[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ56592.1

[Show Plain Result]


## Summary of Sequence Search
    1::460
   10::465     2e-65  35%  470 aa  DLDH1_BACSU RecName: Full=Dihydrolipoyl dehydrogenase;       
    8::447     2e-64  32%  461 aa  DLDH_CHLPN RecName: Full=Dihydrolipoyl dehydrogenase;       
    7::455     3e-64  34%  466 aa  DLDH_ZYMMO RecName: Full=Dihydrolipoyl dehydrogenase;       
   10::466     2e-63  35%  475 aa  DLDH_HALVO RecName: Full=Dihydrolipoyl dehydrogenase;       
    8::450     3e-63  33%  465 aa  DLDH_CHLTR RecName: Full=Dihydrolipoyl dehydrogenase;       
    8::450     3e-63  33%  465 aa  DLDH_CHLMU RecName: Full=Dihydrolipoyl dehydrogenase;       
   28::457     7e-63  34%  470 aa  DLDH1_BACST RecName: Full=Dihydrolipoyl dehydrogenase;       
   10::464     1e-61  33%  468 aa  DLDH_STAAW RecName: Full=Dihydrolipoyl dehydrogenase;       
   10::464     1e-61  33%  468 aa  DLDH_STAAU RecName: Full=Dihydrolipoyl dehydrogenase;       
   10::464     1e-61  33%  468 aa  DLDH_STAAS RecName: Full=Dihydrolipoyl dehydrogenase;       
   10::464     1e-61  33%  468 aa  DLDH_STAAR RecName: Full=Dihydrolipoyl dehydrogenase;       
   10::464     1e-61  33%  468 aa  DLDH_STAAN RecName: Full=Dihydrolipoyl dehydrogenase;       
   10::464     1e-61  33%  468 aa  DLDH_STAAM RecName: Full=Dihydrolipoyl dehydrogenase;       
   10::464     1e-61  33%  468 aa  DLDH_STAAC RecName: Full=Dihydrolipoyl dehydrogenase;       
   13::466     6e-60  33%  469 aa  DLDH_CHLP8 RecName: Full=Dihydrolipoyl dehydrogenase;       
   13::466     1e-59  34%  469 aa  DLDH_CHLTE RecName: Full=Dihydrolipoyl dehydrogenase;       
   10::454     1e-59  33%  472 aa  DLDH2_HALMA RecName: Full=Dihydrolipoyl dehydrogenase 2;       
    6::451     2e-57  33%  461 aa  DLDH_THESC RecName: Full=Dihydrolipoyl dehydrogenase;       
    7::457     8e-57  32%  467 aa  DLDH3_PSEAE RecName: Full=Dihydrolipoyl dehydrogenase 3;       
    6::459     2e-56  33%  466 aa  DLDH3_PSEPU RecName: Full=Dihydrolipoyl dehydrogenase 3;       
   44::497     4e-56  33%  509 aa  DLDH_PIG RecName: Full=Dihydrolipoyl dehydrogenase, mitochondrial; 
   44::497     5e-56  33%  509 aa  DLDH_CANFA RecName: Full=Dihydrolipoyl dehydrogenase,
   44::506     1e-55  33%  509 aa  DLDH_MOUSE RecName: Full=Dihydrolipoyl dehydrogenase,
   44::506     1e-55  33%  509 aa  DLDH_CRIGR RecName: Full=Dihydrolipoyl dehydrogenase,
   44::506     1e-55  33%  509 aa  DLDH_RAT RecName: Full=Dihydrolipoyl dehydrogenase, mitochondrial; 
   44::497     2e-55  33%  509 aa  DLDH_MACFA RecName: Full=Dihydrolipoyl dehydrogenase,
   44::497     3e-55  33%  509 aa  DLDH_HUMAN RecName: Full=Dihydrolipoyl dehydrogenase,
    7::444     4e-55  31%  477 aa  DLDH_AZOVI RecName: Full=Dihydrolipoyl dehydrogenase;       
   44::497     6e-55  33%  509 aa  DLDH_PONAB RecName: Full=Dihydrolipoyl dehydrogenase,
    7::464     3e-54  30%  474 aa  DLDH2_BACSU RecName: Full=Dihydrolipoyl dehydrogenase;       
    7::454     8e-54  34%  464 aa  DLDH1_PSEAE RecName: Full=Dihydrolipoyl dehydrogenase;       
    7::462     4e-53  31%  478 aa  DLDH_PSEFL RecName: Full=Dihydrolipoyl dehydrogenase;       
    7::462     5e-53  31%  478 aa  DLDH2_PSEAE RecName: Full=Dihydrolipoamide dehydrogenase;       
    7::468     9e-53  32%  478 aa  DLDH2_PSEPU RecName: Full=Dihydrolipoamide dehydrogenase;       
    7::456     2e-51  31%  474 aa  DLDH_SHIFL RecName: Full=Dihydrolipoyl dehydrogenase;       
   50::499     2e-51  32%  511 aa  DLDH_SCHPO RecName: Full=Dihydrolipoyl dehydrogenase,
    7::456     2e-51  31%  474 aa  DLDH_ECOLI RecName: Full=Dihydrolipoyl dehydrogenase;       
    7::456     2e-51  31%  474 aa  DLDH_ECOL6 RecName: Full=Dihydrolipoyl dehydrogenase;       
    7::456     2e-51  31%  474 aa  DLDH_ECO57 RecName: Full=Dihydrolipoyl dehydrogenase;       
  108::532     3e-51  30%  547 aa  MERA_STAES RecName: Full=Mercuric reductase;       
  108::532     3e-51  30%  547 aa  MERA_STAAU RecName: Full=Mercuric reductase;       
   56::491     1e-50  30%  501 aa  DLDH_PEA RecName: Full=Dihydrolipoyl dehydrogenase, mitochondrial; 
   29::488     2e-50  32%  499 aa  DLDH_YEAST RecName: Full=Dihydrolipoyl dehydrogenase,
    9::450     2e-50  32%  459 aa  GSHR_ANASP RecName: Full=Glutathione reductase;       
   16::449     2e-50  32%  459 aa  DLDH1_PSEPU RecName: Full=Dihydrolipoyl dehydrogenase;       
    7::452     9e-50  30%  473 aa  DLDH_BUCAI RecName: Full=Dihydrolipoyl dehydrogenase;       
   10::467     1e-49  30%  477 aa  DLDH3_HALMA RecName: Full=Dihydrolipoyl dehydrogenase 3;       
    5::452     2e-49  28%  457 aa  DLDH_MYCPN RecName: Full=Dihydrolipoyl dehydrogenase;       
   28::461     2e-49  31%  474 aa  DLDH_HALSA RecName: Full=Dihydrolipoyl dehydrogenase;       
   33::494     3e-49  32%  497 aa  DLDH_MANSE RecName: Full=Dihydrolipoyl dehydrogenase;       
    6::457     8e-49  30%  468 aa  STHA_MYCTU RecName: Full=Probable soluble pyridine nucleotide
    6::457     8e-49  30%  468 aa  STHA_MYCTA RecName: Full=Soluble pyridine nucleotide
    6::457     8e-49  30%  468 aa  STHA_MYCBT RecName: Full=Soluble pyridine nucleotide
    6::457     8e-49  30%  468 aa  STHA_MYCBP RecName: Full=Soluble pyridine nucleotide
    6::457     8e-49  30%  468 aa  STHA_MYCBO RecName: Full=Probable soluble pyridine nucleotide
    8::463     3e-48  31%  475 aa  DLDH_BUCBP RecName: Full=Dihydrolipoyl dehydrogenase;       
   87::534     7e-48  31%  547 aa  MERA_THIFE RecName: Full=Mercuric reductase;       
    7::456     9e-48  31%  478 aa  DLDH_HAEIN RecName: Full=Dihydrolipoyl dehydrogenase;       
    7::457     2e-47  29%  476 aa  DLDH_BUCAP RecName: Full=Dihydrolipoyl dehydrogenase;       
  173::609     3e-47  30%  631 aa  MERA_BACCE RecName: Full=Mercuric reductase;       
   29::469     4e-47  31%  474 aa  DLDH_SYNY3 RecName: Full=Dihydrolipoyl dehydrogenase;       
   16::450     4e-47  31%  454 aa  DLDH_RHOCA RecName: Full=Dihydrolipoyl dehydrogenase;       
   10::439     6e-47  30%  449 aa  GSHR_BURCE RecName: Full=Glutathione reductase;       
    8::456     1e-46  30%  475 aa  DLDH_VIBCH RecName: Full=Dihydrolipoyl dehydrogenase;       
   20::464     2e-46  33%  489 aa  GSHRP_SPIOL RecName: Full=Glutathione reductase, chloroplastic;    
   62::497     5e-46  29%  507 aa  DLDH1_ARATH RecName: Full=Dihydrolipoyl dehydrogenase 1,
  121::548     6e-46  31%  561 aa  MERA_ENTAG RecName: Full=Mercuric reductase;       
    5::449     1e-45  28%  457 aa  DLDH_MYCGE RecName: Full=Dihydrolipoyl dehydrogenase;       
    8::456     2e-45  29%  475 aa  DLDH_VIBPA RecName: Full=Dihydrolipoyl dehydrogenase;       
  121::548     5e-45  32%  561 aa  MERA_PSEAE RecName: Full=Mercuric reductase;       
    6::458     5e-45  28%  464 aa  DLDH_MYCTU RecName: Full=Dihydrolipoyl dehydrogenase;       
    6::458     5e-45  28%  464 aa  DLDH_MYCBO RecName: Full=Dihydrolipoyl dehydrogenase;       
   47::464     7e-45  30%  474 aa  DLDH_RALEH RecName: Full=Dihydrolipoyl dehydrogenase;       
