSNGLHYSPATQCLLEKSIAGFKEIEYEVMRDKNDNAIVVC
CARB_STAAR      VGYPLIVRPATMGGTGGGICHNDEELHEIVSNGLHYSPATQCLLEKSIAGFKEIEYEVMRDKNDNAIVVC
CARB_STAAN      VGYPLIVRPATMGGTGGGICHNDEELHEIVSNGLHYSPATQCLLEKSIAGFKEIEYEVMRDKNDNAIVVC
CARB_STAAM      VGYPLIVRPATMGGTGGGICHNDEELHEIVSNGLHYSPATQCLLEKSIAGFKEIEYEVMRDKNDNAIVVC
CARB_STAAE      VGYPLIVRPATMGGTGGGICHNDEELHEIVSNGLHYSPATQCLLEKSIAGFKEIEYEVMRDKNDNAIVVC
CARB_STAAC      VGYPLIVRPATMGGTGGGICHNDEELHEIVSNGLHYSPATQCLLEKSIAGFKEIEYEVMRDKNDNAIVVC
CARB_STAA9      VGYPLIVRPATMGGTGGGICHNDEELHEIVSNGLHYSPATQCLLEKSIAGFKEIEYEVMRDKNDNAIVVC
CARB_STAA8      VGYPLIVRPATMGGTGGGICHNDEELHEIVSNGLHYSPATQCLLEKSIAGFKEIEYEVMRDKNDNAIVVC
CARB_STAA3      VGYPLIVRPATMGGTGGGICHNDEELHEIVSNGLHYSPATQCLLEKSIAGFKEIEYEVMRDKNDNAIVVC
CARB_STAA2      VGYPLIVRPATMGGTGGGICHNDEELHEIVSNGLHYSPATQCLLEKSIAGFKEIEYEVMRDKNDNAIVVC
CARB_STAA1      VGYPLIVRPATMGGTGGGICHNDEELHEIVSNGLHYSPATQCLLEKSIAGFKEIEYEVMRDKNDNAIVVC
CARB_NATTJ      IGYPVIVRPA------------------------------------------------------------
PURT_YERE8      ----------------------------------------------------------------------
PURT_VARPS      IGYPCIVKPVMSS-SGKGQSKIGPADVQKAWDYAMAGGRVSVIVEGFIDFDYEITLLTVRAKDAQTRFCE
PURT_SHESA      IGVPCVVKPVMSS-SGKGQSVIRDAAQSTKAWQYAQEGGRAVIVEGFIPFDYEITLLTISAVNGIHFCAP
PURT_PROMT      IGYPLLIKPVMSS-SGKGQSLVKNKNDLAQAWNLAIEKSRKIILEEFIDFDLEITLLTIRQSNGKTLFCA
PURT_PECCP      ----------------------------------------------------------------------
PURT_ERWCT      ----------------------------------------------------------------------
PURT_ACIAD      ----------------------------------------------------------------------
CARB_STRGC      IGYPVIVRPATLGGTGGGICSNEGELQEIAENGLKISPVTQCLIERSIAGFKEIEYEVMR----------
PURT_SHESM      IGVPCVVKPVMSS-SGKGQSVIRDVSQSAKAWQYAQEGGRAVIVEGFIPFDYEITLLTISAVNGIHFCAP
PURT_BURVG      ----------------------------------------------------------------------
PURT_BURCM      ----------------------------------------------------------------------
CARB_XANAC      VGYPTIIRPSTLGGSGGGIAYNREELIEIVGRGLELSPTTEVLVEESVLGWKEFEMEVVRDTADNCIIVC
CARB_MACCJ      IGYPVIVRPATMGGTGGGICHDEKELVEIVTNGLKYSPVTQCLIEKSIAGYKEIEYEVMRDSNDNAIVVC
CARB1_METJA     IGYPVIVRPA------------------------------------------------------------
Y4RH_RHISN      IGLPAVLKPAVG----------------------------------------------------------
PURT_SHESR      IGVPCVVKPVMSS-SGKGQSVIRDVSQSAKAWQYAQEGGRAVIVEGFIPFDYEITLLTISAVNGIHFCAP
PURT_ALCBS      ----------------------------------------------------------------------
CARB_XYLFA      VGFPTIIRPSTLGGTGGGITYNRQEFEEIIKRGLELSPVHEVLVEESVLGWKEFEMEVVRDASDNCIIVC
CARB_THET8      VGFPVVVRPSTLGGTGGGIAHDEAELVEVLSRGLTLSPVHTALVEESVLGWKEFELEVMRDHADTVVIIT
PURT_SHEON      ----------------------------------------------------------------------
PURT_SHEFN      ----------------------------------------------------------------------
PURT_BURTA      ----------------------------------------------------------------------
PURT_BURS3      ----------------------------------------------------------------------
PURT_BURPS      ----------------------------------------------------------------------
PURT_BURP6      ----------------------------------------------------------------------
PURT_BURP1      ----------------------------------------------------------------------
PURT_BURP0      ----------------------------------------------------------------------
PURT_BURMS      ----------------------------------------------------------------------
PURT_BURMA      ----------------------------------------------------------------------
PURT_BURM9      ----------------------------------------------------------------------
PURT_BURM7      ----------------------------------------------------------------------
PURT_BORPE      ----------------------------------------------------------------------
CARB_XYLFT      VGFPTIIRPSTLGGTGGGIAYNRQEFEEIIKRGLELSPVHEVLVEESVLGWKEFEMEVVRDASDNCIIVC
CARB_STAAB      VGYPLIVRPATMGGTGGGICHNDEELHEIVSNGLHYSPATQCLLEKSIAGFKEIEYEVMRDKNDNAIVVC
CARB_MYCGI      IGYPVLVRPSY-VLGGRGMEIVYD----------------------------------------------
CARB_CLOBL      IGYPIIVRPAYTGGTGGGIAESEEELDEILALGLQLSSIGQVLLEKSVKGWKEIEYEVMRDSRGNCITVC
PYR1_DROME      VGYPCLVR--------------------------------------------------------------
PURT_VIBVY      VSIPCVVKPVMSS-SGKGQSVIKSPADIEKAWQYAQEGGRTVIVEGFIDFDYEITLLTVRAVDGVHFCAP
PURT_VIBVU      VSIPCVVKPVMSS-SGKGQSVIKSPADIEKAWQYAQEGGRTVIVEGFIDFDYEITLLTVRAVDGVHFCAP
PURT_COREF      LGYPNVVKPVMSS-SGKGQSVVTSAEDLESAWEYAMSGNQRVIVEQFVEFDYEITLLTVRGATGKPATWP
PURT_BURCH      ----------------------------------------------------------------------
PURT_BURCA      ----------------------------------------------------------------------
CARB_PYRFU      IEYPVIVR--------------------------------------------------------------
CARB_PEDPA      SGYPVIVRPATMGGTGGGIAQDEAELRKITANGLTLSPVTQVLIEQSIAGLKEIEFEVMR----------
CARB_MYCLE      IGYPVLVRPSY-VLGGRGMEIVYD----------------------------------------------
CARB_METHJ      VGFPAIIRPAYTGGAGGGIAYNLDELRRIVELGLGKSRIHQVLIEESVAGWKEIEFEVMRDANDTCITIC
CARB_ACIC5      IGFPVIIR--------------------------------------------------------------
CARB_ACIBL      IGFPLVLRPSTLGGSGGGIAYNREELMDLLGKGLDLSPVHEVLLEESVLGWKEYELELMRDLADNVIVIC
PURT_VIBPA      ----------------------------------------------------------------------
CPSM_RAT        VGYPCLLRPSY-VLSGSAMNVVEDEMKRFLEEATRVSQEHPVVLTKFIEGAREVEMD-AVGKEGRVISHA
CARB_STRA5      IGYPLIVRPATLGGTGGGMCDNQEQLVDITTKGLKLSPVTQCLIERSIAGFKEIEYEVMRDAADNALVVC
CARB_STRA3      IGYPLIVRPATLGGTGGGMCDNQEQLVDITTKGLKLSPVTQCLIERSIAGFKEIEYEVMRDAADNALVVC
CARB_STRA1      IGYPLIVRPATLGGTGGGMCDNQEQLVDITTKGLKLSPVTQCLIERSIAGFKEIEYEVMRDAADNALVVC
CARB_MYCVP      IGYPVLVRPSY-VLGGRGMEIVYD----------------------------------------------
CARB_MYCTU      IGYPVLVRPSY-VLGGRGMEIVYD----------------------------------------------
CARB_MYCBO      IGYPVLVRPSY-VLGGRGMEIVYD----------------------------------------------
CARB_METPE      VGLPVIIRPAYTGGAGGGIAHTVDELKRIVEIGLQRSRIHQVLIEESVMGWKELEFEVMRDAKDTCVIIC
CARB_EXIS2      IGLPIIIRPAYTGGTGGGIAETMDEFIRIVEGGLKASPATQVLLEKSIAGMKEVEFEVMRDATNQAIIVC
PYR1_MESAU      VGYPCVVRPSLSGAAMNVAYTDGD-LERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVACD-GVVSAIA
PURT_YERPY      ----------------------------------------------------------------------
PURT_YERPS      ----------------------------------------------------------------------
PURT_YERPP      ----------------------------------------------------------------------
PURT_YERPN      ----------------------------------------------------------------------
PURT_YERPG      ----------------------------------------------------------------------
PURT_YERPE      ----------------------------------------------------------------------
PURT_YERPB      ----------------------------------------------------------------------
PURT_YERPA      ----------------------------------------------------------------------
PURT_LEPCP      ----------------------------------------------------------------------
CPSM_MOUSE      VGYPCLLR--------------------------------------------------------------
CARB_THET2      VGFPLLVRPSLGGRAMQVVRDEGELKRYLEEVYAPLEERPSILLDRFLEGAIELDVD-ALSDGQEVMVAG
CARB_STRTD      IGYPVIVRPATLGGTGGGMCANEEELREIAENGLKLSPVTQCLIERSIAGFKEIEYEVMR----------
CARB_STRT2      IGYPVIVRPATLGGTGGGMCANEEELREIAENGLKLSPVTQCLIERSIAGFKEIEYEVMR----------
CARB_STRT1      IGYPVIVRPATLGGTGGGMCANEEELREIAENGLKLSPVTQCLIERSIAGFKEIEYEVMR----------
CARB_STRAW      IGYPVLVRPSY-VLGGRGMEIVYD----------------------------------------------
CARB_RUBXD      IGFPLIIRPSTLGGTGGSVAEDLDALRASVRDGLDASPVRSVLVERSVAGWKEFELEVMRDLADNVVIVC
CARB_METTP      LGLPLIVRPAYTGGSGGGV---------------------------------------------------
CARB_DEIGD      IGLPIVIRPSTLGGTGGGIAHTYEDFLKITEGGLRDSPVHSVLLEESILGWKEYELEVMRDHADTVVIIT
PYR1_HUMAN      VGYPCVVR--------------------------------------------------------------
PURT_VIBHB      ----------------------------------------------------------------------
PURT_SHESW      ----------------------------------------------------------------------
PURT_RHOFD      ----------------------------------------------------------------------
PURT_PROMH      ----------------------------------------------------------------------
MCCA_DICDI      IGYPVLIKAVMGG-GGKGMRIVEDGVESSKREATASFGDSRVLVEKYLVHPRHVEIQVFADRHGNVHLFE
CARB_STRMU      IGYPVIVRPATLGGTGGGMCADEKELREIAENGLKLSPVTQCLIERSIAGFKEIEYEVMR----------
CARB_CLOAB      FGLPVIIRPATLGGTGGGIASTMEELKEICDRGIKMSPIGQILLEQSVAGWKELEYEVMR----------
PURT_MYCA9      ----------------------------------------------------------------------
PURT_BORPA      ----------------------------------------------------------------------
PURT_BORBR      ----------------------------------------------------------------------
CARB_METLZ      VGLPAIIRPAYTGGAGGGVANTKEELRTIVEHGLTKSRVHQVLIEESVKGWNEIEFEVMRDAADTCIIIC
CARB_FUSNN      IDYPVIVRPATMGGTGGGICYNEEDLHEIVPNGLNYSPVHQCLLEKSIAGYKEIEYEVMRDSNDTAIVVC
CARB_BACHD      VGYPIIVRPAYXXXXXXXXXVYNEEDLVEIVTSGLKYSPVQCLVEKSIAGFKEIEYEVMRDGKDHAIVVC
ACCC_BACHD      FGYPVMLKASAGG-GGIGMQLVRNDEEMRKAFAGNQKRATTMFLEKAVENPRHIEVQIAADHHGHV----
PURT_SHEPC      ----------------------------------------------------------------------
PURT_SHEB5      ----------------------------------------------------------------------
PURT_POLSJ      ----------------------------------------------------------------------
PURT_CORGL      ----------------------------------------------------------------------
PURT_CORGB      ----------------------------------------------------------------------
MCCA_ARATH      IGYPIIIKPTHGG-GGKGMRIVADSFLGAQREAAASFGVNTILLEKYITRPRHIEVQIFGDKHGNVLLYE
CARB_MYCSS      IGYPVLVRPSY-VLGGRGMEIVYD----------------------------------------------
CARB_MYCSK      IGYPVLVRPSY-VLGGRGMEIVYD----------------------------------------------
CARB_MYCSJ      IGYPVLVRPSY-VLGGRGMEIVYD----------------------------------------------
CARB_LEUMM      HGYPVIVRPAYTGGTGGGIAQTHEELSEITANGLELSPVTQVLIERSIAGYKEIEFEVMRDANDNALVVA
CARB_LACSS      NGFPVIIRPA------------------------------------------------------------
PURT_BORA1      ----------------------------------------------------------------------
PURT_ACIAC      ----------------------------------------------------------------------
MPTN_METAC      FGDAVIKPVF--GYKGKDIARVKD----------------------------------------------
CARB_STRPZ      IGYPVIVRPATLGGTGGGICSSEEELCEITENGLKLSPVTQCLIERSIAGFKEIEYEVMR----------
CARB_STRPG      IGYPVIVRPATLGGTGGGICSSEEELCEITENGLKLSPVTQCLIERSIAGFKEIEYEVMR----------
CARB_STRP8      IGYPVIVRPATLGGTGGGICSSEEELCEITENGLKLSPVTQCLIERSIAGFKEIEYEVMR----------
CARB_STRP6      IGYPVIVRPATLGGTGGGICSSEEELCEITENGLKLSPVTQCLIERSIAGFKEIEYEVMR----------
CARB_STRP3      IGYPVIVRPATLGGTGGGICSSEEELCEITENGLKLSPVTQCLIERSIAGFKEIEYEVMR----------
CARB_STRP1      IGYPVIVRPATLGGTGGGICSSEEELCEITENGLKLSPVTQCLIERSIAGFKEIEYEVMR----------
CARB_METMJ      VGLPAIIRPAYTGGSGGGVAHTPEEMRRICELGLARSRIHQVLVEESVAGWKEIEFEVMRDAADTCIIVC
CARB_LACS1      IGYPVIVRPAMGGTGG------------------------------------------------------
CARB_LACJO      IGYPIIVRPATMGGTGGGICNNHEELAKIAKNGLELSPVTECLIEKSIAGYKEIEFEVMR----------
CARB_HALER      LGFPVIIRPSTMGGSGGGVAYNKEEFEEICTRGFELSNNHELLIDESLLGWKEYEMEVVRDKNDNCIIVC
CARB_BEUC1      IGYPVLVRPSY-VLGGRGMEIVYD----------------------------------------------
PURT_SULTO      ----------------------------------------------------------------------