   23::441     9e-45  32%  450 aa  GSHR_STRTR RecName: Full=Glutathione reductase;       
   25::450     1e-44  28%  458 aa  DLDH3_BACSU RecName: Full=Dihydrolipoyl dehydrogenase;       
    6::461     4e-44  29%  467 aa  DLDH_MYCLE RecName: Full=Dihydrolipoyl dehydrogenase;       
   85::523     6e-44  32%  557 aa  GSHRP_TOBAC RecName: Full=Glutathione reductase, chloroplastic;    
   62::497     6e-44  29%  507 aa  DLDH2_ARATH RecName: Full=Dihydrolipoyl dehydrogenase 2,
    9::458     1e-43  27%  466 aa  STHA_COLP3 RecName: Full=Soluble pyridine nucleotide
   97::531     1e-43  30%  557 aa  MERA_SHEPU RecName: Full=Mercuric reductase;       
   72::509     1e-43  31%  544 aa  GSHRP_SOYBN RecName: Full=Glutathione reductase, chloroplastic;    
  108::535     5e-43  32%  548 aa  MERA_PSEFL RecName: Full=Mercuric reductase;       
   26::468     8e-43  32%  479 aa  DLDH_TRYBB RecName: Full=Dihydrolipoyl dehydrogenase;       
   30::474     1e-42  33%  499 aa  GSHRC_ARATH RecName: Full=Glutathione reductase, cytosolic;        
   29::457     2e-42  29%  465 aa  STHA_SERP5 RecName: Full=Soluble pyridine nucleotide
   28::457     4e-42  29%  465 aa  STHA_PHOLL RecName: Full=Soluble pyridine nucleotide
   33::477     9e-42  32%  502 aa  GSHRC_BRARP RecName: Full=Glutathione reductase, cytosolic;        
   29::458     1e-41  28%  466 aa  STHA_YERE8 RecName: Full=Soluble pyridine nucleotide
  111::461     1e-41  33%  474 aa  MERA_STRLI RecName: Full=Mercuric reductase;       
   38::438     1e-41  30%  451 aa  GSHR_PSEAE RecName: Full=Glutathione reductase;       
   79::517     2e-41  30%  552 aa  GSHRP_PEA RecName: Full=Glutathione reductase,
    8::457     4e-41  31%  463 aa  STHA_CHRSD RecName: Full=Soluble pyridine nucleotide
   93::531     4e-41  30%  565 aa  GSHRP_ARATH RecName: Full=Glutathione reductase, chloroplastic;    
    8::419     5e-41  30%  464 aa  STHA_PSEA7 RecName: Full=Soluble pyridine nucleotide
    8::419     6e-41  30%  464 aa  STHA_PSEAE RecName: Full=Soluble pyridine nucleotide
    8::419     6e-41  30%  464 aa  STHA_PSEAB RecName: Full=Soluble pyridine nucleotide
    8::419     6e-41  30%  464 aa  STHA_PSEA8 RecName: Full=Soluble pyridine nucleotide
    8::459     1e-40  30%  468 aa  GSHR_NEUCR RecName: Full=Glutathione reductase;       
   29::458     1e-40  29%  466 aa  STHA_YERPY RecName: Full=Soluble pyridine nucleotide
   29::458     1e-40  29%  466 aa  STHA_YERPS RecName: Full=Soluble pyridine nucleotide
   29::458     1e-40  29%  466 aa  STHA_YERPP RecName: Full=Soluble pyridine nucleotide
   29::458     1e-40  29%  466 aa  STHA_YERPN RecName: Full=Soluble pyridine nucleotide
   29::458     1e-40  29%  466 aa  STHA_YERPG RecName: Full=Soluble pyridine nucleotide
   29::458     1e-40  29%  466 aa  STHA_YERPE RecName: Full=Soluble pyridine nucleotide
   29::458     1e-40  29%  466 aa  STHA_YERPB RecName: Full=Soluble pyridine nucleotide
   29::458     1e-40  29%  466 aa  STHA_YERPA RecName: Full=Soluble pyridine nucleotide
   29::458     1e-40  29%  466 aa  STHA_YERP3 RecName: Full=Soluble pyridine nucleotide
   31::460     2e-40  28%  468 aa  STHA_ERWCT RecName: Full=Soluble pyridine nucleotide
  119::546     2e-40  33%  559 aa  MERA_ALCSP RecName: Full=Mercuric reductase;       
    7::463     4e-40  30%  492 aa  TYTR_TRYCO RecName: Full=Trypanothione reductase;         Short=TR;
   29::457     7e-40  28%  465 aa  STHA_SODGM RecName: Full=Soluble pyridine nucleotide
    9::458     9e-40  28%  466 aa  STHA_VIBSL RecName: Full=Soluble pyridine nucleotide
   29::473     9e-40  30%  498 aa  GSHRC_PEA RecName: Full=Glutathione reductase, cytosolic;       
   29::458     1e-39  28%  466 aa  STHA_ERWT9 RecName: Full=Soluble pyridine nucleotide
  121::548     2e-39  33%  561 aa  MERA_ACICA RecName: Full=Mercuric reductase;       
   28::457     3e-39  29%  465 aa  STHA_PROMH RecName: Full=Soluble pyridine nucleotide
    8::456     3e-39  30%  464 aa  STHA_AZOVI RecName: Full=Soluble pyridine nucleotide
    8::456     3e-39  30%  464 aa  STHA_AZOVD RecName: Full=Soluble pyridine nucleotide
    8::456     6e-39  30%  464 aa  STHA_HAHCH RecName: Full=Soluble pyridine nucleotide
   27::471     6e-39  29%  496 aa  GSHRC_ORYSJ RecName: Full=Glutathione reductase, cytosolic;        
   29::458     1e-38  28%  466 aa  STHA_ECO81 RecName: Full=Soluble pyridine nucleotide
   29::458     1e-38  28%  466 aa  STHA_SHIFL RecName: Full=Soluble pyridine nucleotide
   29::458     1e-38  28%  466 aa  STHA_SALG2 RecName: Full=Soluble pyridine nucleotide
    8::418     1e-38  33%  463 aa  STHA_MARAV RecName: Full=Soluble pyridine nucleotide
   29::458     1e-38  28%  466 aa  STHA_ECOLC RecName: Full=Soluble pyridine nucleotide
   29::458     1e-38  28%  466 aa  STHA_ECOHS RecName: Full=Soluble pyridine nucleotide
    9::458     2e-38  26%  466 aa  STHA_VIBVY RecName: Full=Soluble pyridine nucleotide
    9::458     2e-38  26%  466 aa  STHA_VIBVU RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_SALTY RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_SALTI RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_SALPK RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_SALPB RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_SALPA RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_SALEP RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_ESCF3 RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_ENT38 RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_ECOUT RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_ECOSM RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_ECOSE RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_ECOLU RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_ECOLI RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_ECOL6 RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_ECOL5 RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_ECOK1 RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_ECODH RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_ECOBW RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_ECO8A RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_ECO7I RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_ECO5E RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_ECO55 RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_ECO45 RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_ECO24 RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_SALPC RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_SALCH RecName: Full=Soluble pyridine nucleotide
   29::458     2e-38  28%  466 aa  STHA_ECO27 RecName: Full=Soluble pyridine nucleotide
  120::551     2e-38  29%  564 aa  MERA_SHIFL RecName: Full=Mercuric reductase;       
   26::471     2e-38  29%  477 aa  DLDH_TRYCR RecName: Full=Dihydrolipoyl dehydrogenase;       
   29::458     4e-38  30%  466 aa  STHA_KLEP7 RecName: Full=Soluble pyridine nucleotide
   29::458     5e-38  28%  466 aa  STHA_SHIB3 RecName: Full=Soluble pyridine nucleotide
   29::458     5e-38  28%  466 aa  STHA_ECO57 RecName: Full=Soluble pyridine nucleotide
   43::478     6e-38  31%  488 aa  DLDH_DICDI RecName: Full=Dihydrolipoyl dehydrogenase;       
   29::458     1e-37  27%  466 aa  STHA_VIBCM RecName: Full=Soluble pyridine nucleotide
   29::458     1e-37  27%  466 aa  STHA_VIBCH RecName: Full=Soluble pyridine nucleotide
   29::458     1e-37  27%  466 aa  STHA_VIBC3 RecName: Full=Soluble pyridine nucleotide
   29::458     1e-37  30%  466 aa  STHA_KLEP3 RecName: Full=Soluble pyridine nucleotide
    9::458     1e-37  25%  466 aa  STHA_VIBPA RecName: Full=Soluble pyridine nucleotide
   34::419     1e-37  30%  464 aa  STHA_PSEPK RecName: Full=Soluble pyridine nucleotide
   34::419     1e-37  30%  464 aa  STHA_PSEP1 RecName: Full=Soluble pyridine nucleotide
   29::460     2e-37  28%  468 aa  STHA_HAMD5 RecName: Full=Soluble pyridine nucleotide
    8::456     2e-37  30%  464 aa  STHA_PSEU5 RecName: Full=Soluble pyridine nucleotide
   29::458     4e-37  28%  466 aa  STHA_CITK8 RecName: Full=Soluble pyridine nucleotide
    7::463     5e-37  31%  492 aa  TYTR_TRYBB RecName: Full=Trypanothione reductase;         Short=TR;
   98::515     5e-37  28%  522 aa  GSHR_CALJA RecName: Full=Glutathione reductase, mitochondrial;     
  109::456     7e-37  30%  464 aa  STHA_PSEPW RecName: Full=Soluble pyridine nucleotide
   95::456     9e-37  31%  464 aa  STHA_PSEU2 RecName: Full=Soluble pyridine nucleotide
   95::456     9e-37  31%  464 aa  STHA_PSESM RecName: Full=Soluble pyridine nucleotide
   34::419     1e-36  30%  464 aa  STHA_PSEPG RecName: Full=Soluble pyridine nucleotide
  109::419     1e-36  31%  464 aa  STHA_PSEE4 RecName: Full=Soluble pyridine nucleotide
   95::456     3e-36  31%  464 aa  STHA_PSE14 RecName: Full=Soluble pyridine nucleotide
   98::515     3e-36  30%  522 aa  GSHR_HUMAN RecName: Full=Glutathione reductase, mitochondrial;     
    7::463     4e-36  29%  491 aa  TYTR_LEIDO RecName: Full=Trypanothione reductase;         Short=TR;
  109::456     1e-35  30%  464 aa  STHA_PSEFS RecName: Full=Soluble pyridine nucleotide
   76::493     1e-35  29%  500 aa  GSHR_MOUSE RecName: Full=Glutathione reductase, mitochondrial;     
   36::463     2e-35  26%  471 aa  STHA_VIBF1 RecName: Full=Soluble pyridine nucleotide
   23::447     2e-35  28%  456 aa  GSHR_HAEIN RecName: Full=Glutathione reductase;       
  109::456     3e-35  29%  464 aa  STHA_PSEFL RecName: Full=Soluble pyridine nucleotide
  109::456     3e-35  30%  464 aa  STHA_PSEF5 RecName: Full=Soluble pyridine nucleotide
   35::456     3e-35  29%  465 aa  GSHR_DICDI RecName: Full=Glutathione reductase;       
   32::461     1e-34  28%  469 aa  STHA_PHOPR RecName: Full=Soluble pyridine nucleotide
    8::463     1e-34  30%  492 aa  TYTR_TRYCR RecName: Full=Trypanothione reductase;         Short=TR;
  109::419     1e-34  30%  464 aa  STHA_PSEPF RecName: Full=Soluble pyridine nucleotide
    7::463     2e-34  28%  491 aa  TYTR_CRIFA RecName: Full=Trypanothione reductase;         Short=TR;
   31::456     2e-34  28%  464 aa  STHA_MARMS RecName: Full=Soluble pyridine nucleotide
   44::467     3e-34  27%  476 aa  GSHR_CANGA RecName: Full=Glutathione reductase;       
   23::441     5e-34  29%  450 aa  GSHR_ECOLI RecName: Full=Glutathione reductase;       
   49::471     4e-33  28%  480 aa  GSHR_ASHGO RecName: Full=Glutathione reductase;       
   30::501     6e-33  30%  511 aa  TRXR2_BOVIN RecName: Full=Thioredoxin reductase 2, mitochondrial;  
    5::417     1e-32  29%  424 aa  GSHR_RAT RecName: Full=Glutathione reductase;         Short=GRase; 
   23::480     2e-32  30%  503 aa  GSHR_CAEEL RecName: Full=Probable glutathione reductase 2;       
    5::435     5e-32  28%  441 aa  YKGC_ECOLI RecName: Full=Probable pyridine nucleotide-disulfide
   44::516     1e-30  28%  526 aa  TRXR2_RAT RecName: Full=Thioredoxin reductase 2, mitochondrial;    
   34::461     5e-30  29%  470 aa  GSHR_YARLI RecName: Full=Glutathione reductase;       
    1::269     5e-30  30%  277 aa  DLDH_RHIET RecName: Full=Probable dihydrolipoyl dehydrogenase;     
   20::487     6e-30  27%  499 aa  IRC15_YEAST RecName: Full=Increased recombination centers protein
   58::514     8e-30  31%  524 aa  TRXR2_HUMAN RecName: Full=Thioredoxin reductase 2, mitochondrial;  
   23::327     1e-29  30%  336 aa  DLDH_ACHLA RecName: Full=Dihydrolipoyl dehydrogenase;       
   42::514     2e-29  28%  524 aa  TRXR2_MOUSE RecName: Full=Thioredoxin reductase 2, mitochondrial;  
    8::456     9e-29  26%  464 aa  STHA_PSEMY RecName: Full=Soluble pyridine nucleotide
   30::455     9e-29  27%  464 aa  GSHR_SCHPO RecName: Full=Glutathione reductase;       
  117::586     1e-28  29%  596 aa  TRXR1_DROME RecName: Full=Thioredoxin reductase 1, mitochondrial;  
   50::475     1e-27  28%  484 aa  GSHR_KLULA RecName: Full=Glutathione reductase;       
   74::506     3e-27  29%  516 aa  TRXR2_DROME RecName: Full=Thioredoxin reductase 2, mitochondrial;  
   51::474     6e-27  25%  483 aa  GSHR_YEAST RecName: Full=Glutathione reductase;       
   52::473     5e-25  27%  499 aa  TRXR1_BOVIN RecName: Full=Thioredoxin reductase 1, cytoplasmic;    
   45::511     2e-24  28%  541 aa  TRXR_PLAF7 RecName: Full=Thioredoxin reductase;         Short=TrxR;
   45::511     2e-24  28%  541 aa  TRXR_PLAF5 RecName: Full=Thioredoxin reductase;         Short=TrxR;
  166::587     1e-23  28%  613 aa  TRXR1_MOUSE RecName: Full=Thioredoxin reductase 1, cytoplasmic;    
   52::473     3e-23  27%  499 aa  TRXR1_PIG RecName: Full=Thioredoxin reductase 1, cytoplasmic;      
  309::729     6e-23  27%  754 aa  TRXR3_HUMAN RecName: Full=Thioredoxin reductase 3;       
  229::672     7e-23  27%  697 aa  TRXR3_MOUSE RecName: Full=Thioredoxin reductase 3;       
   52::473     5e-22  27%  499 aa  TRXR1_PONAB RecName: Full=Thioredoxin reductase 1, cytoplasmic;    
  202::623     6e-22  27%  649 aa  TRXR1_HUMAN RecName: Full=Thioredoxin reductase 1, cytoplasmic;    
   26::487     1e-21  24%  500 aa  GSHR_PLAFK RecName: Full=Glutathione reductase;       
   45::481     1e-21  26%  490 aa  GSHR_DEBHA RecName: Full=Glutathione reductase;       
   26::487     4e-21  24%  500 aa  GSHR_PLAF7 RecName: Full=Glutathione reductase;       
  175::659     5e-21  28%  667 aa  TRXR1_CAEEL RecName: Full=Thioredoxin reductase 1;       
  133::472     1e-17  28%  498 aa  TRXR1_RAT RecName: Full=Thioredoxin reductase 1, cytoplasmic;      
  121::340     1e-16  31%  460 aa  MERA_SERMA RecName: Full=Mercuric reductase;       
  105::428     2e-16  26%  448 aa  NAOX_METJA RecName: Full=Putative NADH oxidase;       
   91::277     1e-15  29%  379 aa  NORW_ERWCT RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  293::467     2e-14  33%  605 aa  AIFM3_MOUSE RecName: Full=Apoptosis-inducing factor 3;       
   10::291     5e-14  34%  319 aa  TRXB_LISMO RecName: Full=Thioredoxin reductase;         Short=TRXR;
   78::422     5e-14  27%  442 aa  CDR_PYRFU RecName: Full=Coenzyme A disulfide reductase;       