PURT_PSYIN      ----------------------------------------------------------------------
PURT_METFK      ----------------------------------------------------------------------
PURT_DECAR      ----------------------------------------------------------------------
CPSM_RANCA      VGYPCLLR--------------------------------------------------------------
CARB_THETN      YGYPLIIRPAYTGGTGGGIAHNDEELISIVDLGLKKSMVGEVLVEKSLYGWKEIEFEVMRDAADNCITIC
CARB_THENN      FGYPVIIRPSTLGGTGGGVAFNEEELREIVTKGLIESPVHTVLIEESVIGWKEYELEVVRDGAGNFIVVC
CARB_SULAC      VGYPVLVR--------------------------------------------------------------
PURT_THIDA      ----------------------------------------------------------------------
PURT_POLNA      ----------------------------------------------------------------------
MPTN_METMA      FGDAVIKPVF--GYKGKDI---------------------------------------------------
CARB_MYXXD      IGFPAIIRPSTLGGTGGGIAYNREEFETICRSGLKASPTTTILVEESVLGWKEYELEVVRDTADNVIIVC
CARB_LACLA      IGYPIIVRPATMGGTGGGICDTEEELREIVANGLKLSPVTQCLIEESIAGYKEIEYEVMRDSADNAIVVC
CARB_LACAC      IGYPIIVRPATMGGTGGGICHNRKELAEIAKNGLELSPVTECLIEKSIAGYKEIEFEVMR----------
CARB_HALOH      IGFPVIVRPAYTGGSGGGIAENVEELKEIVTLGLKRSRINQVLIEKSLYGWKELEYEVIRDGNDNCITIC
CARB_YERPE      LGYPLVVR--------------------------------------------------------------
CARB_EXISA      IGYPIIIRPAYTGGTGGGIAHDRESFEQIVESGLKASPVTQVLLEKSIAGMKEVEFEVMRDSSDQAIIVC


                         .         .         .         +         .         .         .:280
query           VVETVQRGGICHEVIAPAPHLSEDRXXXXXXXXXXXXXXXXXXXXXXXELFETDTGVVVNELAMRPHNSG
PURK_MYCTU      VVQTVQRDGTCVLVIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFETDGALLVNELAMRPHNSG
PURK_MYCBO      VVQTVQRDGTCVLVIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFETDGALLVNELAMRPHNSG
PURK_CORAM      LTESVQRNGVCAEAVAPAPGVDPQLQQRAETLGEKIATELGVTGVLAVELFANESGIAVNELAMRPHNTG
PURK_MYCLE      VVETVQRDGICVXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVVGVFAVELFETDGALLVNELAMRPHNSG
PURK_SYNE7      VVQTHQQNQVCRWVVAPAA-IPGALQKAVAAIARTLVETVDYVGVAGIELFQQGDRLWVNEIAPRTHNSG
PUR6_DEBOC      TVETIHKNNICHVVYAPA-RVSDSIAVKASVLAKNAVKSFPGCGIFGVEMFLLPNNILINEIAPRPHNSG
PUR6_YEAST      IVETIHKDNICDLCYAPA-RVPDSVQLKAKLLAENAIKSFPGCGIFGVEMFYLETGLLINEIAPRPHNSG
PUR6_PICME      TVETIHQNNICHTVFAPA-RVNDTVQKKAQILADNAVKSFPGAGIFGVEMFLLQNGLLVNEIAPRPHNSG
PUR6_CANGA      IVETIHKNNVCHLCYVPARVPDSVQHKAKLMAENAIKSFPGCGIFGVEMFLLDDDSIVLNEIAPRPHNSG
PURK_BACSU      TAENIHHNNILFQSIVPA-RVEKGIQQKAADLAVKLADELNLVGPLAVEMFLTEDGLLVNELAPRPHNSG
PUR6_SCHPO      TTETIQKDNVCHLVYAPAPFSIQQRAQTLAMDAVRTFEGAGIYGVEMFVLQDGET-ILLNEIAPRPHNSG
PURK_VIBVY      LAENIHVNGVLSLSTADSPDLQEQAKHMFTAVAETLNYVGVLAL----EFFDVDGQLLVNEIAPRVHNSG
PURK_VIBVU      LAENIHVNGVLSLSTADSPDLQEQAKHMFTAVAETLNYVGVLAL----EFFDVDGQLLVNEIAPRVHNSG
PURK_SYNY3      VVETKQIDQVCRWVVXXXXXXXXXRRILNHLDYVGILAIEFFLLPASTQTPTPEQRLLVNELAPRTHNSG
PURK_VIBCH      LAENVHTQGVLSLSTADAPALQTQAKAMFKAVAEQLNYVGVLAL----EFFEVQGQLLVNEIAPRVHNSG
PUR6_CANAL      TVETIHENNIWHLVYAPA-RIPDTLGQKASILAKNAVKSFPGCGIFGVEMFXXXXXXXXXXXAPRPHNSG
PURK_VIBF1      LTENVHVDGVL--ALSTALEGTSNLQQQADEMFTAIADELNYIGVLAIEFFDVDGTLLVNEIAPRVHNSG
PURK_PSEAE      LVHNTHDSGILKLSVASSGHLAED-------YVGRVLARLDYVGVLAFEFFEVDGGLKANEIAPRVHNSG
PURK_VIBPA      LAENVHTNGVLSLSTADAPELQAQAKQMFTAVADSLNYVGVLAL----EFFDVEGTLLVNEIAPRVHNSG
PUR6_CRYNE      AVETIHRESILRVCLAPLRGEKGVNQRARELAEKAVGHLEGAGIFGVEMFLMPDGELLLNEIAPRPHNSG
PURK_BRUME      LAENVHKDGILATSTVPAA-ISVQTAEAARTAAEKLLHALDYVGVLGLEFFVLKDGTLLNEFAPRVHNSG
PUR6_CRYNV      AVETIHRESILRVCLAPLRGERGVNQRARELAEKAVGHLEGAGIFGVEMFLMPDGELLLNEIAPRPHNSG
PUR6_VIGAC      VVELFT-GHICHIVKSPA-NVNWKTRELAIEVAFNAVKSLEVPGVFAVELFLTKEGILLNEVAPRPHNSG
PURK_AQUAE      QPFNKHEEGILIYNYVPYAKLKEAEEITKRLMELLDIVGVFTVEFFLLK----DGRVLINEFAPRVHNTG
PURK_STAS1      LQENEHQNQILFKTIVPA-RVQDNKEQEARNEVNKIIKAIHFIGTFTVEFFDQQNQLYVNEIAPRPHNSG
PURK_STAES      LQENEHQNQILFKTVVPA---RSDKENEARKEVEKITRAIHFVGTFTVEFFDKENNLYVNEIAPRPHNSG
PURK_STAEQ      LQENEHQNQILFKTVVPA---RSDKENEARKEVEKITRAIHFVGTFTVEFFDKENNLYVNEIAPRPHNSG
PURK_STAHJ      LQENEHRNQILFKTIVPA---RSDKEQEARDEVNKIINEVHFVGTFTVEFFDKSNNLYVNEIAPRPHNSG
PURK_HAEIN      VTHNLQQNGILYSVVDCAFPQQSVQQKQAETMLGKIMDKLGYVGVMAMECFVVGDKLLINELAPRVHNSG
PURK_ECOLI      LTHNLHQDGILRTSVXXXXXXXXXXXXXEEMLSAIMQELGYVGVMAM-ECFVTPQGLLINELAPRVHNSG
PURK_STAAW      LQENEHRNQILFKTIVPA---RIDKTAEAKEQVNKIIQSIHFIGTFTVEFFDSNNQLYVNEIAPRPHNSG
PURK_STAAS      LQENEHRNQILFKTIVPA---RIDKTAEAKEQVNKIIQSIHFIGTFTVEFFDSNNQLYVNEIAPRPHNSG
PURK_STAAC      LQENEHRNQILFKTIVPA---RIDKTAEAKEQVNKIIQSIHFIGTFTVEFFDSNNQLYVNEIAPRPHNSG
PURK_STAAR      LQENEHRNQILFKTIVPA---RIDKIAEAKEQVNKIIQSIHFIGTFTVEFFDSNNQLYVNEIAPRPHNSG
PURK_STAAN      LQENEHRNQILFKTIVPA---RIDKTAEAKEQVNKIIQSIHFIGTFTVEFFDSNNQLYVNEIAPRPHNSG
PURK_STAAM      LQENEHRNQILFKTIVPA---RIDKTAEAKEQVNKIIQSIHFIGTFTVEFFDSNNQLYVNEIAPRPHNSG
PURK_SULSO      PTYNYNEKGILQNIVEIARRLSEE---------------LDYVGIMGVEVFVVNGKVLINEFAPRVHNTG
PURT_PELPD      PIGHVQIKGDYHESWQPMA-MSPXXXXXXXXXXXXVTTALGGYGLFGVELFISNDRVLFSEVSPRPHDTG
PURT_SYNS3      PIGHQQANGDYQCSWQPAS-ISPSQLQQAQTMARTVTDNLGGAGLFGVEFFLCGDEVVFSELSPRPHDTG
PURT_PELCD      IGHR-QEGGDYQESWQPMP-MTDKALAEAQRQAKVITEALGGAGLFGVEFFIQGDTVYFSEVSPRPHDTG
PURT_BACV8      PIGHVQKGGDYRESFQPA-HIDPEHLKEAQRMADKVTAALTGAGIWGVEFFSHENGVYFSELSPRPHDTG
PURT_METM7      IGH-IQIDGDYHESWQPHPMCAPTKAKAQEMAKKITDELGGYGIFGV-ELFVLDDEVIFSEVSPRPHDTG
PURT_METMP      IGH-IQVDGDYHESWQPHPMCAPTKAKAQEMAKKITDELGGYGIFGV-ELFVLDDEVIFSEVSPRPHDTG
PURT_SYNY3      PIGHRQERGDYQESWQPAP-LTQRQLAQAQAIAKTVTDALGGAGIFGVEFFITPEEVIFSELSPRPHDTG
PURT_BACTN      PIGHVQKGGDYRESFQPA-HIDPAHLKEAEEMAEKVTRALTGAGLWGVEFFSHENGVYFSELSPRPHDTG
PURT_SYNPW      PIGHEQARGDYQCSWQPAA-LSDKQLSEAQAMARTVTDNLGGAGLFGVEFFLCGDEVIFSELSPRPHDTG
PURT_SULAC      V-EHQRPQGVYHYIESWHPAVSQDVISKASEYATKVVNELGGFGIFGVEIMIAGNRVLFNEVAPRPHDTG
PURT_METVS      IGH-IQIDGDYHESWQPHPMCSPTKAKAQEVAKKITDELGGYGIFGV-ELFIMDDEVIFSEVSPRPHDTG
PURT_SYNS9      PIGHEQERGDYQCSWQPA-QMSDAQLQQAQTMARTVTDNLGGAGLFGVEFFLCGNEVIFSELSPRPHDTG
PURT_CHLTE      PIGHRQERGDYQESWQPC-RISPEQLEEAQNIAGKVTEALTGAGIWGVEFFLADDGVYFSELSPRPHDTG
PURT_METM5      IGH-IQIDGDYHESWQPHPMCAPTKAKAQEMAKKITDELGGYGIFGV-ELFVLDDEVIFSEVSPRPHDTG
PURT_META3      IGH-IQDGGDYIESWQPHP-MSEEMIKKAQEMANKITTVLGGNGIFGVELFIRGDEVIFSEVSPRPHDTG
PURT_GEOMG      IGH-VQIKGDYHESWQPMA-MTPAALAESQRQAKAVTDALGGSGIFGVELFIKGDRVWFSEVSPRPHDTG
PURT_PROMA      PIGHEQKGGD-YQCSWQPQKLSFDQLKEAKSIAKKVTNELGGIGLFGVEFFIRGEEVIFSELSPRPHDTG
PURT_NITSB      IGH-IQKDG--DYIFSWQPQMSETALQKAKEIAKTITDGLGGRGIFGVELFVKGDEVYFSEVSPRPHDTG
PURT_METJA      IGH-VQIDGDYHESWQPH-NMSAELKEQAQDIAKKVTDALGGYGIFGVELFVKGDEVIFSEVSPRPHDTG
PURT_SYNPX      PIGHEQEHGDYQCSWQPA-ELSSEQLHQAQAMARTVTQNXXXXXXXXXXXXXXXDEVIFSELSPRPHDTG
PURT_CHLPD      PIGHRQERGDYQESWQPC-RIGDAQLHEAQEIAEKVTRSLTGAGIWGVEFFLADDGLYFSELSPRPHDTG
PURT_PROMM      PIGHEQIGGDYQCSWQPA-ELSTEQLKQAQSMALTITKNXXXXXXXXXXXXXXXNEVIFSELSPRPHDTG
PURT_ANAVT      IGHRQERGDY-QESWQPAG-ISEDKILEAQAIAKKVTDALGGAGIFGVEFFITKDEVIFSELSPRPHDTG
PURT_PASMU      IGH-IQIDGDYRESWQPQA-MSAVALEKAQAIAEKITGALGGRGIFGVEMFVCGDEVIFNEVSPRPHDTG
PURT_LEPBL      PIGHRQERGDYQESWQPA-EISEVQLKEAQRMAEAVTKELTGFGIWGVEFFLTEDQVYFSELSPRPHDTG
PURT_LEPBJ      PIGHRQERGDYQESWQPA-EISEVQLKEAQRMAEAVTKELTGFGIWGVEFFLTEDQVYFSELSPRPHDTG
PURT_DESMR      IGHRQEKGDY-RESWQPHP-MSQSALAKAQAMAGAVTEALGGRGIFGVELFIKGDAVIFSEVSPRPHDTG
PURT_THICR      IGH-IQEDGDYRQSWQPHP-MSDIAVQSAEKIALKITEALGGWGLFGVELFIKDDQVIFSEVSPRPHDTG
PURT_SYNSC      PIGHEQEGGDYQCSWQPA-QLTDQQLHQAQAMAKTVTDNLGGAGLFGVEFFLCDDEVIFSELSPRPHDTG
PURT_BACFN      PIGHVQKGGDYRESFQPA-HIDPAHLKEAEDMAEKVTRALTGAGLWGVEFFSHENGVYFSELSPRPHDTG
PURT_DESVV      IGH-LQKDGDYRESWQPQP-MDAVALEKARAMADAVTGALGGWGIFGVELFVRGDEVWFSEVSPRPHDTG
PURT_DESVH      IGH-LQKDGDYRESWQPQP-MDAVALEKARAMADAVTGALGGWGIFGVELFVRGDEVWFSEVSPRPHDTG
PURT_ANASP      IGHRQERGDY-QESWQPAG-ISEDKILEAQAIAKTVTDALGGAGIFGVEFFITKDEVIFSELSPRPHDTG
PURT_ANADE      PIGHRQERGDYQESWVPPPLLEEARRMAGAVTRALGGAGIFGV-----EFFLAKDRIWFSELSPRPHDTG
PURT_HAES1      IGHRQEKGAMSVQALAKAQHIAEK-----------ITTELGGRGIFGVEMFVCGDEVIFNEVSPRPHDTG
PURT_AZOSB      VGHRQEKGDY-QESWQPQP-MSAKAIAESERIALAVTGALGGRGLFGVELFIKGDMVWFSEVSPRPHDTG
PURT_FLAPJ      IGHRQERGDY-QESWQPA-RISDKDLHEAQDMARKVTEALGGAGLFGVEFFLTNDGVYFSELSPRPHDTG
PURT_ERYLH      IGHRQERGDMSKPAIAAAQEMAEK-------VVTALQGNGKGFGLFGVEFFVKGEEVIFSELSPRPHDTG
PURT_BIFLO      IGQR-QESGDYRESWQPATEPDGERTAVEGLVAKAQAAGETGWGVFGVELFVTDGSILFNEVSPRPHDTG
PURT_SALAR      VGHR-QQDGDYRESWQPQ-QMSELALKRAQEIARHVVLALGGHGLFGVELFVCGDEVIFSEVSPRPHDTG
PURT_PROM3      PIGHEQIGGDYQCSWQPA-ELSTEQLKQAQSMALSITENXXXXXXXXXXXXXXXNEVIFSELSPRPHDTG
PURT_BACFR      PIGHVQKGGDYRESFQPA-HIDPAHLKEAEDMAEKVTRALTGAGLWGVEFFSHENGVYFSELSPRPHDTG
PURT_AERHH      IGHR-QEDGDYRESWQPQA-MSEQALARSKEVAAKVVEALGGYGLFGVELFIKGDEVWFSEVSPRPHDTG
PURT_DESDG      IGHR-QEDGDYRQSWQPQP-MSAAALEQARHMAQAVTQALGGYGLFGVELFIKGDTVWFSEVSPRPHDTG
PURT_MANSM      IGHRQQNGDYRESWQPQA--MSEIALQKAQQVAEKITSALGGRGIFGVEMFVCGDEVIFNEVSPRPHDTG
PURT_FRATW      ------------------------------------------------ELFIKGDEVFFNEVSPRPHDTG
PURT_FRATT      ------------------------------------------------ELFIKGDEVFFNEVSPRPHDTG
PURT_FRATN      ------------------------------------------------ELFIKGDEVFFNEVSPRPHDTG
PURT_FRAT1      ------------------------------------------------ELFIKGDEVFFNEVSPRPHDTG
PURT_CORJK      IGHRQDRGDYV-ESWQPA-HMSEDALDXXXXXXXXXXXXLGGRGVYGVELFVKGDDVYFSEVSPRLHDTG
PURT_BACA2      IGHE-QKDGDYIESWQPH-HMTEQQIKEAKHIAKSITDELGGYGLFGVELFLTEDKVYFSEVSPRPHDTG
PURT_SYNR3      ------------------------------------------------EFFIASGEVIFSELSPRPHDTG
PURT_PSEU5      VGHRQEKGDY-QESWQPQP-MXXXXXXXXXXXXXXVTDALGGRGIFGVELFVKGEQVWFCEISPRPHDTG
PURT_HALWD      VGHTQQDGDYR---TSWQPHLTTEQRTTAQQMAQKVTDGLGGYGIFGVEFFVQDGTVIFSELSPRPHDTG
PURT_SYNP6      ------------------------------------------------EFFVTPDEVIFSELSPRPHDTG
PURT_SYNE7      ------------------------------------------------EFFVTPDEVIFSELSPRPHDTG
PURT_PYRFU      KVGHYQIDGDYHASWQPA-EISEKAEREVYRIAKRITDVLGGLGLFGVEMFVKGDKVWANEVSPRPHDTG
PURT_BURXL      PIGHVQVAGDYVESWQPQP-MSPLALERSREVAHKVTAALGGRGLFGVELFVRGDDVWFSEVSPRPHDTG
PURT_SULNB      IGHVQKDGDF---ILSWQPQMSPEALKKAQEIAKAVTDGLGGRGIFGVEFFVKDEEVYFSELSPRPHDTG
PURT_AERS4      IGHR-QEDGDYRESWQPQA-MSTLALARSKEVAAKVVGALGGYGLFGVELFIRGDEVWFSEVSPRPHDTG
CARB_LYSSC      NMENVDPVGI-HTVVAPTQTLSD-----------------------------------------------
PURT_SULDN      IGHEQRDGDY---VFSWQPQMSEIAKQRAEDMAKKITDGLGGRGLFGVELFIKGDEVYFSEVSPRPHDTG
PURT_PROMP      IGHEQYKGD--YQCSWQPLDMNQSLINEARKMTTKILNNLNGSGIYGVEFFVRGKEVIFSELSPRPHDTG
PURT_FRATO      ------------------------------------------------ELFIKGDEVFFNEVSPRPHDTG
PURT_FRATH      ------------------------------------------------ELFIKGDEVFFNEVSPRPHDTG
PURT_FRATF      ------------------------------------------------ELFIKGDEVFFNEVSPRPHDTG
PURT_ACTPJ      IGHR-QEDGDYRESWQPQA-MSDLALKRAQETAERITTALGGRGIFGVELFVCGDEIIFNEVSPRPHDTG
PURT_XANC5      ------------------------------------------------ELFVKGDEVWFSEVSPRPHDTG
PURT_SALPC      VGHR-QQDGDYRESWQPQ-QMSELALKRAQEIARHVVLALGGHGLFGVELFVCGDEVIFSEVSPRPHDTG
PURT_SALCH      VGHR-QQDGDYRESWQPQ-QMSELALKRAQEIARHVVLALGGHGLFGVELFVCGDEVIFSEVSPRPHDTG
PURT_MARAV      IGHR-QEDGDYRESWQPQP-MNDLALQRSKEIARAVVEDLGGYGIYGVELFVKGENVWFSEVSPRPHDTG
PURT_HAEDU      IGHRQQNGDYRESWQPQA--MSEVALQKAQQIAERITTALGGRGIFGVELFVCGDDIIFNEVSPRPHDTG
PURT_XANCP      IGHW-QKDGDYRESWQPQP-MSAAALRRSQEIAQAITDELGGWGLFGVELFVKGDEVWFSEVSPRPHDTG
PURT_XANCB      IGHW-QKDGDYRESWQPQP-MSAAALRRSQEIAQAITDELGGWGLFGVELFVKGDEVWFSEVSPRPHDTG
PURT_XANC8      IGHW-QKDGDYRESWQPQP-MSAAALRRSQEIAQAITDELGGWGLFGVELFVKGDEVWFSEVSPRPHDTG
PURT_STRM5      IGH-LQKDGDYRESWQPQP-MSSAALARAEEISRAITDDLGGWGLFGVELFVKGDEVWFSEVSPRPHDTG
PURT_RALEJ      KVETVQVSGDYVESWQPHP-MHPAALQTAQHIARAVTSDLGGQGLFGVELFVKGEQVWFSEVSPRPHDTG
PURT_LEPIN      PIGHRQERGDYQESWQPAA-ISEVQLKEAQRMADAVTKELTGFGIWGVEFFLTEDKVYFSELSPRPHDTG
PURT_LEPIC      PIGHRQERGDYQESWQPAA-ISEVQLKEAQRMADAVTKELTGFGIWGVEFFLTEDKVYFSELSPRPHDTG
PURT_XANAC      IGHW-QQDGDYRESWQPQP-MSAAALRRSQQIAKAITDDLGGRGLFGVELFVKGDEVWFSEVSPRPHDTG
PURT_PROM9      ------------------------------------------------EFFVKENEVIFSELSPRPHDTG
PURT_PROM0      ------------------------------------------------EFFIKGSEVIFSELSPRPHDTG
PURT_MYCVP      EIETRFCEPIGHRQVSPMPGTALERARQIAGAVTRDLGGQGIFGV---ELFVKGDQVWFSEVSPRPHDTG
PURT_MYCGI      FCEPIGHRQVSGDYVEPMPSTALDRSRQIAKAVTENLGGQGIFGV---ELFVKGDDVWFSEVSPRPHDTG
PURT_PYRHO      KVGHYQIDGDYHASWQPA-EISEKAEREVYRIAKRITDVLGGLGIFGVEMFVKGDKVWANEVSPRPHDTG
PURT_PROM5      IGHEQYKGD--YQCSWQPLDMNESLINEARNMTNKILNNLNGSGIYGVEFFVRGKEVIFSELSPRPHDTG
CARB_SCHPO      VSEHVENAGVHSTIALPPYSLSED----------------------------------------------
CARB_CLOBA      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_BACSU      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
PURT_STRMK      IGH-LQKDGDYRESWQPQP-MSSAALARAEEISRAITDDLGGWGLFGVELFVKGDEVWFSEVSPRPHDTG
PURT_SALPB      VGHR-QQDGDYRESWQPQ-QMSELALKRAQEIARHVVLALGGHGLFGVELFVCGDEVIFSEVSPRPHDTG
PURT_SALNS      VGHR-QQDGDYRESWQPQ-QMSELALKRAQEIARHVVLALGGHGLFGVELFVCGDEVIFSEVSPRPHDTG
PURT_IGNH4      PVEHKRPKGIYYESWHPATVNDEXXXXXXXXXXXXXNELGGLGIFGVEILVTKDGRVLFSEVSPRPHDTG
PURT_BIFAA      IGQRQESGDFTPDVLEQAQHIA--RTAVEGLVAKAQASGEKGWGVFGVELFVTDGNVLFNEVSPRPHDTG
PURT_ACTP7      IGHR-QEDGDYRESWQPQA-MSDLALKRAQETAERITTALGGRGIFGVELFVCGDEIIFNEVSPRPHDTG
PURT_ACTP2      IGHR-QEDGDYRESWQPQA-MSDLALKRAQETAERITTALGGRGIFGVELFVCGDEIIFNEVSPRPHDTG
CARB_ASHGO      ----------------------------------------------------------------------
PURT_PYRKO      KVGHYQIDGDYHSSWQPA-EISERAEREVYRIAKRITDVLGGLGIFGVEMFVKGDKVWANEVSPRPHDTG
PURT_PASHA      ------------------------------------------------ELFVCGDEIIFNEVSPRPHDTG
PURT_ERWT9      IGHR-QEDGDYRESWQPQ-HMSELALQRARQVAEKVVTALGGHGLFGVELFVCGDEVVFSEVSPRPHDTG
PURT_DESAD      ------------------------------------------------ELFIKGEEVIFSEVSPRPHDTG
CARB_CLOBB      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
PURT_SALTY      VGHR-QQDGDYRESWQPQ-QMSELALKRAQEIARHVVLALGGHGLFGVELFVCGDEVIFSEVSPRPHDTG
PURT_SALTI      VGHR-QQDGDYRESWQPQ-QMSELALKRAQEIARHVVLALGGHGLFGVELFVCGDEVIFSEVSPRPHDTG
PURT_SALSV      VGHR-QQDGDYRESWQPQ-QMSELALKRAQEIARHVVLALGGHGLFGVELFVCGDEVIFSEVSPRPHDTG
PURT_SALPK      VGHR-QQDGDYRESWQPQ-QMSELALKRAQEIARHVVLALGGHGLFGVELFVCGDEVIFSEVSPRPHDTG
PURT_SALPA      VGHR-QQDGDYRESWQPQ-QMSELALKRAQEIARHVVLALGGHGLFGVELFVCGDEVIFSEVSPRPHDTG
PURT_SALDC      VGHR-QQDGDYRESWQPQ-QMSELALKRAQEIARHVVLALGGHGLFGVELFVCGDEVIFSEVSPRPHDTG
PURT_PYRAB      KVGHYQIDGDYHASWQPA-EISEKAEREVYRIAKRITDVLGGLGLFGVEMFVKGDKVWANEVSPRPHDTG
CARB_STAES      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_STAEQ      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
PURT_PROMS      ------------------------------------------------EFFIKGSEVIFSELSPRPHDTG
PURT_AZOVD      IGHRQEKGDYQESWQPQA--MSTTAQAESERIARTVTEALGGRGLFGVELFVKGDQVWFSEVSPRPHDTG
CARB_BACCL      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
PURT_TOLAT      ------------------------------------------------ELFIKGDEVYFSEVSPRPHDTG
PURT_RALEH      PIGHVQVSGDYVESWQPQP-MHPAALETAQRIAQAVTADLGGMGLFGVELFVKGEQVWFSEVSPRPHDTG
PURT_HAHCH      ------------------------------------------------ELFVKGDEVYFSEVSPRPHDTG
CARB_LACRJ      CMENFDPVGI------------------------------------------------------------
CARB_LACRD      CMENFDPVGI------------------------------------------------------------
PURT_VIBCM      ------------------------------------------------ELFVKGDKVIFNEVSPRPHDTG
PURT_VIBCH      ------------------------------------------------ELFVKGDKVIFNEVSPRPHDTG
PURT_RHOSR      PIGHLQDSGDYVESWQPQP-MSDAALARSREVAEKVTAALGGRGIFGVELFVKGDDVYFSEVSPRPHDTG
PURT_RALME      EVETVQVAGDYVESWQPHP-MHPKALETSQHIARAVTADLGGQGLFGVELFVKGEQVWFSEVSPRPHDTG
PURT_PSEU2      ------------------------------------------------ELFIKGDQVWFSEVSPRPHDTG
PURT_PSESM      ------------------------------------------------ELFIKGDQVWFSEVSPRPHDTG
PURT_PSEPK      VGHRQEKGDYQESWQPQA--MSPKALAESQRVAKAVTDALGGRGLFGVELFVKGDQVWFSEVSPRPHDTG
PURT_PSEFS      ------------------------------------------------ELFIKGDQVWFSEVSPRPHDTG
PURT_PSE14      ------------------------------------------------ELFIKGDQVWFSEVSPRPHDTG
PURT_PHOPR      ------------------------------------------------ELFVRGNEVLFNEVSPRPHDTG
PURT_DESVM      IGH-LQKDGDYRESWQPHP-MSQAALAESRRMAEAVTGALGGWGIFGVELFIKGDKVYFSEVSPRPHDTG
PURT_CUPTR      QVETVQVSGDYVESWQPQP-MHPXXXXXXXXXXXXVTADLGGMGLFGVELFVKGEQVWFSEVSPRPHDTG
PURT_XANOP      ------------------------------------------------ELFVKGDEVWFSEVSPRPHDTG
PURT_PSEPW      ------------------------------------------------ELFVKGDQVWFSEVSPRPHDTG
PURT_PSEPG      ------------------------------------------------ELFVKGDQVWFSEVSPRPHDTG
PURT_PSEPF      ------------------------------------------------ELFIKGDQVWFSEVSPRPHDTG
PURT_BACSU      IGH-VQKDGDYIESWQPHD-MTEQQIEEAKHIAKTITDELGGYGLFGVELFLAKDRVYFSEVSPRPHDTG
CARB_BACCN      NMENIDPVGV-HTVVAPSQTLSD-----------------------------------------------
CARB_BACC2      NMENIDPVGV-HTVVAPSQTLSD-----------------------------------------------
PURT_WOLSU      IGH-IQKGGDYIFSWQPA-QMKKSVLKKAQKIARDVVSALGGRGIFGVELFIKKNEVYFSEVSPRPHDTG
PURT_PSEF5      ------------------------------------------------ELFIKGDQVWFSEVSPRPHDTG
PURT_PSEE4      ------------------------------------------------ELFVKGDQVWFSEVSPRPHDTG
PURT_PSEAE      IGHRQVKGDY-HESWQPQA-MSAQALAESERVARAVTEALGGRGLFGVELFVKGDQVWFSEVSPRPHDTG
PURT_PSEAB      IGHRQVKGDY-HESWQPQA-MSAQALAESERVARAVTEALGGRGLFGVELFVKGDQVWFSEVSPRPHDTG
PURT_PSEA8      IGHRQVKGDY-HESWQPQA-MSAQALAESERVARAVTEALGGRGLFGVELFVKGDQVWFSEVSPRPHDTG
CARB_TRICU      ----------------------------------------------------------------------
CARB_CLOB8      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_BACWK      NMENIDPVGV-HTVVAPSQTLSD-----------------------------------------------
PURT_XANOR      ------------------------------------------------ELFVKGDEVWFSEVSPRPHDTG
PURT_XANOM      ------------------------------------------------ELFVKGDEVWFSEVSPRPHDTG
PURT_VIBF1      IGHR-QEDGDYRESWQPQV-MTEAALKQAQNAAEKVVNALGGYGLFGVELFIKGDNIYFNEVSPRPHDTG
PURT_SHIFL      ------------------------------------------------ELFVCGDEVIFSEVSPRPHDTG
PURT_SHIF8      ------------------------------------------------ELFVCGDEVIFSEVSPRPHDTG
CARB_PELTS      NMENVDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_BACST      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
PYC_HUMAN       RDCSIQRRHQKVVEIAPAAHL-------------------------------------------------
PYC_BOVIN       RDCSIQRRHQKVVEIAPAAHL-------------------------------------------------
PURT_SHIBS      ------------------------------------------------ELFVCSDEVIFSEVSPRPHDTG
PURT_SHIB3      ------------------------------------------------ELFVCSDEVIFSEVSPRPHDTG
PYR1_EMENI      ----------------------------------------------------------------------
PURT_WIGBR      IGHRQEKGDYQESW---QPHKMDNVIFEKAKKISKKIVSYLGGYGIFGEFFIYKDKVIFSEISPRPHDTG
PURT_SODGM      IGHR-QEDGDYRESWQPQ-HMSALARQRAQTIAADVVTALGGKGLFGVELFICGDDVIFSEVSPRPHDTG
PURT_SHISS      ------------------------------------------------ELFVCGDEVIFSEVSPRPHDTG
PURT_SHIDS      ------------------------------------------------ELFVCGDEVIFSEVSPRPHDTG
PURT_ECOUT      ------------------------------------------------ELFVCGDEVIFSEVSPRPHDTG
PURT_ECOLI      ------------------------------------------------ELFVCGDEVIFSEVSPRPHDTG
PURT_ECOL5      ------------------------------------------------ELFVCGDEVIFSEVSPRPHDTG
PURT_ECOK1      ------------------------------------------------ELFVCGDEVIFSEVSPRPHDTG
PURT_ECODH      ------------------------------------------------ELFVCGDEVIFSEVSPRPHDTG
PURT_ECOBW      ------------------------------------------------ELFVCGDEVIFSEVSPRPHDTG
PURT_ECO57      ------------------------------------------------ELFVCGDEVIFSEVSPRPHDTG
CARB_GEMAT      ----------------------------------------------------------------------
CARB_BACC3      NMENIDPVGV-HTVVAPSQTLSD-----------------------------------------------
CARB_BACC0      NMENIDPVGV-HTVVAPSQTLSD-----------------------------------------------
CARB_BACAN      NMENIDPVGV-HTVVAPSQTLSD-----------------------------------------------
CARB_BACAH      NMENIDPVGV-HTVVAPSQTLSD-----------------------------------------------
CARB_BACAC      NMENIDPVGV-HTVVAPSQTLSD-----------------------------------------------
CARB_BACAA      NMENIDPVGV-HTVVAPSQTLSD-----------------------------------------------
PYC1_CAEEL      RDCSVQRRHQKVVEIAPAPALPE-----------------------------------------------
PURT_MYCS2      IGHR-QVGGDYVESWQPHP-MPATALERAQEIAGAVTGNLGGQGIFGVELFVKGDQVWFSEVSPRPHDTG
PURT_METCA      ------------------------------------------------ELFVRGDEVWFSEVSPRPHDTG
PURT_EDWI9      ------------------------------------------------ELFVRGDEVIFSEVSPRPHDTG
CARY_BACST      NMENVDPVGI-HTVVAPSQTLTDE----------------------------------------------
CARB_SYMTH      SMENIDPVGV-HTVVAPSQTLTD-----------------------------------------------
CARB_LISW6      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_BACC1      NMENIDPVGV-HTVVAPSQTLSD-----------------------------------------------
PYR1_YEAST      ----------------------------------------------------------------------
PYR1_SCHPO      ----------------------------------------------------------------------
PURT_SHEAM      IGHR-QEDGDYRESWQPQA-MSSLALDRAQHIAREVVQNXXXXXXXXVELFIKGDEVYFSEVSPRPHDTG
PURT_PARD8      ------------------------------------------------ELFIKGDDVIFSEVSPRPHDTG
PURT_KLEP3      ------------------------------------------------ELFVCGDEVIFSEVSPRPHDTG
CARB_SULTO      ----------------------------------------------------------------------
CARB_STRS7      SMENFDPVGI-HTVFAPTQTLSD-----------------------------------------------
CARB_STRCO      ----------------------------------------------------------------------
CARB_STAS1      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_STAHJ      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_LISMO      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_LISMH      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_LISMF      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_LISMC      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_LISIN      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_DESAP      SMENIDPMGI-HTVVAPTQTLSD-----------------------------------------------
CARB_BACHK      NMENIDPVGV-HTVVAPSQTLSD-----------------------------------------------
PYC_RAT         RDCSIQRRHQKVVEIAPATHL-------------------------------------------------
PYC_MOUSE       RDCSIQRRHQKVVEIAPATHL-------------------------------------------------
PURT_ENTS8      ------------------------------------------------ELFVCGDEVIFSEVSPRPHDTG
CARB_XANCP      AIENLDPMGV-HTTVAPAQTLTD-----------------------------------------------
CARB_SULIY      ----------------------------------------------------------------------
CARB_SULIN      ----------------------------------------------------------------------
CARB_SULIM      ----------------------------------------------------------------------