   87::278     8e-14  29%  377 aa  NORW_CITK8 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::278     1e-13  29%  377 aa  NORW_ECOLU RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::278     1e-13  30%  377 aa  NORW_ECOL5 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   81::299     2e-13  29%  441 aa  MDAR1_ARATH RecName: Full=Probable monodehydroascorbate reductase,
   87::320     2e-13  29%  377 aa  NORW_SHIFL RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::320     2e-13  29%  377 aa  NORW_SHIF8 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::278     2e-13  28%  377 aa  NORW_ECOL6 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  158::494     3e-13  24%  523 aa  XECC_XANP2 RecName: Full=2-oxopropyl-CoM reductase, carboxylating; 
   87::278     3e-13  28%  377 aa  NORW_SHISS RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::278     3e-13  28%  377 aa  NORW_ECOUT RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::278     3e-13  28%  377 aa  NORW_ECOK1 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::278     3e-13  28%  377 aa  NORW_ECO45 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   62::419     3e-13  28%  447 aa  NAPE_ENTFA RecName: Full=NADH peroxidase;         Short=NPXase;    
   87::278     4e-13  28%  377 aa  NORW_ECOSM RecName: Full=Nitric oxide reductase FlRd-NAD(+)
    2::418     4e-13  28%  446 aa  NAOX_ENTFA RecName: Full=NADH oxidase;         Short=NOXase;       
    6::291     7e-13  28%  301 aa  TRXB_METJA RecName: Full=Putative thioredoxin reductase;       
   81::278     9e-13  33%  377 aa  NORW_KLEP7 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   10::291     1e-12  33%  319 aa  TRXB_LISIN RecName: Full=Thioredoxin reductase;         Short=TRXR;
   87::278     2e-12  28%  377 aa  NORW_ECO27 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  161::432     2e-12  27%  456 aa  NAOX_STRP6 RecName: Full=Probable NADH oxidase;       
   87::278     3e-12  28%  377 aa  NORW_SALTI RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   31::278     3e-12  31%  377 aa  NORW_KLEP3 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   82::426     3e-12  25%  446 aa  CDR_PYRAB RecName: Full=Coenzyme A disulfide reductase;       
   87::278     3e-12  27%  377 aa  NORW_ESCF3 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::278     3e-12  28%  377 aa  NORW_ECOHS RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::278     3e-12  28%  377 aa  NORW_ECO8A RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::278     3e-12  28%  377 aa  NORW_ECO5E RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::278     3e-12  28%  377 aa  NORW_ECO57 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::278     3e-12  28%  377 aa  NORW_ECO55 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   18::343     4e-12  33%  526 aa  OOXA2_RHIME RecName: Full=Opine oxidase subunit A;       
   87::347     4e-12  30%  377 aa  NORW_SALHS RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::347     4e-12  30%  377 aa  NORW_SALEP RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::278     8e-12  28%  377 aa  NORW_SALTY RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::347     8e-12  30%  377 aa  NORW_SALA4 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::278     1e-11  28%  377 aa  NORW_SALSV RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::278     1e-11  29%  377 aa  NORW_SHIDS RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::347     1e-11  30%  377 aa  NORW_SALG2 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::278     1e-11  27%  377 aa  NORW_ECOSE RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  103::278     1e-11  29%  377 aa  NORW_ECO24 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   55::318     1e-11  27%  805 aa  NASD_BACSU RecName: Full=Nitrite reductase [NAD(P)H];       
    4::283     2e-11  30%  311 aa  TRXB_CHLPN RecName: Full=Thioredoxin reductase;         Short=TRXR;
   87::278     2e-11  27%  377 aa  NORW_ECOLI RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::278     2e-11  27%  377 aa  NORW_ECOLC RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::278     2e-11  27%  377 aa  NORW_ECODH RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::278     2e-11  27%  377 aa  NORW_ECOBW RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   10::186     3e-11  27%  397 aa  Y636_METJA RecName: Full=Uncharacterized protein MJ0636;
   87::320     4e-11  27%  377 aa  NORW_SHIBS RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::320     4e-11  27%  377 aa  NORW_SHIB3 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
    1::287     5e-11  28%  393 aa  RURE_ACIAD RecName: Full=Rubredoxin-NAD(+) reductase;       
  103::300     5e-11  28%  771 aa  NASB_BACSU RecName: Full=Assimilatory nitrate reductase electron
    5::283     6e-11  33%  312 aa  TRXB_CHLTR RecName: Full=Thioredoxin reductase;         Short=TRXR;
   91::279     6e-11  28%  381 aa  NORW_VIBFM RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  149::422     6e-11  27%  442 aa  CDR_PYRKO RecName: Full=Coenzyme A disulfide reductase;       
   87::278     1e-10  27%  377 aa  NORW_SALAR RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   81::425     1e-10  27%  445 aa  CDR_PYRHO RecName: Full=Coenzyme A disulfide reductase;       
   94::296     1e-10  29%  433 aa  MDAR_PEA RecName: Full=Monodehydroascorbate reductase;       
   87::278     2e-10  25%  377 aa  NORW_SALPC RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::278     2e-10  25%  377 aa  NORW_SALCH RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  107::419     2e-10  25%  440 aa  CDR_STAHJ RecName: Full=Coenzyme A disulfide reductase;       
    5::283     3e-10  29%  312 aa  TRXB_CHLMU RecName: Full=Thioredoxin reductase;         Short=TRXR;
    7::279     4e-10  30%  322 aa  TRXB_STRCL RecName: Full=Thioredoxin reductase;         Short=TRXR;
   83::297     4e-10  28%  434 aa  MDAR3_ARATH RecName: Full=Probable monodehydroascorbate reductase,
   83::297     5e-10  28%  434 aa  MDARS_CUCSA RecName: Full=Monodehydroascorbate reductase, seedling
   98::275     5e-10  30%  410 aa  BEDA_PSEPU RecName: Full=Benzene 1,2-dioxygenase system
   87::278     9e-10  25%  377 aa  NORW_SALPK RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::278     9e-10  25%  377 aa  NORW_SALPA RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  208::479     9e-10  30%  507 aa  AHPF_STAES RecName: Full=Alkyl hydroperoxide reductase subunit F;  
  208::479     9e-10  30%  507 aa  AHPF_STAEQ RecName: Full=Alkyl hydroperoxide reductase subunit F;  
   89::320     1e-09  27%  377 aa  NORW_ENT38 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  149::277     1e-09  27%  438 aa  CDR_STAAW RecName: Full=Coenzyme A disulfide reductase;       
  149::277     1e-09  27%  438 aa  CDR_STAAS RecName: Full=Coenzyme A disulfide reductase;       