CARB_SULIL      ----------------------------------------------------------------------
CARB_SULIK      ----------------------------------------------------------------------
CARB_SULIA      ----------------------------------------------------------------------
CARB_STRSV      ----------------------------------------------------------------------
CARB_STRGG      ----------------------------------------------------------------------
CARB_HYPBU      CLENADPMGVHSVVIAPCQTLTD-----------------------------------------------
CARB_BACCZ      NMENIDPVGV-HTVVAPSQTLSD-----------------------------------------------
CARB_BACCQ      NMENIDPVGV-HTVVAPSQTLSD-----------------------------------------------
CARB_BACC7      NMENIDPVGV-HTVVAPSQTLSD-----------------------------------------------
PURT_THISH      VGHRQVKGDYV-ESWQPQP-MSETALDTAREMAAAVTGALGGQGLFGVEFFVRGDEVWFSEVSPRPHDTG
CARB_SULSO      ----------------------------------------------------------------------
CARB_LACPL      ----------------------------------------------------------------------
CARB_BACCR      NMENIDPVGV-HTVVAPSQTLSD-----------------------------------------------
CARB_BACC4      NMENIDPVGV-HTVVAPSQTLSD-----------------------------------------------
PURT_SULSO      ------------------------------------------------EIIVSGNRILFSEVAPRPHDTG
PURT_PROM1      PIGHEQKNGDYQCSWQPA-ELTESVLEKAQQIAKRVTDNXXXXXXXXXXXXIKGEEVIFSELSPRPHDTG
PURT_ACIBT      ------------------------------------------------ELFIKGDKVWFSEVSPRPHDTG
CARB_YEAST      ISEHVENAGVHSSLVLPPQHLSDD----------------------------------------------
CARB_STRE4      SMENFDPVGI-HTVFAPTQTLSD-----------------------------------------------
CARB_STACT      NMENIDPVGIDSVVVAPSQTLTD-----------------------------------------------
CARB_STAAW      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_STAAT      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_STAAS      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_STAAR      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_STAAN      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_STAAM      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_STAAE      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_STAAC      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_STAA9      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_STAA8      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_STAA3      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_STAA2      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_STAA1      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_NATTJ      ----------------------------------------------------------------------
PURT_YERE8      ------------------------------------------------ELFVCGDEVIFSEVSPRPHDTG
PURT_VARPS      PIGHVQVSGDYVESWQPHP-MAPAALQKAQQIAEAVTSDLGGQGLFGVELFVKGDEVWFSEVSPRPHDTG
PURT_SHESA      IGHR-QEDGDYRESWQPQA-MSADVLAKSQAIASKVVEALGGYGLFGVELFVKGSDVYFSEVSPRPHDTG
PURT_PROMT      PIGHEQKNGDYQCSWQPA-ELTESVLEKAQQIAKRVTDNXXXXXXXXXXXXIKGEEVIFSELSPRPHDTG
PURT_PECCP      ------------------------------------------------ELFVCGDEVIFSEVSPRPHDTG
PURT_ERWCT      ------------------------------------------------ELFVCGDEVIFSEVSPRPHDTG
PURT_ACIAD      ------------------------------------------------ELFIKGDHVWFSEVSPRPHDTG
CARB_STRGC      ----------------------------------------------------------------------
PURT_SHESM      IGHR-QEDGDYRESWQPQA-MSADVLAKSQAIASKVVEALGGYGLFGVELFVKGSDVYFSEVSPRPHDTG
PURT_BURVG      ------------------------------------------------ELFVRGDDVWFSEVSPRPHDTG
PURT_BURCM      ------------------------------------------------ELFVRGDDVWFSEVSPRPHDTG
CARB_XANAC      AIENLDPMGV-HTTVAPAQTLTD-----------------------------------------------
CARB_MACCJ      NMENIDPVGI-HTVVAPSQTLTD-----------------------------------------------
CARB1_METJA     ----------------------------------------------------------------------
Y4RH_RHISN      ----------------------------------------------------------------------
PURT_SHESR      IGHR-QEDGDYRESWQPQA-MSADVLAKSQAIASKVVEALGGYGLFGVELFVKGNDVYFSEVSPRPHDTG
PURT_ALCBS      ------------------------------------------------ELFIKGDQVYFSEVSPRPHDTG
CARB_XYLFA      SIENLDPMGV-HTTVAPAQTLSD-----------------------------------------------
CARB_THET8      SIENVDPMGV-HTTVAPAQTLSD-----------------------------------------------
PURT_SHEON      ------------------------------------------------ELFVKGSDVYFSEVSPRPHDTG
PURT_SHEFN      ------------------------------------------------ELFIRGDEVYFSEVSPRPHDTG
PURT_BURTA      ------------------------------------------------ELFVRGDDVWFSEVSPRPHDTG
PURT_BURS3      ------------------------------------------------ELFVNGDDVWFSEVSPRPHDTG
PURT_BURPS      ------------------------------------------------ELFVRGDDVWFSEVSPRPHDTG
PURT_BURP6      ------------------------------------------------ELFVRGDDVWFSEVSPRPHDTG
PURT_BURP1      ------------------------------------------------ELFVRGDDVWFSEVSPRPHDTG
PURT_BURP0      ------------------------------------------------ELFVRGDDVWFSEVSPRPHDTG
PURT_BURMS      ------------------------------------------------ELFVRGDDVWFSEVSPRPHDTG
PURT_BURMA      ------------------------------------------------ELFVRGDDVWFSEVSPRPHDTG
PURT_BURM9      ------------------------------------------------ELFVRGDDVWFSEVSPRPHDTG
PURT_BURM7      ------------------------------------------------ELFVRGDDVWFSEVSPRPHDTG
PURT_BORPE      ------------------------------------------------ELFVAGDQVWFSEVSPRPHDTG
CARB_XYLFT      SIENLDPMGV-HTTVAPAQTLSD-----------------------------------------------
CARB_STAAB      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_MYCGI      ----------------------------------------------------------------------
CARB_CLOBL      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
PYR1_DROME      ----------------------------------------------------------------------
PURT_VIBVY      IGHR-QEDGDYRESWQPQ-QMSENAIKAAEYTAEQVVNALGGYGIFGVELFVKGDKVIFNEVSPRPHDTG
PURT_VIBVU      IGHR-QEDGDYRESWQPQ-QMSENAIKAAEYTAEQVVNALGGYGIFGVELFVKGDKVIFNEVSPRPHDTG
PURT_COREF      IGHRQQDGDYVESMEMTAPALENARSVAARITNALGGRGVFGV-----ELFVSGDDVYFSEVSPRPHDTG
PURT_BURCH      ------------------------------------------------ELFVRGDDVWFSEVSPRPHDTG
PURT_BURCA      ------------------------------------------------ELFVRGDDVWFSEVSPRPHDTG
CARB_PYRFU      ----------------------------------------------------------------------
CARB_PEDPA      ----------------------------------------------------------------------
CARB_MYCLE      ----------------------------------------------------------------------
CARB_METHJ      GMENVDPMGVHSVVVAPILTLRDD----------------------------------------------
CARB_ACIC5      ----------------------------------------------------------------------
CARB_ACIBL      SIENFDPMGV-HTTVAPAQTLSD-----------------------------------------------
PURT_VIBPA      ------------------------------------------------ELFVKGDKVIFNEVSPRPHDTG
CPSM_RAT        ISEHVEDAGV------------------------------------------------------------
CARB_STRA5      NMENFDPVGI-HTVFAPAQTLSD-----------------------------------------------
CARB_STRA3      NMENFDPVGI-HTVFAPAQTLSD-----------------------------------------------
CARB_STRA1      NMENFDPVGI-HTVFAPAQTLSD-----------------------------------------------
CARB_MYCVP      ----------------------------------------------------------------------
CARB_MYCTU      ----------------------------------------------------------------------
CARB_MYCBO      ----------------------------------------------------------------------
CARB_METPE      SMENVDPMGVHSVVVAPILTLRDD----------------------------------------------
CARB_EXIS2      AMENFDPVGV-HTVFAPTQTLSD-----------------------------------------------
PYR1_MESAU      ISEHVENAGV------------------------------------------------------------
PURT_YERPY      --------------------------------------------------------VIFSEVSPRPHDTG
PURT_YERPS      --------------------------------------------------------VIFSEVSPRPHDTG
PURT_YERPP      --------------------------------------------------------VIFSEVSPRPHDTG
PURT_YERPN      --------------------------------------------------------VIFSEVSPRPHDTG
PURT_YERPG      --------------------------------------------------------VIFSEVSPRPHDTG
PURT_YERPE      --------------------------------------------------------VIFSEVSPRPHDTG
PURT_YERPB      --------------------------------------------------------VIFSEVSPRPHDTG
PURT_YERPA      --------------------------------------------------------VIFSEVSPRPHDTG
PURT_LEPCP      ------------------------------------------------ELFVKGDLVWFSEVSPRPHDTG
CPSM_MOUSE      ----------------------------------------------------------------------
CARB_THET2      IMEHVERAGVDSATLLPPVHVPEE----------------------------------------------
CARB_STRTD      ----------------------------------------------------------------------
CARB_STRT2      ----------------------------------------------------------------------
CARB_STRT1      ----------------------------------------------------------------------
CARB_STRAW      ----------------------------------------------------------------------
CARB_RUBXD      SIENVDPMGV-HTTVAPAQTLSD-----------------------------------------------
CARB_METTP      ----------------------------------------------------------------------
CARB_DEIGD      SIENFDPMGV-HTTVAPAQTLSD-----------------------------------------------
PYR1_HUMAN      ----------------------------------------------------------------------
PURT_VIBHB      ------------------------------------------------ELFVKGDKVIFNEVSPRPHDTG
PURT_SHESW      ------------------------------------------------ELFVKGNEVYFSEVSPRPHDTG
PURT_RHOFD      ------------------------------------------------ELFVKGEQVWFSEVSPRPHDTG
PURT_PROMH      ------------------------------------------------ELFIQGDEVFFNEVSPRPHDTG
MCCA_DICDI      RDCSVQRR---HQKIAPAPHLSEE----------------------------------------------
CARB_STRMU      ----------------------------------------------------------------------
CARB_CLOAB      ----------------------------------------------------------------------
PURT_MYCA9      ------------------------------------------------ELFIKGDQVYFSEVSPRPHDTG
PURT_BORPA      ------------------------------------------------ELFVAGDQVWFSEVSPRPHDTG
PURT_BORBR      ------------------------------------------------ELFVAGDQVWFSEVSPRPHDTG
CARB_METLZ      GMENVDPMGVTGESVVVAPILS------------------------------------------------
CARB_FUSNN      NMENIDPVGI-HTVVAPSQTLTD-----------------------------------------------
CARB_BACHD      NMENIDPVGV-HTVVAPSQTLSD-----------------------------------------------
ACCC_BACHD      ----------------------------------------------------------------------
PURT_SHEPC      ------------------------------------------------ELFVKGHEVYFSEVSPRPHDTG
PURT_SHEB5      ------------------------------------------------ELFVKGHEVYFSEVSPRPHDTG
PURT_POLSJ      ------------------------------------------------ELFVKGDEVWFSEVSPRPHDTG
PURT_CORGL      ------------------------------------------------ELFVSGDDVYFSEVSPRPHDTG
PURT_CORGB      ------------------------------------------------ELFVSGDDVYFSEVSPRPHDTG
MCCA_ARATH      RDCSVQRR---HQKIAPAPNISE-----------------------------------------------
CARB_MYCSS      ----------------------------------------------------------------------
CARB_MYCSK      ----------------------------------------------------------------------
CARB_MYCSJ      ----------------------------------------------------------------------
CARB_LEUMM      SMENFDPVGI-HTVTAPVQTLSD-----------------------------------------------
CARB_LACSS      ----------------------------------------------------------------------
PURT_BORA1      ------------------------------------------------ELFVAGDQVWFSEVSPRPHDTG
PURT_ACIAC      ------------------------------------------------ELFVKGDEVWFSEVSPRPHDTG
MPTN_METAC      ----------------------------------------------------------------------
CARB_STRPZ      ----------------------------------------------------------------------
CARB_STRPG      ----------------------------------------------------------------------
CARB_STRP8      ----------------------------------------------------------------------
CARB_STRP6      ----------------------------------------------------------------------
CARB_STRP3      ----------------------------------------------------------------------
CARB_STRP1      ----------------------------------------------------------------------
CARB_METMJ      GMENVDPMGIHSVVVAPILTLRDD----------------------------------------------
CARB_LACS1      ----------------------------------------------------------------------
CARB_LACJO      ----------------------------------------------------------------------
CARB_HALER      AIENFDPMGV-HTTVAPAQTLTD-----------------------------------------------
CARB_BEUC1      ----------------------------------------------------------------------
PURT_SULTO      --------------------------------------------------------VLFSEVSPRPHDTG
PURT_PSYIN      ------------------------------------------------EFFVKGDQVYFSEVSPRPHDTG
PURT_METFK      -----------------------------------------------------------SEVSPRPHDTG
PURT_DECAR      ------------------------------------------------ELFVKGDMVWFSEVSPRPHDTG
CPSM_RANCA      ----------------------------------------------------------------------
CARB_THETN      SMENFDPVGV-HTVVAPAQTLSD-----------------------------------------------
CARB_THENN      SIENLDPMGI------------------------------------------------------------
CARB_SULAC      ----------------------------------------------------------------------
PURT_THIDA      ------------------------------------------------ELFVKGDTVWFSEVSPRPHDTG
PURT_POLNA      ------------------------------------------------ELFVKGDEVWFSEVSPRPHDTG
MPTN_METMA      ----------------------------------------------------------------------
CARB_MYXXD      SIENLDPMGV-HTTVAPAQTLTD-----------------------------------------------
CARB_LACLA      NMENFDPVGV-HTVFAPSQTLSDN----------------------------------------------
CARB_LACAC      ----------------------------------------------------------------------
CARB_HALOH      NMENIDPVGI-HTVVAPSQTLSD-----------------------------------------------
CARB_YERPE      ----------------------------------------------------------------------
CARB_EXISA      AMENFDPVGV-HTVFAPTQTLSD-----------------------------------------------


                         .         *         .         .         .         .         +:350
query           HWTIDGACTSQFEQHLRAVLDLPLGSPRTVAPFTVMANLLGGHDPHVFNRYIHVMARDPELKVHFYGKEV
PURK_MYCTU      HWTIDGARTSQFEQHLRAVLDYPLGDSDAVVPVTVMANVLGAAQPSVDERLHHLFARMPDARVHLYGKAE
PURK_MYCBO      HWTIDGARTSQFEQHLRAVLDYPLGDSDAVVPVTVMANVLGAAQPSVDERLHHLFARMPDARVHLYGKAE
PURK_CORAM      HWTLVGSVTSQFEQHLRAVMDEPLGDTSTLAPVTVMANVLGADEDQQWASVPRSGAPVPATKVHLYGKGI
PURK_MYCLE      HWTMDGARTSQFEQHLRAVLDYPLGETDAVAPVTVMVNVLGAPQPPTLSRLHHLFARMPDARVHLYDKVE
PURK_SYNE7      HYSLDACQTSQFEQQLRAIADLPLGSTALQWPGALMVNLLGFEDHQSYAELRQQLAALPGACLYWYGKES
PUR6_DEBOC      HYTIDACVTSQFEAHVRAVVGLPMTSLSTTTTNAIMLNVLGDEESNKELEICRRALETPNASVYLYGKST
PUR6_YEAST      HYTIDACVTSQFEAHLRSILDLPMTSFSTITTNAIMLNVLG--DKHTKDKELETCERTPGSSVYLYGKES
PUR6_PICME      HYTIDACVTSQFEAHVRAITGLPLSTPSTQA---IMLNVLGGDEQNGEFKMCKRALETPHASVYLYGKTT
PUR6_CANGA      HYTINACVVSQFEAHLRAILDLPMTSLSTNSTNAIMLNLLG--DPETKDKELQICERTPGASVYLYGKES
PURK_BACSU      HYTLDLCETSQFEQHIRAVCGLPLGKTDLLKP-GMMVNLLGDE--------VKLVEEDPELKLYIYGKEI
PUR6_SCHPO      HYTIEACPTSQFEAHLRAICGLPFSEINTSTTHALMVNILGTDDPDYVSKIAKRSLSIPGATLHLYGKES
PURK_VIBVY      HWTQQGAETCQFENHLRAVCGLPLGSTKLVRE-TSMINILGED-----TLPASVMAMD-GCHIHWYGKEK
PURK_VIBVU      HWTQQGAETCQFENHLRAVCGLPLGSTKLVRE-TSMINILGED-----TLPASVMAMD-GCHIHWYGKEK
PURK_SYNY3      HFSLDACHTSQFALQLQAVTGQTLGSSALRCGQAVMVNLLGYESTGDYQQQLDKLAALPHSHVHWYGKDC
PURK_VIBCH      HWTQQGAETCQFENHLRAVCGLPLGSTKLVRE-TAMINILGEDQLPA-----EVLALE-GCHVHWYGKAK
PUR6_CANAL      HYTIDACVTSQFEAHVRAVTGLPM--PKGFTEFSIMLNVLGDKTPNKESEICRRALETPHASVYLYGKAT
PURK_VIBF1      HWTQQGTDICQFEMHIRAVCNLPLTGNQLLRS-TAMINILGE------DSLPDEILTMPNCHIHWYGKEK
PURK_PSEAE      HWTIEGAECSQFENHLRAVAGLPLGSTAKVGE-SAMLNFIG------XXXXXXXXXXXXDCHLHHYGKAF
PURK_VIBPA      HWTQQGAETCQFENHLRAVCGLPLGSTKLIRE-TSMVNILGEDTPEA------LLAMD-GCHIHWYGKEK
PUR6_CRYNE      HHTIEACLTSQFENHLRAILSLPLGSTALRVPSAAMVNILGASSTDAIDKMADNALTVPGAAVHLYGKES
PURK_BRUME      HWTEAACAISQFEQHIRAVAGLPLGNTDRHSD-CVMENLIGDDIEKV-----PAILCEKNAVLHLYGKEA
PUR6_CRYNV      HHTIEACLTSQFENHLRAILSLPLGSTALRVPSAAMVNILGASSTDAIDKMADNALTVPGAAVHLYGKES
PUR6_VIGAC      HHTIESCHTSQFEQHLPAVVGLPLGDPSMKTPAAIMYNILGEEEEHGFQLAHQLMKRAPGASVHWYDKEM
PURK_AQUAE      HWTLDGAYTSQFENLLRAITEMPLGSTELKLP-SGMVNILGSYEEIPLKEILSVEG----AKLYWYGKEK
PURK_STAS1      HYSIEACEYSQFDTHIKAITGQQLPQQVTLLKPAIMMNLLGRDLDLLEDQF----AEHPEWHVHIYGKNE
PURK_STAES      HYSIEACDYSQFDTHILAITGQKLPQAIELLKPTVMMNLLGRDLDLLENEF----SRHPDWHIHIYGKER
PURK_STAEQ      HYSIEACDYSQFDTHILAITGQKLPQAIELLKPTVMMNLLGRDLDLLENEF----SRHPDWHIHIYGKER
PURK_STAHJ      HYSIEACDYSQFDTHILAVTGQNLPKEIEILKPAVMMNLLGRDLDLLEDKF----ANHPEWHVHIYGKER
PURK_HAEIN      HWTQLGCSISQFELHLRALLNLPTPELQTFAP-SVMINLIGNHNPKWLN--------IPFAQLHWYGKEV
PURK_ECOLI      HWTQNGASISQFELHLRAITDLPLPQPVVNNP-SVMINLIGSDVNYDWLKL-------PLVHLHWYDKEV
PURK_STAAW      HYSIEACDYSQFDTHILAVTGQSLPNSIELLKPAVMMNLLGKDLDLLENEF----NEHPEWHLHIYGKER
PURK_STAAS      HYSIEACDYSQFDTHILAVTGQSLPNSIELLKPAVMMNLLGKDLDLLENEF----NEHPEWHLHIYGKER
PURK_STAAC      HYSIEACDYSQFDTHILAVTGQSLPNSIELLKPAVMMNLLGKDLDLLENEF----NEHPEWHLHIYGKER
PURK_STAAR      HYSIEACDYSQFDTHILAVTGQSLPNSIELLKPAVMMNLLGKDLDLLENEF----NEHPEWHLHIYGKER
PURK_STAAN      HYSIEACDYSQFDTHILAVTGQSLPNSIELLKPAVMMNLLGKDLDLLENEF----NEHPEWHLHIYGKSG
PURK_STAAM      HYSIEACDYSQFDTHILAVTGQSLPNSIELLKPAVMMNLLGKDLDLLENEF----NEHPEWHLHIYGKSG
PURK_SULSO      HYTLDGALISQFEQHLRAIIGMELG-PSTILSPSGMVNILGTDKPVEVLKY---------GKVYWYSKEV
PURT_PELPD      MVTMISQNLSQFELHVRAILGLPVGEIVNLAPSASHVILADASFDAVRFEGLEQALEVATSKLRLFGKDT
PURT_SYNS3      LVTLISQNLSEFDLHLRAVLGLPIPSITAADAAASRVILAESQGHHVQFSGVEQALTEPDTNLLLFGKEA
PURT_PELCD      MVTMATQNMSEFELHVRAVLGLPIPAIELLSPGASHVVLAGGQDDEVSFSGVEDALRVPGSKVRLFGKDS
PURT_BACV8      MVTLAGTQNNEFELHLRAVLGLPI----------------------------------------------
PURT_METM7      MVTMVTQKMSEFEIHARAILGLPVNVDILFASHVIKSEILKWAPEY----EIHEASKVKDTKIRLFGKPI
PURT_METMP      MVTMVTQKMSEFEIHARAILGLPVNSPG--ASHVIKSEILKWAPEY----EIHEASKVKDTKIRLFGKPI
PURT_SYNY3      MVTLISQNLNEFELHLRAILGLPIPQIKQTGP--------------------------------------
PURT_BACTN      MVTLAGTQNNEFELHLRAVLGLPIKQERIGASAVILSPIASQERPQY--RGMEEVTKEEDTYLRIFGKPT
PURT_SYNPW      LVTLISQNLNEFELHLRAVLGLPIPAIRCADAAASRVILADKHGSRVTYSGMEEALQESETSVFLFGKDA
PURT_SULAC      LVTLVSSDISEFQVHVRSALGLPTPDVKVVTPAAAHVILASGEKPKYIN--VDKALEIPGVQVRLFGKPV
PURT_METVS      MVTMVTQKMSEFEIHVRSILGLPV----------------------------------------------
PURT_SYNS9      LVTLISQNLSEFELHLRAVLNLPI-PQLTTAPAAASRVILADREKTVAYEGLEQALREAGTQVLLFGKNA
PURT_CHLTE      MVTLAGTQNSEFELHARAVLGLPVPDLRAGASAVILADRVGNNPS--FDGLDAALA-EPGSDIRIFGKPV
PURT_METM5      MVTMVTQKMSEFEIHARAILGLPVNVDILFASHVIKSEILKWAPEY----EIHEASKVKDTKIRLFGKPI
PURT_META3      MVTMITQNMSEFEIHLRSILGLPVDIQLTAGASSVIKSKIHKYAPQY---DISDAVKVPNTKLRIFGKPL
PURT_GEOMG      MVTMISQNLSEFELHVRAILGLPVPEVANLAPAASHVVLASEAAEEVTFSGLDAALSVPETKLRLFGKDT
PURT_PROMA      LVTLISQNLNEFELHLRAILGLPIPSIECVSPSASRVILSQESFAKVAYKGIEKALEIQNSKIMIFGKNT
PURT_NITSB      MVTMITQSQSEFALHVRAVLGLGLG---------------------------------------------
PURT_METJA      MVTMITQEMSEFEIHVRAILGLPVSTKHPGASHVIKAEI----NKYAPKYHIEDALKVPNTKLRLFGKNA
PURT_SYNPX      LVTLISQNLSEFELHLRAVLGLPIPSITTADAAASRVILAQNQMDAVSYTGVDTALQEPDTQLLLFGKTA
PURT_CHLPD      MVTLAGTQNTEFELHARAVLGLPIPKLRVGASAVVSADREGKNPDY---SGLEEALGEPCTDIRIFGKAT
PURT_PROMM      LVTLISQNLSEFELHLRAVLNLPIPTIQTADAAASRVILAKDNLSSISYKGVEKALSEIDTQILLFGKNA
PURT_ANAVT      MVTLISQNLNEFELHLRAILGLPIPKIEQLGP-SASAVILASEDAPVFTGIAEALAA-PDVDIRLFGKTA
PURT_PASMU      MVTLISQELSEFALHARAILGLPIPDITLISPSASKAIVVEGKSTQVFGQLAEVLA-EPHTNLRLFGKEV
PURT_LEPBL      MVTLSGTQNNEFELHIRAILGIPITQERKGASAVILAS-TDGKIPEV--RGLDIASEMPESDFRIFGKPI
PURT_LEPBJ      MVTLSGTQNNEFELHIRAILGIPITQERKGASAVILAS-TDGKIPEV--RGLDIASEMPESDFRIFGKPI
PURT_DESMR      MVTLISQDLSEFALHVRAILGLPIPAIRLYGPAASRVILGEGDSTSPRFAIDPAALAQPDTAIKLFGKEL
PURT_THICR      LVTLISQDLSEFALHLRAILGLPIPNITQHGPSASSVILPTGHSTETQFSGLEDALKEPDTQIRLFGKPE
PURT_SYNSC      LVTLISQNLSEFELHLRAVLGLXXXXXXXXXXXXSRVILAQTNMDSVAFEGVEQALTEADTQVLLFGKTA
PURT_BACFN      MVTLAGTQNNEFELHLRAVLGLPI----------------------------------------------
PURT_DESVV      LVTLISQNMSEFALHVRAILGLPVPLLRQNGPAASCVILAEGDSEAPRFHGVDAALAEQDTALCLFGKEV
PURT_DESVH      LVTLISQNMSEFALHVRAILGLPVPLLRQNGPAASCVILAEGDSEAPRFHGVDAALAEQDTALCLFGKEV
PURT_ANASP      MVTLISQNLNEFELHLRAILGLPIPKIEQLG-FCASAVILASEDAPLFTGVAEALA-EPDVDIRLFGKTA
PURT_ANADE      MVTLAGTQPNEFELHLRAVLGLPIPPITLVRPGASAVILARGTGAPVV-RGLESALAEPGADVRIFGKAL
PURT_HAES1      MVTLISQELSEFALHARAILGLPIPEINLISPAASKAIVVEGKSNQVQFGNLFEVLQEPNTNIRLFGKEV
PURT_AZOSB      LVTLISQDLSEFALHARAILGLPIPAIRQVGPSASAVILVEGESTQPSFSNLGAALAEPDTALRLFGKEV
PURT_FLAPJ      MVTLAGTQNNEFELHLRAILSLPI----------------------------------------------
PURT_ERYLH      MVTSVSQNLSEFDLHARAIMGLHVPSEILARP-SASAVILAEQESETVSYSGLAAAMEGGADIRIFGKNT
PURT_BIFLO      MVTMASQRLSEFALHARAILGLPI-TPEHVSLTIPAGSVAASHDGEVEFTDVAAALAEPGTDLRIFAKEV
PURT_SALAR      MVTLISQDLSEFALHVRAFLGLPVGAIRQYGPAASAVIL-----PQLTSRNVTFAAVGAGLQVRFFGKEI
PURT_PROM3      LVTLISQNLSEFELHLRAVLKLPIPTIQTADAAASRVILAKDNLSSISYKGVEKALSEIDTQILLFGKNA
PURT_BACFR      MVTLAGTQNNEFELHLRAVLGLPI----------------------------------------------
PURT_AERHH      MVTLISQDLSEFALHVRAILGLPVGTITQYGPSASAVVLREGHSQDIRYQGIEALALVPGAQLRLFGK--
PURT_DESDG      LVTIASQNLSEFALHVRAVLGLPVPVIRQYGPAASSVILAEGSSARTRFGNLQEALGEPDTSLLLFGKEV
PURT_MANSM      MVTLISQELSEFALHARAILGLPIPEINLISPAASKAIVVEGKSTQVQFGNLEQVLAEPNTNIRLFGKEV
PURT_FRATW      MVTLISQNINEFELHLRAIVGLPIPDIQTLQPSASAAILLEGDTANASICGIDKALADANVDIRIFGKEI
PURT_FRATT      MVTLISQNINEFELHLRAIVGLPIPDIQTLQPSASAAILLEGDTANASICGIDKALADANVDIRIFGKEI
PURT_FRATN      MVTLISQNINEFELHLRAIVGLPIPDIQTLQPSASAAILLEGDTANASICGIDKALADANVDIRIFGKEI
PURT_FRAT1      MVTLISQNINEFELHLRAIVGLPIPDIQTLQPSASAAILLEGDTANASICGIDKALADANVDIRIFGKEI
PURT_CORJK      MVTLGTQRFSEFDLHARAILGLPIDTTLISPGASAVIRCEDKHDGDIEYAGVNKAMAVEETNIYLFGK--
PURT_BACA2      LVTLVTQNLSEFALHVRAVLGFPIPEITQLSP--------------------------------------
PURT_SYNR3      LVTLRGQNLSEFELHLRAVLGLPIPSITSTGAAASRVVLAGADQQPVHYRGVAEALAVPESELLLFGKEA
PURT_PSEU5      LVTLVSQDLSEFALHARAILGLPIPVIRQLGPAASAVVLVEGESTQVFGNLAEVLA-EPDTALRLFGKPG
PURT_HALWD      LVTLSSQRLSQFDLHLRAILGLPIPDIDVERPGASAALVVDEPLTRPAFTGVDEALSMSDVDIRLFGKEA
PURT_SYNP6      MVTLISQNLNEFELHLRAVLGLPIPAIELLGPSASRVILAEDSGDRPSYAGVAAALQEPWVDLRLFGKDM
PURT_SYNE7      MVTLISQNLNEFELHLRAVLGLPIPAIELLGPSASRVILAEDSGDRPSYAGVAAALQEPWVDLRLFGKDM
PURT_PYRFU      MVTLASHPPSEFGLHLRAVLGLPIPGPMLIPAATVIKAKVSGYSPRF--RGLAKALSVPNATIRLFGKEA