  149::277     2e-09  26%  438 aa  CDR_STAAN RecName: Full=Coenzyme A disulfide reductase;       
  149::277     2e-09  26%  438 aa  CDR_STAAM RecName: Full=Coenzyme A disulfide reductase;       
  149::277     2e-09  28%  438 aa  CDR_STAAB RecName: Full=Coenzyme A disulfide reductase;       
  149::277     2e-09  26%  438 aa  CDR_STAA9 RecName: Full=Coenzyme A disulfide reductase;       
  149::277     2e-09  26%  438 aa  CDR_STAA2 RecName: Full=Coenzyme A disulfide reductase;       
  149::277     2e-09  26%  438 aa  CDR_STAA1 RecName: Full=Coenzyme A disulfide reductase;       
  208::479     2e-09  29%  507 aa  AHPF_STAAW RecName: Full=Alkyl hydroperoxide reductase subunit F;  
  208::479     2e-09  29%  507 aa  AHPF_STAAN RecName: Full=Alkyl hydroperoxide reductase subunit F;  
  208::479     2e-09  29%  507 aa  AHPF_STAAM RecName: Full=Alkyl hydroperoxide reductase subunit F;  
  208::479     2e-09  29%  507 aa  AHPF_STAAC RecName: Full=Alkyl hydroperoxide reductase subunit F;  
  208::479     2e-09  29%  507 aa  AHPF_STAA8 RecName: Full=Alkyl hydroperoxide reductase subunit F;  
    8::277     2e-09  29%  311 aa  TRXB_STAAW RecName: Full=Thioredoxin reductase;         Short=TRXR;
    8::277     2e-09  29%  311 aa  TRXB_STAAS RecName: Full=Thioredoxin reductase;         Short=TRXR;
    8::277     2e-09  29%  311 aa  TRXB_STAAR RecName: Full=Thioredoxin reductase;         Short=TRXR;
    8::277     2e-09  29%  311 aa  TRXB_STAAN RecName: Full=Thioredoxin reductase;         Short=TRXR;
    8::277     2e-09  29%  311 aa  TRXB_STAAM RecName: Full=Thioredoxin reductase;         Short=TRXR;
    8::277     2e-09  29%  311 aa  TRXB_STAAC RecName: Full=Thioredoxin reductase;         Short=TRXR;
  168::443     2e-09  26%  479 aa  NAOX_MYCPN RecName: Full=Probable NADH oxidase;       
  224::438     2e-09  30%  613 aa  AIFM1_HUMAN RecName: Full=Apoptosis-inducing factor 1,
    6::280     3e-09  34%  322 aa  FENR_SALAI RecName: Full=Ferredoxin--NADP reductase;       
  149::277     4e-09  26%  438 aa  CDR_STAAR RecName: Full=Coenzyme A disulfide reductase;       
   87::278     5e-09  25%  377 aa  NORW_SALNS RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::278     5e-09  25%  377 aa  NORW_SALDC RecName: Full=Nitric oxide reductase FlRd-NAD(+)
    9::278     6e-09  24%  308 aa  R34K_CLOPA RecName: Full=34.2 kDa protein in rubredoxin operon;    
  166::279     6e-09  36%  382 aa  NORW_VIBVU RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::278     6e-09  26%  377 aa  NORW_ECO81 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
    6::280     6e-09  33%  322 aa  FENR_SALTO RecName: Full=Ferredoxin--NADP reductase;       
  208::479     6e-09  29%  507 aa  AHPF_STAAR RecName: Full=Alkyl hydroperoxide reductase subunit F;  
  193::358     8e-09  30%  532 aa  AIFM1_DICDI RecName: Full=Apoptosis-inducing factor 1,
    5::281     1e-08  29%  310 aa  TRXB_RICFE RecName: Full=Thioredoxin reductase;         Short=TRXR;
   81::280     1e-08  31%  311 aa  TRXB_MYCSM RecName: Full=Thioredoxin reductase;         Short=TRXR;
   82::333     1e-08  28%  488 aa  MDAR2_ARATH RecName: Full=Probable monodehydroascorbate reductase,
    1::176     1e-08  21%  180 aa  YMER_STAAU RecName: Full=Uncharacterized 19.7 kDa protein in
  223::437     1e-08  30%  612 aa  AIFM1_RAT RecName: Full=Apoptosis-inducing factor 1, mitochondrial;
  223::437     1e-08  30%  612 aa  AIFM1_MOUSE RecName: Full=Apoptosis-inducing factor 1,
  208::479     1e-08  29%  507 aa  AHPF_STAAS RecName: Full=Alkyl hydroperoxide reductase subunit F;  
   98::275     2e-08  28%  410 aa  TODA_PSEP1 RecName: Full=Toluene 1,2-dioxygenase system
    2::142     2e-08  26%  150 aa  STHA_PECCC RecName: Full=Soluble pyridine nucleotide
  107::277     2e-08  27%  438 aa  CDR_STAES RecName: Full=Coenzyme A disulfide reductase;       
  107::277     2e-08  27%  438 aa  CDR_STAEQ RecName: Full=Coenzyme A disulfide reductase;       
    5::281     2e-08  31%  310 aa  TRXB_RICCN RecName: Full=Thioredoxin reductase;         Short=TRXR;
  166::279     2e-08  36%  382 aa  NORW_VIBVY RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   87::278     2e-08  27%  377 aa  NORW_ECO7I RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   79::280     3e-08  26%  957 aa  NIRB_KLEOX RecName: Full=Nitrite reductase [NAD(P)H] large subunit;
   97::421     3e-08  25%  446 aa  NAOX_LACLM RecName: Full=NADH oxidase;         Short=NOXase;       
    7::279     4e-08  28%  322 aa  TRXB_STRCO RecName: Full=Thioredoxin reductase;         Short=TRXR;
    5::288     4e-08  33%  322 aa  TRXB_SCHPO RecName: Full=Thioredoxin reductase;       
    8::284     4e-08  31%  328 aa  FENR_LACCB RecName: Full=Ferredoxin--NADP reductase;       
    8::284     4e-08  31%  328 aa  FENR_LACC3 RecName: Full=Ferredoxin--NADP reductase;       
    9::278     5e-08  29%  316 aa  TRXB_BACSU RecName: Full=Thioredoxin reductase;         Short=TRXR;
    8::277     7e-08  29%  310 aa  TRXB_STAES RecName: Full=Thioredoxin reductase;         Short=TRXR;
    8::277     7e-08  29%  310 aa  TRXB_STAEQ RecName: Full=Thioredoxin reductase;         Short=TRXR;
   97::276     7e-08  31%  427 aa  THCD_RHOER RecName: Full=Rhodocoxin reductase;         EC=1.18.1.-;
  103::283     7e-08  30%  409 aa  TERPA_PSESP RecName: Full=Terpredoxin reductase;       
   10::299     7e-08  27%  346 aa  FENR1_BACP2 RecName: Full=Ferredoxin--NADP reductase 1;       
  352::481     7e-08  30%  509 aa  DHNA_BACSU RecName: Full=NADH dehydrogenase;       
  149::277     7e-08  27%  438 aa  CDR_STAA8 RecName: Full=Coenzyme A disulfide reductase;       
    1::288     9e-08  28%  305 aa  TRXB_SPIBA RecName: Full=Thioredoxin reductase;       
   73::306     9e-08  31%  320 aa  TRXB_COXBU RecName: Full=Thioredoxin reductase;         Short=TRXR;
   91::275     9e-08  28%  400 aa  HCAD_ECOLU RecName: Full=3-phenylpropionate/cinnamic acid
  152::277     9e-08  26%  440 aa  CDR_STAS1 RecName: Full=Coenzyme A disulfide reductase;       
  149::277     9e-08  27%  438 aa  CDR_STAAT RecName: Full=Coenzyme A disulfide reductase;       
  149::277     9e-08  27%  438 aa  CDR_STAAE RecName: Full=Coenzyme A disulfide reductase;       
  149::277     9e-08  27%  438 aa  CDR_STAAC RecName: Full=Coenzyme A disulfide reductase;       
  149::277     9e-08  27%  438 aa  CDR_STAA3 RecName: Full=Coenzyme A disulfide reductase;       
  124::317     1e-07  30%  326 aa  TRXB_BORBU RecName: Full=Thioredoxin reductase;         Short=TRXR;
  352::515     1e-07  32%  519 aa  DHNA_BACYN RecName: Full=NADH dehydrogenase;       
   64::285     1e-07  26%  422 aa  CAMA_PSEPU RecName: Full=Putidaredoxin reductase;       
  293::467     1e-07  27%  605 aa  AIFM3_HUMAN RecName: Full=Apoptosis-inducing factor 3;       
    5::281     1e-07  29%  310 aa  TRXB_RICPR RecName: Full=Thioredoxin reductase;         Short=TRXR;
  164::277     1e-07  32%  379 aa  NORW_SERP5 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   91::275     1e-07  28%  400 aa  HCAD_ECO24 RecName: Full=3-phenylpropionate/cinnamic acid
   91::275     2e-07  28%  400 aa  HCAD_ECO7I RecName: Full=3-phenylpropionate/cinnamic acid
   91::275     3e-07  28%  400 aa  HCAD_ECOSM RecName: Full=3-phenylpropionate/cinnamic acid
  367::566     3e-07  27%  739 aa  AIFM1_DROME RecName: Full=Putative apoptosis-inducing factor 1,
  307::490     3e-07  34%  520 aa  AHPF_PSEPU RecName: Full=Alkyl hydroperoxide reductase subunit F;  
  307::490     3e-07  34%  520 aa  AHPF_PSEPK RecName: Full=Alkyl hydroperoxide reductase subunit F;  
    5::281     3e-07  29%  310 aa  TRXB_RICTY RecName: Full=Thioredoxin reductase;         Short=TRXR;
  107::287     3e-07  31%  321 aa  TRXB_ECOLI RecName: Full=Thioredoxin reductase;         Short=TRXR;
  107::287     3e-07  31%  321 aa  TRXB_ECO57 RecName: Full=Thioredoxin reductase;         Short=TRXR;
    8::289     3e-07  28%  319 aa  TRXB_DICDI RecName: Full=Thioredoxin reductase;         EC=1.8.1.9;
   87::278     3e-07  26%  377 aa  NORW_SALPB RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  113::285     3e-07  34%  388 aa  NORW_AERS4 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   85::297     3e-07  26%  433 aa  MDAR_SOLLC RecName: Full=Monodehydroascorbate reductase;       
  355::500     3e-07  30%  530 aa  AHPF_XANCH RecName: Full=Alkyl hydroperoxide reductase subunit F;  
  313::492     3e-07  31%  521 aa  AHPF_SALTY RecName: Full=Alkyl hydroperoxide reductase subunit F;  
   84::298     4e-07  27%  435 aa  MDAR4_ARATH RecName: Full=Probable monodehydroascorbate reductase,
   91::275     4e-07  28%  400 aa  HCAD_ECOSE RecName: Full=3-phenylpropionate/cinnamic acid
   91::275     4e-07  28%  400 aa  HCAD_ECO5E RecName: Full=3-phenylpropionate/cinnamic acid
   91::275     4e-07  28%  400 aa  HCAD_ECO57 RecName: Full=3-phenylpropionate/cinnamic acid
   91::275     4e-07  28%  400 aa  HCAD_ECO55 RecName: Full=3-phenylpropionate/cinnamic acid
  100::276     4e-07  34%  321 aa  FENR_FRASC RecName: Full=Ferredoxin--NADP reductase;       
   91::275     6e-07  27%  400 aa  HCAD_ECOLI RecName: Full=3-phenylpropionate/cinnamic acid
   91::275     6e-07  27%  400 aa  HCAD_ECOLC RecName: Full=3-phenylpropionate/cinnamic acid
   91::275     6e-07  27%  400 aa  HCAD_ECOHS RecName: Full=3-phenylpropionate/cinnamic acid
   91::275     6e-07  27%  400 aa  HCAD_ECODH RecName: Full=3-phenylpropionate/cinnamic acid
   91::275     6e-07  27%  400 aa  HCAD_ECOBW RecName: Full=3-phenylpropionate/cinnamic acid
    9::278     7e-07  26%  307 aa  TRXB_MYCPU RecName: Full=Thioredoxin reductase;         Short=TRXR;
  313::492     7e-07  31%  521 aa  AHPF_ECOLI RecName: Full=Alkyl hydroperoxide reductase subunit F;  
  103::282     1e-06  33%  315 aa  TRXB_EUBAC RecName: Full=Thioredoxin reductase;         Short=TRXR;
  113::321     1e-06  30%  330 aa  FENR_LACF3 RecName: Full=Ferredoxin--NADP reductase;       
  103::282     1e-06  32%  315 aa  TRXB_CLOLI RecName: Full=Thioredoxin reductase;         Short=TRXR;
  230::351     1e-06  32%  493 aa  MDARP_ARATH RecName: Full=Monodehydroascorbate reductase,
   91::276     1e-06  26%  394 aa  HCAD_PHOLL RecName: Full=3-phenylpropionate/cinnamic acid
  139::276     1e-06  35%  322 aa  FENR_ACHLI RecName: Full=Ferredoxin--NADP reductase;       
    8::53      1e-06  51%   53 aa  DLDH_HYMDI RecName: Full=Dihydrolipoyl dehydrogenase;       
  258::437     2e-06  29%  575 aa  YDGE_SCHPO RecName: Full=Putative flavoprotein C26F1.14C;
  100::276     2e-06  34%  321 aa  FENR_FRAAA RecName: Full=Ferredoxin--NADP reductase;       
  154::307     2e-06  27%  348 aa  FENR1_BACSK RecName: Full=Ferredoxin--NADP reductase 1;       
   73::375     2e-06  20%  847 aa  NIRB_ECOLI RecName: Full=Nitrite reductase [NAD(P)H] large subunit;
    9::158     2e-06  38%  623 aa  MNMG_PERMH RecName: Full=tRNA uridine 5-carboxymethylaminomethyl
    5::281     3e-06  31%  310 aa  TRXB_RICBR RecName: Full=Thioredoxin reductase;         Short=TRXR;
    7::161     3e-06  27%  406 aa  GGR2_METBU RecName: Full=Digeranylgeranylglycerophospholipid
   10::309     3e-06  29%  336 aa  FENR_SYMTH RecName: Full=Ferredoxin--NADP reductase;       
   19::304     4e-06  29%  359 aa  FENR_RALPJ RecName: Full=Ferredoxin--NADP reductase;       
  385::431     4e-06  54%  661 aa  BAIH_EUBSP RecName: Full=NADH-dependent flavin oxidoreductase;     
  147::331     5e-06  29% 1104 aa  NIR_EMENI RecName: Full=Nitrite reductase [NAD(P)H];       
  109::322     5e-06  27%  332 aa  FENR_LACRJ RecName: Full=Ferredoxin--NADP reductase;       
  109::322     5e-06  27%  332 aa  FENR_LACRD RecName: Full=Ferredoxin--NADP reductase;       
  144::275     5e-06  34%  408 aa  BPHG_BURXL RecName: Full=Biphenyl dioxygenase system
  355::491     5e-06  28%  521 aa  AHPF_PSEAE RecName: Full=Alkyl hydroperoxide reductase subunit F;  
    3::287     6e-06  31%  334 aa  TRXB_NEUCR RecName: Full=Thioredoxin reductase;         EC=1.8.1.9;
  102::275     6e-06  30%  325 aa  FENR_ACIC1 RecName: Full=Ferredoxin--NADP reductase;       
   95::275     8e-06  28%  307 aa  TRXB_TREPA RecName: Full=Thioredoxin reductase;         Short=TRXR;
   98::269     8e-06  27%  409 aa  TODA_PSEPU RecName: Full=Toluene 1,2-dioxygenase system
    7::280     8e-06  24%  322 aa  FENR_STRSY RecName: Full=Ferredoxin--NADP reductase;       
    7::280     8e-06  24%  322 aa  FENR_STRS2 RecName: Full=Ferredoxin--NADP reductase;       
   98::269     8e-06  27%  409 aa  BNZD_PSEPU RecName: Full=Benzene 1,2-dioxygenase system
   32::181     1e-05  23%  307 aa  THI4_HALWD RecName: Full=Putative thiazole biosynthetic enzyme;
   11::288     2e-05  30%  330 aa  FENR_NOCSJ RecName: Full=Ferredoxin--NADP reductase;       
   90::269     2e-05  26%  308 aa  FENR_LACDB RecName: Full=Ferredoxin--NADP reductase;       
   90::269     2e-05  26%  308 aa  FENR_LACDA RecName: Full=Ferredoxin--NADP reductase;       
  108::333     2e-05  31%  334 aa  TRXB_PENCH RecName: Full=Thioredoxin reductase;         EC=1.8.1.9;
  101::295     2e-05  30%  333 aa  TRXB1_ARATH RecName: Full=Thioredoxin reductase 1;       
    9::158     2e-05  34%  620 aa  MNMG_SULSY RecName: Full=tRNA uridine 5-carboxymethylaminomethyl
    7::286     2e-05  31%  330 aa  FENR2_BACSK RecName: Full=Ferredoxin--NADP reductase 2;       
    6::287     2e-05  24%  348 aa  FENR1_OCEIH RecName: Full=Ferredoxin--NADP reductase 1;       
    6::288     3e-05  30%  319 aa  TRXB_YARLI RecName: Full=Thioredoxin reductase;         EC=1.8.1.9;
  153::285     3e-05  29%  388 aa  NORW_AERHH RecName: Full=Nitric oxide reductase FlRd-NAD(+)
    1::299     3e-05  25%  327 aa  FENR_SULTO RecName: Full=Ferredoxin--NADP reductase;       
  156::296     3e-05  31%  351 aa  FENR_BURVG RecName: Full=Ferredoxin--NADP reductase;       
    7::305     3e-05  28%  331 aa  FENR1_EXIS2 RecName: Full=Ferredoxin--NADP reductase 1;       
    5::288     4e-05  30%  319 aa  TRXB_ASHGO RecName: Full=Thioredoxin reductase;         EC=1.8.1.9;
   59::345     4e-05  27%  383 aa  TRXB2_ARATH RecName: Full=Thioredoxin reductase 2;       