PURT_BURXL      LVTLCSQRFSEFELHARAILGLPV----------------------------------------------
PURT_SULNB      MVTLITQSQSEFALHVRAVLGLPL----------------------------------------------
PURT_AERS4      MVTLISQDLSEFALHVRAILGLPIGTITQYGPSASAVVLRDGHSQDI-----------------------
CARB_LYSSC      ----------------------------------------------------------------------
PURT_SULDN      MVTLITQSQSEFALHLRAVLGLPL----------------------------------------------
PURT_PROMP      MVTLVSQNINEFELHLRAFLNLPIPNISLLKPSATRVIISDKESNTPSYSGLNEALELENTKVLIFGKTA
PURT_FRATO      MVTLISQNINEFELHLRAIVGLPIPDIQTLQPSASAAILLEGDTANASICGIDKALADANVDIRIFSKEI
PURT_FRATH      MVTLISQNINEFELHLRAIVGLPIPDIQTLQPSASAAILLEGDTANASICGIDKALADANVDIRIFSKEI
PURT_FRATF      MVTLISQNINEFELHLRAIVGLPIPDIQTLQPSASAAILLEGDTANASICGIDKALADANVDIRIFSKEI
PURT_ACTPJ      MVTMASQELSQFALHARAILGLPISEIYQISPAASKAIVVEGKSNNMTFGNLDKVLEEIGTNIRLFGKEV
PURT_XANC5      LVTLVSQDLSEFALHARAILGLPVGAQRQAGPSASCALLAHGNGVPVFDNVAEAL-RDPDTALRLFGKPR
PURT_SALPC      MVTLISQDLSEFALHVRAFLGMPIGAIRQYGPAASAVILPQLTSQNVTFDDVHA-AVGAGVQVRLFGKEI
PURT_SALCH      MVTLISQDLSEFALHVRAFLGMPIGAIRQYGPAASAVILPQLTSQNVTFDDVHA-AVGAGVQVRLFGKEI
PURT_MARAV      LVTLVSQDLSEFAIHARAILGIPVPVVRQNGPSASAVILPEGSSTEVSYTGLEEALAQPGTQLRLFGKEL
PURT_HAEDU      MVTMASQELSQFALHARAILGLPIPHIEQFGPAASKAIVVEGKSNNVMFVGLDKVLEERGTHIRLFGKEV
PURT_XANCP      LVTLVSQELSEFALHARAILGLPVGAERQSGPSASCALLAHGNGVPVFDNVAEAL-RDPDTALRLFGKRV
PURT_XANCB      LVTLVSQELSEFALHARAILGLPVGAERQSGPSASCALLAHGNGVPVFDNVAEAL-RDPDTALRLFGKRV
PURT_XANC8      LVTLVSQELSEFALHARAILGLPVGAERQSGPSASCALLAHGNGVPVFDNVAEAL-RDPDTALRLFGKRV
PURT_STRM5      LVTLVSQELSEFALHARAILGLPIPVIRQSGPSASCALLAHGEGVPYFNN-VAAALRVPDTAVRLFGKSV
PURT_RALEJ      MVTMATQWQNEFELHARAILGLPVST--ALKSPGASAVIYGGVDAQVFDG-VDAALRVPQTEVRLFGKES
PURT_LEPIN      MVTLAGTQNNEFELHLRAILGIPI----------------------------------------------
PURT_LEPIC      MVTLAGTQNNEFELHLRAILGIPI----------------------------------------------
PURT_XANAC      LVTLVSQELSEFALHARAILGLPVGAQRQAGPSASCALLAHGNGVPAFDNVAEAL-RDPDTALRLFGKPR
PURT_PROM9      MVTLVSQNINEFELHLRAFLNLPIPHINLIEPSATRVILSDQEHMNPIYEGLNEALEVENTKVLIFGKPI
PURT_PROM0      MVTLVSQNINEFELHLRAFLDLPIPHIYLIEPSATRVILSNQEYLNPIYEGLNEALEFEKTKVLIFGKPV
PURT_MYCVP      MVTMVTQWQNEFELHARAILGLPVDT--TLKSPGASAVIYGGVDAEVFDG-VDLALRVPHTDIRLFGKES
PURT_MYCGI      MVTMVTQWQNEFELHARAILGLPVDT--TLKSPGASAVIYGGVDAEVFDGVDRALA-VPHTDIRLFGKES
PURT_PYRHO      MVTLASHPPSEFALHLRAVLGLPIPGPMLIPAATVIKAKVSGYSPR-FRGLVKALS-VPNATVRLFGKEA
PURT_PROM5      MVTLVSQNLNEFELHLRAFLNLPIPKISLLKPSATRVILSEKESINPSYTGLNEALEVENTKVLIFGKPT
CARB_SCHPO      ----------------------------------------------------------------------
CARB_CLOBA      ----------------------------------------------------------------------
CARB_BACSU      ----------------------------------------------------------------------
PURT_STRMK      LVTLVSQELSEFALHARAILGLPIPVIRQSGPSASCALLAHGEGVPYFNN-VAAALQVPDTAVRLFGKSV
PURT_SALPB      MVTLISQDLSEFALHVRAFLGMPVGAIRQYGPAASAVILPQLTSQNVTFDNVHA-AVGAGVQVRLFGKEI
PURT_SALNS      MVTLISQDLSEFALHVRAFLGMPVGAIRQYGPAASAVILPQLTSQNVTFDNVHA-AVGAGVQVRLFGKEI
PURT_IGNH4      LVTLASMELSEFAIHARAVLGLPVPEPKLLTP--------------------------------------
PURT_BIFAA      MVTMASQRLSEFALHARAILGLPITQEHSIPEGTVAASIVVQGDGEAEFRNVAAALAEPGTDLRVFAKEV
PURT_ACTP7      MVTMASQELSQFALHARAILGLPIPEIYQISPAASKAIVVEGKSNNMTFGNLDKVLEEIGTNIRLFGKEV
PURT_ACTP2      MVTMASQELSQFALHARAILGLPIPEIYQISPAASKAIVVEGKSNNMTFGNLDKVLEEIGTNIRLFGKEV
CARB_ASHGO      ----------------------------------------------------------------------
PURT_PYRKO      MVTLASHPTSEFGLHLRAVLGLPIPGELTPAATHVIKANVSGYSPRF--RGLAKALSVPNATVRLFGKEA
PURT_PASHA      IVTMASQELSQFALHARAILGLPIPEIYRISPAASKAIVVEGKSDNVRFGGVDKVLAEIGTNIRLFGKEV
PURT_ERWT9      MVTLISQDVSEFALHVRAFLGLPVGAIRQYGP--------------------------------------
PURT_DESAD      LVTVISQDLSEFALHVRAILGLPIPAIRQYGPAASSVILSNGKSEAPAFANVDKALEAADTKVLIFGKEC
CARB_CLOBB      ----------------------------------------------------------------------
PURT_SALTY      MVTLISQDLSEFALHVRAFLGMPVGAIRQYGPAASAVILPQLTSQNVTFDNVHA-AVGAGVQVRLFGKEI
PURT_SALTI      MVTLISQDLSEFALHVRAFLGMPIGAIRQYGPAASAVILPQLTSQNVTFDDVHA-AVGAGVQVRLFGKEI
PURT_SALSV      MVTLISQDLSEFALHVRAFLGMPVGAIRQYGPAASAVILPQLTSQNVTFDNVHA-AVGAGVQVRLFGKEI
PURT_SALPK      MVTLISQDLSEFALHVRAFLGMPIGAIRQYGPAASAVILPQLTSQNVTFDDVHA-AVGAGVQVRLFGKEI
PURT_SALPA      MVTLISQDLSEFALHVRAFLGMPIGAIRQYGPAASAVILPQLTSQNVTFDDVHA-AVGAGVQVRLFGKEI
PURT_SALDC      MVTLISQDLSEFALHVRAFLGMPVGAIRQYGPAASAVILPQLTSQNVTFDNVHA-AVGAGVQVRLFGKEI
PURT_PYRAB      MVTLASHPPSEFGLHLRAVLGLPIPGPMLIPAATVIKAKVKGYSPRF--RGLAKALSVPNATVRLFGKEA
CARB_STAES      ----------------------------------------------------------------------
CARB_STAEQ      ----------------------------------------------------------------------
PURT_PROMS      MVTLVSQNINEFELHLRAFLNLPIPRIDLIEPSATRVILSNQEYLNPIYEGLYEALEFEKTKVLIFGKPV
PURT_AZOVD      LVTLISQDLSEFALHARAILGLPIPAIRQFGPAASAVILVEGQSREVGFANLGQALAEPDTALRLFGKEV
CARB_BACCL      ----------------------------------------------------------------------
PURT_TOLAT      MVTLISQDMSEFALHVRAILGLPIGKITQYGPAASAVVLREGNSTDIYGNLPAALAQIPGAQLRLFGKPE
PURT_RALEH      MVTMATQWQNEFELHARAILGLPVDT--TLRSPGASAVIYGGVDAQVFDGVDQALS-VPQTEVRLFGKES
PURT_HAHCH      LVTLVSQNLSEFALHARALLGLPVPLIKQTGASASVALLVEGDSSRVCFSSLEAALCHPEVQLRLFGKEV
CARB_LACRJ      ----------------------------------------------------------------------
CARB_LACRD      ----------------------------------------------------------------------
PURT_VIBCM      MVTLISQELSEFALHVRAFTGLPIGQIVQYGPSASAAILGQGQSQNIQFNGLDDALSIPHTQVRLFGKPD
PURT_VIBCH      MVTLISQELSEFALHVRAFTGLPIGQIVQYGPSASAAILGQGQSQNIQFNGLDDALSIPHTQVRLFGKPD
PURT_RHOSR      LVTLRTQRLSEFELHARAILGLPVDT--TLTTPGASAVIYGGVDATGFDGVADAMA-VPETDLRLFGKES
PURT_RALME      MVTMITQWQNEFELHARAILGLPV-STALRAP-GASAVIYGGVEAEVFDG-VDEALRVPQTELRLFGKES
PURT_PSEU2      LVTLISQDLSQFALHARAILGLPIPLIRQFGPSASAVILVEGQSTQTAFANLGAALAEPDTALRLFGKEV
PURT_PSESM      LVTLISQDLSQFALHARAILGLPIPLIRQFGPSASAVILVEGQSTQTAFANLGAALAEPDTALRLFGKEV
PURT_PSEPK      LVTLISQDLSQFALHARAILGLPIPVVRQFGPSASAVILPEGQSQQTSFANLGAALSEPDTAIRLFGKEI
PURT_PSEFS      LVTLISQDLSQFALHARAILGLPIPLIRQFGPSASAVILVEGQSTQTAFANLGAALSEPDTALRLFGKEV
PURT_PSE14      LVTLISQDLSQFALHARAILGLPIPLIRQFGPSASAVILVEGQSTQTAFANLGAALAEPDTALRLFGKEV
PURT_PHOPR      MVTLISQDLSEFALHVRAFLGLPIQQIIQYGPAASAVILGNGISSNIFDNLTAALSR-PQTQVRLFGKEI
PURT_DESVM      LVTLISQNLSEFALHARAILGLPVPALRQNGPAASCVVLAEGDSMSPGYHGIEAALAEPDTGLCLFGKEV
PURT_CUPTR      MVTMATQWQNEFELHARAILGLPVDT--TLRSPGASAVIYGGVEAQVFDG-VDQALRVPQTEVRLFGKES
PURT_XANOP      LVTLVSQELSEFALHARAILGLPVGAEGQSGPSASCALLAHGNGVPVFDNVADAL-RDPDTALRLFGKPR
PURT_PSEPW      LVTLISQDLSQFALHARAILGLPIPVVRQFGPSASAVILPEGQSQQTSFANLGAALSEPDTAIRLFGKEI
PURT_PSEPG      LVTLISQDLSQFALHARAILGLPIPVVRQFGPSASAVILPEGQSQQTSFANLGAALSEPDTAIRLFGKEI
PURT_PSEPF      LVTLISQDLSQFALHARAILGLPVPLIRQFGPSASAVILVEGQSTQTAFANLGAALSEPDTALRLFGKEV
PURT_BACSU      LVTLVTQNLSEFALHVRAILGFPITEITQLSP--------------------------------------
CARB_BACCN      ----------------------------------------------------------------------
CARB_BACC2      ----------------------------------------------------------------------
PURT_WOLSU      MVTLITQNFSEFALHLRAVLGAPLHVERISA---------------------------------------
PURT_PSEF5      LVTLISQDLSQFALHARAILGLPIPLIRQFGPSASAVILVEGTSTQTAFANLGAALSEPDTALRLFGKEV
PURT_PSEE4      LVTLISQELSQFALHARAILGLPIPVVRQFGPSASAVILPEGQSQQTSFANLGAALSEPDTAIRLFGKEI
PURT_PSEAE      LVTLISQDLSEFALHARAILGLPIPVIRQLGPSASAVILVEGKSRQVAFANLGAALSEADTALRLFGKEV
PURT_PSEAB      LVTLISQDLSEFALHARAILGLPIPVIRQLGPSASAVILVEGKSRQVAFANLGAALSEADTALRLFGKEV
PURT_PSEA8      LVTLISQDLSEFALHARAILGLPIPVIRQLGPSASAVILVEGKSRQVAFANLGAALSEADTALRLFGKEV
CARB_TRICU      ----------------------------------------------------------------------
CARB_CLOB8      ----------------------------------------------------------------------
CARB_BACWK      ----------------------------------------------------------------------
PURT_XANOR      LVTLVSQELSEFALHARAILGLPVGAEGQSGPSASCALLAHGNGVPVFDNVADAL-RDPNTALRLFGKPR
PURT_XANOM      LVTLVSQELSEFALHARAILGLPVGAEGQSGPSASCALLAHGNGVPVFDNVADAL-RDPNTALRLFGKPR
PURT_VIBF1      LVTLISQEMSEFALHVRAFTGMPINQVTQYGPSASSVILGQGTSTNIRFDGLTEALSQPQTQIKLFGKPE
PURT_SHIFL      MVTLISQDLSEFALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVFDNVQNAVGAD--LQIRLFGKEI
PURT_SHIF8      MVTLISQDLSEFALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVFDNVQNAVGAD--LQIRLFGKEI
CARB_PELTS      ----------------------------------------------------------------------
CARB_BACST      ----------------------------------------------------------------------
PYC_HUMAN       ----------------------------------------------------------------------
PYC_BOVIN       ----------------------------------------------------------------------
PURT_SHIBS      MVTLISQDLSEFALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVFDNVQNAVGAD--LQIRLFGKEI
PURT_SHIB3      MVTLISQDLSEFALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVFDNVQNAVGAD--LQIRLFGKEI
PYR1_EMENI      ----------------------------------------------------------------------
PURT_WIGBR      MVTLISQNLSEFALHVRSFLKLPIGKIRQYGP--------------------------------------
PURT_SODGM      MVTLISQDLSEFALHVRAFLGLPIGTIRQYGP--------------------------------------
PURT_SHISS      MVTLISQDLSEFALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVFDNVQNAVGAD--LQIRLFGKEI
PURT_SHIDS      MVTLISQDLSEFALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVFDNVQNAVGAD--LQIRLFGKEI
PURT_ECOUT      MVTLISQDLSEFALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVFDNVQNAVGAD--LQIRLFGKEI
PURT_ECOLI      MVTLISQDLSEFALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVFDNVQNAVGAD--LQIRLFGKEI
PURT_ECOL5      MVTLISQDLSEFALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVFDNVQNAVGAD--LQIRLFGKEI
PURT_ECOK1      MVTLISQDLSEFALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVFDNVQNAVGAD--LQIRLFGKEI
PURT_ECODH      MVTLISQDLSEFALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVFDNVQNAVGAD--LQIRLFGKEI
PURT_ECOBW      MVTLISQDLSEFALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVFDNVQNAVGAD--LQIRLFGKEI
PURT_ECO57      MVTLISQDLSEFALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVFDNVQNAVGAD--LQIRLFGKEI
CARB_GEMAT      ----------------------------------------------------------------------
CARB_BACC3      ----------------------------------------------------------------------
CARB_BACC0      ----------------------------------------------------------------------
CARB_BACAN      ----------------------------------------------------------------------
CARB_BACAH      ----------------------------------------------------------------------
CARB_BACAC      ----------------------------------------------------------------------
CARB_BACAA      ----------------------------------------------------------------------
PYC1_CAEEL      ----------------------------------------------------------------------
PURT_MYCS2      MVTMVTQWQNEFELHARAILGLPVDT--TLRAPGASAVIYGGVDATVFDG-VDAALQVPHTDIRLFGKES
PURT_METCA      MVTMVSQAQNEFELHVRAILGLPVDS--SLRRPGASAVIYGGAEGIAFEGLERALA-VPESEVRLFGKEA
PURT_EDWI9      LVTLVSQDLSEFALHVRAFLGLPIGVIRQFGPCASAVLLPSLHSDDVTFANLSQALR-PATQLRLFGKPH
CARY_BACST      ----------------------------------------------------------------------
CARB_SYMTH      ----------------------------------------------------------------------
CARB_LISW6      ----------------------------------------------------------------------
CARB_BACC1      ----------------------------------------------------------------------
PYR1_YEAST      ----------------------------------------------------------------------
PYR1_SCHPO      ----------------------------------------------------------------------
PURT_SHEAM      MVTLISQDLSEFALHVRAILGLPVGTIVQRGPSASAVILVEGESSNIGYSGLAEALAQPNTQLRLFAK--
PURT_PARD8      MVTMITQDLSQFALHARAVLGLPIPNIVFHGAGASRAVVVEGDSDRLSLGNLDKVLEQPDTQMRFFGKEV
PURT_KLEP3      MVTLISQDLSEFALHVRAFLGLPVGAIRQYGP--------------------------------------
CARB_SULTO      ----------------------------------------------------------------------
CARB_STRS7      ----------------------------------------------------------------------
CARB_STRCO      ----------------------------------------------------------------------
CARB_STAS1      ----------------------------------------------------------------------
CARB_STAHJ      ----------------------------------------------------------------------
CARB_LISMO      ----------------------------------------------------------------------
CARB_LISMH      ----------------------------------------------------------------------
CARB_LISMF      ----------------------------------------------------------------------
CARB_LISMC      ----------------------------------------------------------------------
CARB_LISIN      ----------------------------------------------------------------------
CARB_DESAP      ----------------------------------------------------------------------
CARB_BACHK      ----------------------------------------------------------------------
PYC_RAT         ----------------------------------------------------------------------
PYC_MOUSE       ----------------------------------------------------------------------
PURT_ENTS8      MVTLISQDLSEFALHVRAFLGLPVGGIRQYGP--------------------------------------
CARB_XANCP      ----------------------------------------------------------------------
CARB_SULIY      ----------------------------------------------------------------------
CARB_SULIN      ----------------------------------------------------------------------
CARB_SULIM      ----------------------------------------------------------------------
CARB_SULIL      ----------------------------------------------------------------------
CARB_SULIK      ----------------------------------------------------------------------
CARB_SULIA      ----------------------------------------------------------------------
CARB_STRSV      ----------------------------------------------------------------------
CARB_STRGG      ----------------------------------------------------------------------
CARB_HYPBU      ----------------------------------------------------------------------
CARB_BACCZ      ----------------------------------------------------------------------
CARB_BACCQ      ----------------------------------------------------------------------
CARB_BACC7      ----------------------------------------------------------------------
PURT_THISH      LVTLATQWQSEFELHARAILGLPVDT-RLRNP-GASAVIYGGVEAQAFENVDQALA-VPGTDIRLFGKEA
CARB_SULSO      ----------------------------------------------------------------------
CARB_LACPL      ----------------------------------------------------------------------
CARB_BACCR      ----------------------------------------------------------------------
CARB_BACC4      ----------------------------------------------------------------------
PURT_SULSO      LVTLASSDINEFQIHVRSAIGLPTPEVKLVSPHVILAQTENVWGPKFLN--IEKAMEIPGVQVRLFGKPV
PURT_PROM1      LVTLISQNLNEFELHLRAVLGIPI----------------------------------------------
PURT_ACIBT      LVTLASQFQSEFELHARAILGLPVNTARSVAASAVIYAGVDANNLSYSN--LNVALAHPDTDLRLFGK--
CARB_YEAST      ----------------------------------------------------------------------
CARB_STRE4      ----------------------------------------------------------------------
CARB_STACT      ----------------------------------------------------------------------
CARB_STAAW      ----------------------------------------------------------------------
CARB_STAAT      ----------------------------------------------------------------------
CARB_STAAS      ----------------------------------------------------------------------
CARB_STAAR      ----------------------------------------------------------------------
CARB_STAAN      ----------------------------------------------------------------------
CARB_STAAM      ----------------------------------------------------------------------
CARB_STAAE      ----------------------------------------------------------------------
CARB_STAAC      ----------------------------------------------------------------------
CARB_STAA9      ----------------------------------------------------------------------
CARB_STAA8      ----------------------------------------------------------------------
CARB_STAA3      ----------------------------------------------------------------------
CARB_STAA2      ----------------------------------------------------------------------
CARB_STAA1      ----------------------------------------------------------------------
CARB_NATTJ      ----------------------------------------------------------------------
PURT_YERE8      MVTLISQNMSEFALHVRAFLGLPIGTIR------------------------------------------
PURT_VARPS      MVTMATQWQNEFELHARAILGLPV----------------------------------------------
PURT_SHESA      LVTLISQDLSEFALHVRAILGLPIPNIHQHGPSASAVVLVEGKSKNI-----------------------
PURT_PROMT      LVTLISQNLNEFELHLRAVLGIPI----------------------------------------------
PURT_PECCP      MVTMISQDLSEFALHVRAFLGLPIGAVR------------------------------------------
PURT_ERWCT      MVTMISQDLSEFALHVRAFLGLPIGAVR------------------------------------------
PURT_ACIAD      LVTLASQFQSEFELHARAILGLPVNTTRHSVAASAVIYAGVDADNLSFSQLNQALAH-PETDLRLFGK--
CARB_STRGC      ----------------------------------------------------------------------
PURT_SHESM      LVTLISQDLSEFALHVRAILGLPIPNIHQHGPSASAVVLVEGKSKNI-----------------------
PURT_BURVG      LVTLASQRQSEFELHARAILGLPLGSPAASA---------------------------------------
PURT_BURCM      LVTLASQRQSEFELHARAILGLPLGSPAASA---------------------------------------
CARB_XANAC      ----------------------------------------------------------------------
CARB_MACCJ      ----------------------------------------------------------------------
CARB1_METJA     ----------------------------------------------------------------------
Y4RH_RHISN      ----------------------------------------------------------------------
PURT_SHESR      LVTLISQDLSEFALHVRAILGLPIPNIHQHGPSASAVVLVEGKSKNI-----------------------
PURT_ALCBS      LVTLISQTLSEFALHARAILGLPIPTIEQRGASASSVLLIQGQSEAMRYHGLNTALANADTEVRLFGKDI
CARB_XYLFA      ----------------------------------------------------------------------
CARB_THET8      ----------------------------------------------------------------------
PURT_SHEON      LVTLISQDLSEFALHVRAILGLPIPNIHQHGPSASAVVLVEGKSKNIRYQGLAAALAAENTQLRLFAKPE
PURT_SHEFN      LVTLISQDLSEFALHVRAILGLPISNIVQHGPSASAVILAEGTSTNIRYQGMAAALAPADTQLRLFGKPD
PURT_BURTA      LVTLASQRQSEFELHARAILGLPV-EPALATP-AASAVIYGGLD--------------------------
PURT_BURS3      LVTLASQRQSEFELHARAILGLPLGTPAASA---------------------------------------
PURT_BURPS      LVTLASQRQSEFELHARAILGLPV-EPALATP-AASAVIYGGLD--------------------------
PURT_BURP6      LVTLASQRQSEFELHARAILGLPV-EPALATP-AASAVIYGGLD--------------------------
PURT_BURP1      LVTLASQRQSEFELHARAILGLPV-EPALATP-AASAVIYGGLD--------------------------
PURT_BURP0      LVTLASQRQSEFELHARAILGLPV-EPALATP-AASAVIYGGLD--------------------------
PURT_BURMS      LVTLASQRQSEFELHARAILGLPV-EPALATP-AASAVIYGGLD--------------------------
PURT_BURMA      LVTLASQRQSEFELHARAILGLPV-EPALATP-AASAVIYGGLD--------------------------
PURT_BURM9      LVTLASQRQSEFELHARAILGLPV-EPALATP-AASAVIYGGLD--------------------------
PURT_BURM7      LVTLASQRQSEFELHARAILGLPV-EPALATP-AASAVIYGGLD--------------------------
PURT_BORPE      MVTLISQVQNEFELHARALLGLPVDT-RLRQP-GASSVIYGGVDARAFEGVAQALA-EPGTDIRLFGKES
CARB_XYLFT      ----------------------------------------------------------------------
CARB_STAAB      ----------------------------------------------------------------------
CARB_MYCGI      ----------------------------------------------------------------------
CARB_CLOBL      ----------------------------------------------------------------------
PYR1_DROME      ----------------------------------------------------------------------
PURT_VIBVY      LVTLISQEMSEFALHVRAFTGMPVNKIVQYGPSASAVILGNGQSENLRFDGMSDALEQPQTQLRLFGK--
PURT_VIBVU      LVTLISQEMSEFALHVRAFTGMPVNKIVQYGPSASAVILGNGQSENLRFDGMSDALEQPQTQLRLFGK--
PURT_COREF      LVTLATQRFSEFELHAKAVLGLPVDV--TLTSPGASAVIYGGVDPGVSYAGLAEALAVAETDVRLFGKEA
PURT_BURCH      LVTLASQRQSEFELHARAILGLPLGTPAASA---------------------------------------
PURT_BURCA      LVTLASQRQSEFELHARAILGLPLGTPAASA---------------------------------------
CARB_PYRFU      ----------------------------------------------------------------------
CARB_PEDPA      ----------------------------------------------------------------------
CARB_MYCLE      ----------------------------------------------------------------------
CARB_METHJ      ----------------------------------------------------------------------
CARB_ACIC5      ----------------------------------------------------------------------
CARB_ACIBL      ----------------------------------------------------------------------
PURT_VIBPA      MVTMISQEMSEFALHVRAFTGMPINKIVQYGPSASAVILGQGTSTDIFDNLAKALAQ-PQTQVRLFGK--
CPSM_RAT        ----------------------------------------------------------------------
CARB_STRA5      ----------------------------------------------------------------------
CARB_STRA3      ----------------------------------------------------------------------
CARB_STRA1      ----------------------------------------------------------------------
CARB_MYCVP      ----------------------------------------------------------------------
CARB_MYCTU      ----------------------------------------------------------------------
CARB_MYCBO      ----------------------------------------------------------------------
CARB_METPE      ----------------------------------------------------------------------
CARB_EXIS2      ----------------------------------------------------------------------
PYR1_MESAU      ----------------------------------------------------------------------
PURT_YERPY      MVTLISQNMSEFALHVRAFLGLPIGTIRQYGAAASAVILPELTSQNITYRGLET-ALIGDTQIRLFGKEI
PURT_YERPS      MVTLISQNMSEFALHVRAFLGLPIGTIRQYGAAASAVILPELTSQNITYRGLET-ALIGDTQIRLFGKEI
PURT_YERPP      MVTLISQNMSEFALHVRAFLGLPIGTIRQYGAAASAVILPELTSQNITYRGLET-ALIGDTQIRLFGKEI
PURT_YERPN      MVTLISQNMSEFALHVRAFLGLPIGTIRQYGAAASAVILPELTSQNITYRGLET-ALIGDTQIRLFGKEI
PURT_YERPG      MVTLISQNMSEFALHVRAFLGLPIGTIRQYGAAASAVILPELTSQNITYRGLET-ALIGDTQIRLFGKEI
PURT_YERPE      MVTLISQNMSEFALHVRAFLGLPIGTIRQYGAAASAVILPELTSQNITYRGLET-ALIGDTQIRLFGKEI
PURT_YERPB      MVTLISQNMSEFALHVRAFLGLPIGTIRQYGAAASAVILPELTSQNITYRGLET-ALIGDTQIRLFGKEI
PURT_YERPA      MVTLISQNMSEFALHVRAFLGLPIGTIRQYGAAASAVILPELTSQNITYRGLET-ALIGDTQIRLFGKEI
PURT_LEPCP      MVTMITQWQNEFELHARAILGLPVST--ALKSPGASAVIYGGVDPGVVYDGVDEALRVPNSEIRLFGK--
CPSM_MOUSE      ----------------------------------------------------------------------
CARB_THET2      ----------------------------------------------------------------------
CARB_STRTD      ----------------------------------------------------------------------