  155::279     4e-05  29%  381 aa  NORW_VIBF1 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  158::287     4e-05  31%  336 aa  FENR1_BACA2 RecName: Full=Ferredoxin--NADP reductase 1;       
    5::288     5e-05  30%  319 aa  TRXB_CANGA RecName: Full=Thioredoxin reductase;         EC=1.8.1.9;
    7::161     5e-05  25%  392 aa  GGR_UNCMA RecName: Full=Digeranylgeranylglycerophospholipid
  163::299     5e-05  29%  351 aa  FENR_BURP8 RecName: Full=Ferredoxin--NADP reductase;       
   90::287     7e-05  28%  336 aa  FENR1_BACSU RecName: Full=Ferredoxin--NADP reductase 1;       
   32::181     9e-05  24%  310 aa  THI4_HALSA RecName: Full=Putative thiazole biosynthetic enzyme;
   32::181     9e-05  24%  310 aa  THI4_HALS3 RecName: Full=Putative thiazole biosynthetic enzyme;
  296::359     9e-05  40%  498 aa  PYRD1_MOUSE RecName: Full=Pyridine nucleotide-disulfide
    8::287     9e-05  27%  328 aa  FENR2_OCEIH RecName: Full=Ferredoxin--NADP reductase 2;       
  296::359     1e-04  40%  498 aa  PYRD1_RAT RecName: Full=Pyridine nucleotide-disulfide
  173::316     1e-04  34%  434 aa  DHNA_ECOLI RecName: Full=NADH dehydrogenase;         EC=1.6.99.3;
   93::288     2e-04  27%  319 aa  TRXB_BUCAI RecName: Full=Thioredoxin reductase;         Short=TRXR;
   11::44      2e-04  47%  529 aa  CRTI_MYXXA RecName: Full=Phytoene dehydrogenase;       
    5::55      2e-04  41%  391 aa  PURT_SYNP6 RecName: Full=Phosphoribosylglycinamide
    5::55      2e-04  41%  391 aa  PURT_SYNE7 RecName: Full=Phosphoribosylglycinamide
    6::120     2e-04  33%  633 aa  MNMG2_FUSNN RecName: Full=tRNA uridine 5-carboxymethylaminomethyl
  164::298     2e-04  29%  353 aa  FENR_PROVI RecName: Full=Ferredoxin--NADP reductase;       
   10::120     3e-04  26%  657 aa  MNMG_DESAP RecName: Full=tRNA uridine 5-carboxymethylaminomethyl
  165::292     3e-04  31%  305 aa  FENR_IGNH4 RecName: Full=Ferredoxin--NADP reductase;       
    9::48      3e-04  45%  331 aa  FENR_DEIGD RecName: Full=Ferredoxin--NADP reductase;       
  170::287     3e-04  28%  372 aa  DHA_BACSH RecName: Full=Alanine dehydrogenase;         EC=1.4.1.1;
  126::213     3e-04  32%  412 aa  YEIT_ECO57 RecName: Full=Uncharacterized oxidoreductase yeiT;      
   98::289     3e-04  27%  315 aa  TRXB_MYCPN RecName: Full=Thioredoxin reductase;         Short=TRXR;
   13::151     3e-04  33%  472 aa  TRMFO_RHIME RecName:
    5::154     3e-04  33%  612 aa  MNMG_MYCPN RecName: Full=tRNA uridine 5-carboxymethylaminomethyl
    5::81      3e-04  39%  640 aa  MNMG_CAMHC RecName: Full=tRNA uridine 5-carboxymethylaminomethyl
  126::191     4e-04  35%  413 aa  YEIT_SALTY RecName: Full=Uncharacterized oxidoreductase yeiT;      
  126::191     4e-04  35%  413 aa  YEIT_SALTI RecName: Full=Uncharacterized oxidoreductase yeiT;      
   38::185     4e-04  23%  310 aa  THI4_HALMA RecName: Full=Putative thiazole biosynthetic enzyme;
   19::94      4e-04  34%  388 aa  TETX_BACFR RecName: Full=Tetracycline resistance protein from
  387::505     4e-04  26%  678 aa  STCD_RHIME RecName: Full=Probable N-methylproline demethylase;     
   87::127     4e-04  50% 1124 aa  MICA2_HUMAN RecName: Full=Protein MICAL-2;
  227::343     4e-04  31%  634 aa  FTHS_ARATH RecName: Full=Formate--tetrahydrofolate ligase;       
    5::37      6e-04  48%  324 aa  YPDA_BACSU RecName: Full=Uncharacterized protein ypdA;
   10::88      6e-04  39%  627 aa  MNMG_COXBU RecName: Full=tRNA uridine 5-carboxymethylaminomethyl
   10::88      6e-04  39%  627 aa  MNMG_COXBR RecName: Full=tRNA uridine 5-carboxymethylaminomethyl
   10::88      6e-04  39%  627 aa  MNMG_COXBN RecName: Full=tRNA uridine 5-carboxymethylaminomethyl
    5::67      6e-04  43%  621 aa  MNMG_CAMFF RecName: Full=tRNA uridine 5-carboxymethylaminomethyl
  298::369     8e-04  37%  500 aa  PYRD1_PONAB RecName: Full=Pyridine nucleotide-disulfide
    6::159     8e-04  31%  614 aa  MNMG_UREPA RecName: Full=tRNA uridine 5-carboxymethylaminomethyl
    6::159     8e-04  31%  614 aa  MNMG_UREP2 RecName: Full=tRNA uridine 5-carboxymethylaminomethyl
   87::117     8e-04  52%  960 aa  MICA2_MOUSE RecName: Full=Protein MICAL-2;
  266::299     8e-04  44%  890 aa  LSDA_DROME RecName: Full=Possible lysine-specific histone
  279::390     8e-04  30%  459 aa  HMT2_SCHPO RecName: Full=Sulfide:quinone oxidoreductase,
  230::346     8e-04  31%  637 aa  FTHS_SPIOL RecName: Full=Formate--tetrahydrofolate ligase;       
  126::213     0.001  31%  412 aa  YEIT_ECOLI RecName: Full=Uncharacterized oxidoreductase yeiT;      
   11::151     0.001  33%  480 aa  TRMFO_SINMW RecName:
    1::69      0.001  29%  392 aa  PURT_CHLTE RecName: Full=Phosphoribosylglycinamide
   10::113     0.001  31%  634 aa  MNMG_XANOR RecName: Full=tRNA uridine 5-carboxymethylaminomethyl
   10::113     0.001  31%  634 aa  MNMG_XANOM RecName: Full=tRNA uridine 5-carboxymethylaminomethyl
    6::159     0.001  31%  614 aa  MNMG_UREU1 RecName: Full=tRNA uridine 5-carboxymethylaminomethyl
   10::161     0.001  28%  629 aa  MNMG_BACSK RecName: Full=tRNA uridine 5-carboxymethylaminomethyl
  303::499     0.001  23%  546 aa  LEU1_PROMP RecName: Full=2-isopropylmalate synthase;       
  161::295     0.001  33%  345 aa  FENR_RHORT RecName: Full=Ferredoxin--NADP reductase;       
  356::487     0.001  31%  530 aa  AHPF_XANCH RecName: Full=Alkyl hydroperoxide reductase subunit F;  (query 3->130)
  356::487     2e-04  29%  521 aa  AHPF_PSEAE RecName: Full=Alkyl hydroperoxide reductase subunit F;  (query 3->130)
  170::198     4e-04  59%  372 aa  DHA_BACSH RecName: Full=Alanine dehydrogenase;         EC=1.4.1.1;(query 3->31)
    1::460

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTKVVIIGGGPGGYEAALVAAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINV
DLDH1_BACSU     -TDTLVIGAGPGGYVAAIRAAQLGQKVTVVEKATLGGVCLNVGCIPSKALINAGHRYENAKHSDDMGITA
DLDH_CHLPN      ----VVIGAGPSGYVAAITAAQSKLRTALIEEDQAGGTCLNRGCIPSKALIAGANVVSHIKHAEQFGIHV
DLDH_ZYMMO      ---LIVLGGGPGGYVAAIRAAQLNLKVALVERVHLGGICLNWGCIPTKSLLRSAEVYHEMQNAEAYGLTS
DLDH_HALVO      -TELLVIGAGPGGYVAAIRAAQNGIDTTLVEKDAYGGTCLNYGCIPSKALITGANLAHEAGNAEEMGIHV
DLDH_CHLTR      ----VVIGAGPGGYVAAITAAQAGLKTALIEKREAGGTCLNRGCIPSKALLAGAEVVTQIRHADQFGIHV
DLDH_CHLMU      ----VVIGAGPGGYVAAITAAQAGLKTALIEEREAGGTCLNRGCIPSKALLASAEIVAQIRHADQFGIHI
DLDH1_BACST     -------------------AAQLGQKVTIVEKGNLGGVCLNVGCIPSKALISASHRYEQAKHSEEMGIKA
DLDH_STAAW      -TDTIVIGAGPGGYVAAIRAAQLGQKVTIVEKGNLGGVCLNVGCIPSKALLHASHRFVEAQHSENLGVIA
DLDH_STAAU      -TDTIVIGAGPGGYVAAIRAAQLGQKVTIVEKGNLGGVCLNVGCIPSKALLHASHRFVEAQHSENLGVIA
DLDH_STAAS      -TDTIVIGAGPGGYVAAIRAAQLGQKVTIVEKGNLGGVCLNVGCIPSKALLHASHRFVEAQHSENLGVIA
DLDH_STAAR      -TDTIVIGAGPGGYVAAIRAAQLGQKVTIVEKGNLGGVCLNVGCIPSKALLHASHRFVEAQHSENLGVIA
DLDH_STAAN      -TDTIVIGAGPGGYVAAIRAAQLGQKVTIVEKGNLGGVCLNVGCIPSKALLHASHRFVEAQHSENLGVIA
DLDH_STAAM      -TDTIVIGAGPGGYVAAIRAAQLGQKVTIVEKGNLGGVCLNVGCIPSKALLHASHRFVEAQHSENLGVIA
DLDH_STAAC      -TDTIVIGAGPGGYVAAIRAAQLGQKVTIVEKGNLGGVCLNVGCIPSKALLHASHRFVEAQHSENLGVIA