CARB_STRT2      ----------------------------------------------------------------------
CARB_STRT1      ----------------------------------------------------------------------
CARB_STRAW      ----------------------------------------------------------------------
CARB_RUBXD      ----------------------------------------------------------------------
CARB_METTP      ----------------------------------------------------------------------
CARB_DEIGD      ----------------------------------------------------------------------
PYR1_HUMAN      ----------------------------------------------------------------------
PURT_VIBHB      MVTMISQEMSEFTLHVHAFTGMPINNIVQYGPSASAVILGQGTSTDIFDNLSKAMAQ-PQTQVRLFGK--
PURT_SHESW      LVTLISQDLSEFALHVRAILGLPIPNIHQHGPSASAVILAEGTSSNIRYQGIGAALEAVNTQLRLFAKPD
PURT_RHOFD      LVTLTTQWQSEFELHARAILGLPVNT--------------------------------------------
PURT_PROMH      LVTLISQDLSEFALHVRAFLGYPIGGIR------------------------------------------
MCCA_DICDI      ----------------------------------------------------------------------
CARB_STRMU      ----------------------------------------------------------------------
CARB_CLOAB      ----------------------------------------------------------------------
PURT_MYCA9      MVTMITQWQNEFELHARAILGLPVDT--TLKSAGASAVIYGGVEAQVFDG-VDEALRVPRTELRLFGK--
PURT_BORPA      MVTLISQVQNEFELHARALLGLPVDT-RLRQP-GASSVIYGGVEARAFEGVAQALA-EPGTDIRLFGKES
PURT_BORBR      MVTLISQVQNEFELHARALLGLPVDT-RLRQP-GASSVIYGGVEARAFEGVAQALA-EPGTDIRLFGKES
CARB_METLZ      ----------------------------------------------------------------------
CARB_FUSNN      ----------------------------------------------------------------------
CARB_BACHD      ----------------------------------------------------------------------
ACCC_BACHD      ----------------------------------------------------------------------
PURT_SHEPC      LVTLISQDLSEFALHVRAILGLPIPNIHQHGPSASAVILAEGTSSNIRYQGIGAALEAVNTQLRLFAKPD
PURT_SHEB5      LVTLISQDLSEFALHVRAILGLPIPNIHQHGPSASAVILAEGTSSNIRYQGIAAALEAVNTQLRLFAKPD
PURT_POLSJ      MVTMCTQWQNEFELHARAILGLPVNT--ALKSSGASAVIYGGVDAKVFDGVADAL-RVPNTDIRLFGK--
PURT_CORGL      LVTLATQRFSEFELHAKAILGLPV----------------------------------------------
PURT_CORGB      LVTLATQRFSEFELHAKAILGLPV----------------------------------------------
MCCA_ARATH      ----------------------------------------------------------------------
CARB_MYCSS      ----------------------------------------------------------------------
CARB_MYCSK      ----------------------------------------------------------------------
CARB_MYCSJ      ----------------------------------------------------------------------
CARB_LEUMM      ----------------------------------------------------------------------
CARB_LACSS      ----------------------------------------------------------------------
PURT_BORA1      MVTMITQVQNEFELHARALLGLPVDTARQPGASSVIYGGLDGRGV-TFHGVAQALA-EPGTDVRLFGKEA
PURT_ACIAC      LVTLATQHQSEFELHARAILGLPV----------------------------------------------
MPTN_METAC      ----------------------------------------------------------------------
CARB_STRPZ      ----------------------------------------------------------------------
CARB_STRPG      ----------------------------------------------------------------------
CARB_STRP8      ----------------------------------------------------------------------
CARB_STRP6      ----------------------------------------------------------------------
CARB_STRP3      ----------------------------------------------------------------------
CARB_STRP1      ----------------------------------------------------------------------
CARB_METMJ      ----------------------------------------------------------------------
CARB_LACS1      ----------------------------------------------------------------------
CARB_LACJO      ----------------------------------------------------------------------
CARB_HALER      ----------------------------------------------------------------------
CARB_BEUC1      ----------------------------------------------------------------------
PURT_SULTO      LVTMASLDINEFQIHVRSALGLPTPEVKIVSPHVILAN-NEGWAPKFLN--VEKALQIPGVQIRLFGKST
PURT_PSYIN      LVTLVSQDASEFALHVRAILGFPIG---------------------------------------------
PURT_METFK      MVTMGSQRFSEFDLHARAILGLPVNV--ALSRPGASAVIYGGLDSSVFEGVEQALA-VPESDIRLFGKES
PURT_DECAR      LVTLCSQRFSEFELHARAILGLPV----------------------------------------------
CPSM_RANCA      ----------------------------------------------------------------------
CARB_THETN      ----------------------------------------------------------------------
CARB_THENN      ----------------------------------------------------------------------
CARB_SULAC      ----------------------------------------------------------------------
PURT_THIDA      MVTLATQRQNEFELHARAILGLPV----------------------------------------------
PURT_POLNA      MVTLCTQWQNEFELHARAILGLPV----------------------------------------------
MPTN_METMA      ----------------------------------------------------------------------
CARB_MYXXD      ----------------------------------------------------------------------
CARB_LACLA      ----------------------------------------------------------------------
CARB_LACAC      ----------------------------------------------------------------------
CARB_HALOH      ----------------------------------------------------------------------
CARB_YERPE      ----------------------------------------------------------------------
CARB_EXISA      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RPGRKIGHVTVVGDDPxxxxxxxxxxxxxxxxxxx
PURK_MYCTU      RPGRKVGHINFLGSD--------------------
PURK_MYCBO      RPGRKVGHINFLGSD--------------------
PURK_CORAM      AQGRKIGHVNLTGED--------------------
PURK_MYCLE      RPGRKVGHINFRGTD--------------------
PURK_SYNE7      KPGRKLGHITL------------------------
PUR6_DEBOC      RPNRKMGHINIV-----------------------
PUR6_YEAST      RPNRKVGHINII-----------------------
PUR6_PICME      RPGRKMGHINIV-----------------------
PUR6_CANGA      KPNRKVGHINIV-----------------------
PURK_BACSU      KKGRKMGHIT-------------------------
PUR6_SCHPO      RKGRKMGHVTIISDSP-------------------
PURK_VIBVY      RAGRKMGHINVCGD---------------------
PURK_VIBVU      RAGRKMGHINVCGD---------------------
PURK_SYNY3      RPGRKLGHVTLLNPD--------------------
PURK_VIBCH      RSGRKMGHINVTAD---------------------
PUR6_CANAL      RPERKMGHINVV-----------------------
PURK_VIBF1      RAGRKMGHINVCADSP-------------------
PURK_PSEAE      KNGRKVGHATL------------------------
PURK_VIBPA      REGRKMGHINVCGDYP-------------------
PUR6_CRYNE      RKARKMGHITVTAE---------------------
PURK_BRUME      RAGRKIGHVT-------------------------
PUR6_CRYNV      RKARKMGHITVTAE---------------------
PUR6_VIGAC      RKQRKMCHITIVG----------------------
PURK_AQUAE      KPRRKVGHV--------------------------
PURK_STAS1      RKNRKMGHLTVLTND--------------------
PURK_STAES      KPDRKMGHMTLLTDD--------------------
PURK_STAEQ      KPDRKMGHMTLLTDD--------------------
PURK_STAHJ      KPNRKMGHMTIL-----------------------
PURK_HAEIN      RIGRKVGHINL------------------------
PURK_ECOLI      RPGRKVGHLNLTDSD--------------------
PURK_STAAW      KDSRKMGHMTVLTND--------------------
PURK_STAAS      KDSRKMGHMTVLTND--------------------
PURK_STAAC      KDSRKMGHMTVLTND--------------------
PURK_STAAR      KDSRKMGHMTVLTND--------------------
PURK_STAAN      RDSRKMGHMTVLTND--------------------
PURK_STAAM      RDSRKMGHMTVLTND--------------------
PURK_SULSO      RKRRKMGHVNVVGNN--------------------
PURT_PELPD      RPGRRMGVALVQGKD--------------------
PURT_SYNS3      RPGRRMG----------------------------
PURT_PELCD      RPGRRMGVALVVAPD--------------------
PURT_BACV8      -----------------------------------
PURT_METM7      KVGRRMGVALAVSDD--------------------
PURT_METMP      KVGRRMGVALAVSDD--------------------
PURT_SYNY3      -----------------------------------
PURT_BACTN      RVNRRMGVV--------------------------
PURT_SYNPW      RPGRRMGVALARGE---------------------
PURT_SULAC      TYNRRMGIVLATGN---------------------
PURT_METVS      -----------------------------------
PURT_SYNS9      RPNRRMGVALARGED--------------------
PURT_CHLTE      RPYRRMGVALMSGE---------------------
PURT_METM5      KVGRRMGVALAVSDN--------------------
PURT_META3      KVGRRMG----------------------------
PURT_GEOMG      RPGRRMGVALSFGAD--------------------
PURT_PROMA      KKGRRMG----------------------------
PURT_NITSB      -----------------------------------
PURT_METJA      KVGRRMGVALAYAD---------------------
PURT_SYNPX      RPGRRMGVALARGE---------------------
PURT_CHLPD      RPYRRMG-VTLAYDEP-------------------
PURT_PROMM      RPGRRMG----------------------------
PURT_ANAVT      HPYRRMG----------------------------
PURT_PASMU      DGHRRMG----------------------------
PURT_LEPBL      RPYRRMG----------------------------
PURT_LEPBJ      RPYRRMG----------------------------
PURT_DESMR      HGTRRLGVALALGRD--------------------
PURT_THICR      IAGRRRMGVALARD---------------------
PURT_SYNSC      RPGRRMG----------------------------
PURT_BACFN      -----------------------------------
PURT_DESVV      HGRRRMGVALALGDD--------------------
PURT_DESVH      HGRRRMGVALALGDD--------------------
PURT_ANASP      HPYRRMG----------------------------
PURT_ANADE      RPHRRMGVALVPGDDP-------------------
PURT_HAES1      NGHRRLG----------------------------
PURT_AZOSB      KGQRRMG----------------------------
PURT_FLAPJ      -----------------------------------
PURT_ERYLH      RPYRRMGVALATGGD--------------------
PURT_BIFLO      HGHRRMAVALAVGE---------------------
PURT_SALAR      DGARRLGVALATGEN--------------------
PURT_PROM3      RPRRRMG----------------------------
PURT_BACFR      -----------------------------------
PURT_AERHH      -----------------------------------
PURT_DESDG      QGRRRMGVALALGE---------------------
PURT_MANSM      DGHRRMG----------------------------
PURT_FRATW      HGKRRMGVV--------------------------
PURT_FRATT      HGKRRMGVV--------------------------
PURT_FRATN      HGKRRMGVV--------------------------
PURT_FRAT1      HGKRRMGVV--------------------------
PURT_CORJK      -----------------------------------
PURT_BACA2      -----------------------------------
PURT_SYNR3      RPMRRMG----------------------------
PURT_PSEU5      VSGQRRMGVALARD---------------------
PURT_HALWD      YPGRRMGAAVATAID--------------------
PURT_SYNP6      RPQRRMG----------------------------
PURT_SYNE7      RPQRRMG----------------------------
PURT_PYRFU      YPGRRLGVV--------------------------
PURT_BURXL      -----------------------------------
PURT_SULNB      -----------------------------------
PURT_AERS4      -----------------------------------
CARB_LYSSC      -----------------------------------
PURT_SULDN      -----------------------------------
PURT_PROMP      KKGRRMGVVLSTDDD--------------------
PURT_FRATO      HGKRRMGVV--------------------------
PURT_FRATH      HGKRRMGVV--------------------------
PURT_FRATF      HGKRRMGVV--------------------------
PURT_ACTPJ      NGHRRLG----------------------------
PURT_XANC5      VDGHRRVGVTLARAD--------------------
PURT_SALPC      DGTRRLGVALATGEN--------------------
PURT_SALCH      DGTRRLGVALATGEN--------------------
PURT_MARAV      QGRRRMGVALALG----------------------
PURT_HAEDU      NGHRRLG----------------------------
PURT_XANCP      DGHRRVG----------------------------
PURT_XANCB      DGHRRVG----------------------------
PURT_XANC8      DGHRRVG----------------------------
PURT_STRM5      HGHRRV