DLDH_CHLP8      ---VAVIGSGPGGYEAALHAARHGMKVCLVEKASLGGVCVNWGCIPTKALLRSAEVYDLAKNPSEFGVNV
DLDH_CHLTE      ---VAVIGSGPGGYEAAIHAARYGLKTCIVEKAVLGGVCVNWGCIPTKALLRSAEVFDLAKNPETFGVNV
DLDH2_HALMA     -TELLVIGGGPGGYVAAIRGAQLGLDTTLVERDAYGGTCLNHGCIPSKALISASDVAHDARQAESMGVFA
DLDH_THESC      ---LIVIGTGPGGYPAAIRGAQXXXXXXXXXXXXXXXXCLNVGCIPTKALLHAAETVHHLKGAEGFGLKA
DLDH3_PSEAE     ---VIVIGAGPGGYNAAIRAGQLGLKVACVERETLGGTCLNVGCMPSKALLHASELYAAASEFARLGIRV
DLDH3_PSEPU     ---VVIIGGGPGGYNAAIRAGQLGLTVACVERSTLGGTCLNVGCMPSKALLHASYEAASGDEFAHLGIEV
DLDH_PIG        ---VTVIGSGPGGYVAAIKAAQLGFKTVCIEKETLGGTCLNVGCIPSKALLNNSYHMAHGKDFASRGIEM
DLDH_CANFA      ---VTVIGSGPGGYVAAIKAAQLGFKTVCVEKETLGGTCLNVGCIPSKALLNNSYHMAHGKDFASRGIEM
DLDH_MOUSE      ---VTVIGSGPGGYVAAIKSAQLGFKTVCIEKETLGGTCLNVGCIPSKALLNNSYHMAHGKDFASRGIEI
DLDH_CRIGR      ---VTVIGSGPGGYVAAIKAAQLGFKTVCIEKDTLGGTCLNVGCIPSKALLNNSYHLAHGRDFASRGIEL
DLDH_RAT        ---VTVIGSGPGGYVAAIKAAQLGFKTVCIEKETLGGTCLNVGCIPSKALLNNSYHLAHGKDFASRGIEI
DLDH_MACFA      ---VTVIGSGPGGYVAAIKAAQLGFKTVCVEKETLGGTCLNVGCIPSKALLNNSYHMAHGKDFASRGIEM
DLDH_HUMAN      ---VTVIGSGPGGYVAAIKAAQLGFKTVCIEKETLGGTCLNVGCIPSKALLNNSYHMAHGTDFASRGIEM
DLDH_AZOVI      ---VIVIGAGPGGYVAAIKSAQLGLKTALIEKTALGGTCLNVGCIPSKALLDSSYKFHEAHESFKLGIST
DLDH_PONAB      ---VTVIGSGPGGYVAAIKAAQLGFKTVCVEKETLGGTCLNVGCIPSKALLNNSYHMAHGKDFASRGIEM
DLDH2_BACSU     ---VVILGGGTGGYVAAIRAAQLGLKTAVVEKEKLGGTCLHKGCIPSKALLRSAEVYRTAREADQFGVET
DLDH1_PSEAE     -TSLLIVGGGPGGYVAAIRAGQLGIPTVLVEGAALGGTCLNVGCIPSKALIHAALKARHYASRSALGIQV
DLDH_PSEFL      ---VVVIGAGPGGYVAAIRAAQLGLKTACIEKYALGGTCLNVGCIPSKALLDSSYKYHEAKEAFKVGIEA
DLDH2_PSEAE     ---VVVIGAGPGGYVAAIRAAQLGLKTACIEKYALGGTCLNVGCIPSKALLDSSYKYHEAKEAFKVGIEA
DLDH2_PSEPU     ---VVVIGAGPGGYVAAIKAAQLGLKTACIEKYALGGTCLNVGCIPSKALLDSSWKYKEAKESFNVGIST
DLDH_SHIFL      -TQVVVLGAGPAGYSAAFRCADLGLETVIVERNTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVF
DLDH_SCHPO      -----VIGGGPGGYVAAIRGAQLGLKTICVEKRGLGGTCLNVGCIPSKALLNNSHIYHTVKH--------
DLDH_ECOLI      -TQVVVLGAGPAGYSAAFRCADLGLETVIVERNTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVF
DLDH_ECOL6      -TQVVVLGAGPAGYSAAFRCADLGLETVIVERNTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVF
DLDH_ECO57      -TQVVVLGAGPAGYSAAFRCADLGLETVIVERNTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVF
MERA_STAES      -----------------------GAKVAMVERGTVGGTCVNIGCVPSKTMLRAGEINGLAQNNPFTGLQT
MERA_STAAU      -----------------------GAKVAMVERGTVGGTCVNIGCVPSKTMLRAGEINGLAQNNPFTGLQT
DLDH_PEA        -------------------AAQLGFKTTCIEKRGLGGTCLNVGCIPSKALLHSSHMYHEAKHSANHGVKV
DLDH_YEAST      ---VVIIGGGPAGYVAAIKAAQLGFNTACVEKRGLGGTCLNVGCIPSKALLNNSMHTEAQKRGIDVNINV
GSHR_ANASP      -----VIGAGSGGLAASKRAASYGAKVAIAENDLVGGTCVIRGCVPKKLMVYGSHFPALFEDAAGYGWQV
DLDH1_PSEPU     ----------PGGYVAAIRAGQLGIPTVLVEGQALGGTCLNIGCIPSKALIHVAEQASRFTEPSPLGISV
DLDH_BUCAI      -TQVVVIGSGPAGYSAAFRCADLGLDTVLIERDKLGGVCLNVGCIPSKTLLHIAKVIKEAKELHKTGVSF
DLDH3_HALMA     -TDVLVIGAGPGGYVAAIRAAQLALDVTLVEKGEYGGACLNRGCIPSKALIHGSKLASEAGQAEELGIYA
DLDH_MYCPN      ---LIIIGAGPAGYVAAEYAGKHKLKTLVVEKEYFGGVCLNVGCIPTKTLLKRAKIVDYLRHAQDYGISI
DLDH_HALSA      -------------------AGQLGLDVTLVEKDAYGGTCLNYGCIPSKAMITASGVAHEAGHAEEMGVYA
DLDH_MANSE      ---LVVIGAGPGGYVAAIKAAQLGMKVVSVEKESLGGTCLNVGCIPSKALLHNTHLYHMAKDFKHRGIET
STHA_MYCTU      ---IVVIGSGPGGQKAAIASAKLGKSVAIVERGRLGGVCVNTGTIPSKTLREAVLYLTGMNQRELYGASY
STHA_MYCTA      ---IVVIGSGPGGQKAAIASAKLGKSVAIVERGRLGGVCVNTGTIPSKTLREAVLYLTGMNQRELYGASY
STHA_MYCBT      ---IVVIGSGPGGQKAAIASAKLGKSVAIVERGRLGGVCVNTGTIPSKTLREAVLYLTGMNQRELYGASY
STHA_MYCBP      ---IVVIGSGPGGQKAAIASAKLGKSVAIVERGRLGGVCVNTGTIPSKTLREAVLYLTGMNQRELYGASY
STHA_MYCBO      ---IVVIGSGPGGQKAAIASAKLGKSVAIVERGRLGGVCVNTGTIPSKTLREAVLYLTGMNQRELYGASY
DLDH_BUCBP      -TQVVIIGSGPSGYSAAFRCSDLGLNVVLIEQYSLGGVCLNVGCIPSKYLLHIAKVIKDVKKLSRIGISF
MERA_THIFE      ---IAVIGSGGAAMACALKAVERGARVTLIERSTIGGTCVNIGCVPSKIMIRAAHIAHLRRES-------
DLDH_HAEIN      -TQVVVLGAGPAGYSAAFRCADLGLETVIVERSTLGGVCLNVGCIPSKALLHVAKVIEEAKHANKNGIYF
DLDH_BUCAP      -SEVVIIGSGPAGYSAAFRCADLGLETVLIEQERLGGVCLNVGCIPSKSLLHIAKIIKDASELSESGVFF
MERA_BACCE      ----IIIGSGGAAFSSAIEAVALNAKVAMIERXXXXXXXXXXXXXPSKTLLRAGEINHLAKNNPFVGLHT
DLDH_SYNY3      -----------------------GLKTAIIEAKDMGGTCVNRGCIPSKALLAASGRVREMSDQQQLGIQI
DLDH_RHOCA      -------------YVCAIRCAQLGLKTACVERGALGGTCLNVGCIPSKALLHATHELHEVHENFEKMGLM
GSHR_BURCE      -----VIGAGSGGVRAARIAAGHGAKVAIAEEYRFGGTCVIRGCVPKKLLMYASQYGQGFEDAAGFGWHS
DLDH_VIBCH      --QVVVLGAGPAGYSAAFRCADLGLDTVIIERNTLGGVCLNVGCIPSKALLHVAKVIEEAKALTEHGIVF
GSHRP_SPIOL     -----VIGAGSGGVRAARFSANLGAKVGICELPGVGGTCVIRGCVPKKILV--------------YGASF
DLDH1_ARATH     -------------------ASQLGLKTTCIEKRGLGGTCLNVGCIPSKALLHSSHMYHEAKHSANHGIKV
MERA_ENTAG      -----------------------GAQVTLIERGTIGGTCVNVGCVPSKIMIRVAHIAHLRRESPFDG---
DLDH_MYCGE      ---LIILGAGPAGYIAAEYAGKHKLKTLVIEKQYFGGVCLNVGCIPTKTLLKRAKIIDYLVHAKDYGITI
DLDH_VIBPA      --QVVVLGSGPAGYSAAFRCADLGLETVLVERSTLGGVCLNVGCIPSKALLHVSKVIEEAKAMADHGVVF
MERA_PSEAE      -----------------------GAQVTLIERGTIGGTCVNVGCVPSKIMIRAAHIAHLRRESPFDGGIA
DLDH_MYCTU      ---VVVLGAGPGGYVAAIRAAQLGLSTAIVEPKYWGGVCLNVGCIPSKALLRNAELVHFTKDAKAFGIS-
DLDH_MYCBO      ---VVVLGAGPGGYVAAIRAAQLGLSTAIVEPKYWGGVCLNVGCIPSKALLRNAELVHFTKDAKAFGIS-
DLDH_RALEH      ----------------------------------LGGTCLNVGCIPSKALLASSEEFENVQHLGDHGITV
GSHR_STRTR      -------------------AAMHGAKVILFEGKEVGGTCVNVGCVPKKVMWYGA------QVAETLHRYA
DLDH3_BACSU     -------------------------NVLLIDKGKLGGTCLNEGCIPTKSLLESANVLDKIKHADSFGIEL
DLDH_MYCLE      ---VVVLGAGPGGYVAAIRAAQLGLSTAVVEPKYWGGICLNVGCIPSKVLLHNALAHIFTKEAKTFGIS-
GSHRP_TOBAC     ------IGAGSGGVRASRFASNFGASVAVCETGGVGGTCVLRGCVPKKLLVYASKYSHEFEESCGFGWNY
DLDH2_ARATH     -------------------AAQLGLKTTCIEKRGLGGTCLNVGCIPSKALLHSSHMYHEAKHVANHGVKV
STHA_COLP3      ---VIIIGTGPGGEGAAMNLAKRQKKVAIIERHQVGGGCTHWGTIPSKAL----------RQSVSRLIEY
MERA_SHEPU      ---VAIIGTGSGAFACAIKAAEGGAKVTLIEADVIXXXXXXXXXXPSKXXXXXXXXXXXXXXXPFTGLE-
GSHRP_SOYBN     ------IGAGSGGVRARRFAANYGASVAICETTGVGGTCVIRGCVPKKLLVYASKFSHEFEESNGFGWRY
MERA_PSEFL      -----------------------GATVTLIERGTIGGTCVNIGCVPSKIMIRAAHIAHLRRES-------
DLDH_TRYBB      ---------------AAIKAAQLGLKTACVEKRGLGGTCLNVGCIPSKALLATHMYHDAHANFERYGL-M
GSHRC_ARATH     -----VIGAGSGGVRAARFSANHGAKVGICELPGVGGTCVIRGCVPKKILVYGATYGGELEDAKNYGWEI
STHA_SERP5      -----------------------GARVAVIERNNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYNNSR
STHA_PHOLL      -----------------------GKSVAVIERNNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
GSHRC_BRARP     -----VIGAGSGGVRAARFSANNGAKVGICELPGVGGTCVIRGCVPKKILVYGATYGGELEDARNYGING
STHA_YERE8      -----------------------GARVAVIERNNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
MERA_STRLI      ----------------------------------------------------------------------
GSHR_PSEAE      ----------------------------------LGGTCVNVGCVPKKLLVYGAHFSEDFEQARAYGWSA
GSHRP_PEA       ------IGAGSGGVRASRFASNFGASSAVCETGGVGGTCVIRGCVPKKLLVYASKFSHEFEESNGFGWRY
STHA_CHRSD      ---VVVIGSGPAGESAAINAAKHGKRVAIVEKQAVGGNCTHWGTIPSKAL------RHQVKQIMQFNTNI
GSHRP_ARATH     ------IGAGSGGVRASRFATSFGASAAVCEAGGVGGTCVLRGCVPKKLLVYASKYSHEFEDSHGFGWKY
STHA_PSEA7      ---VVILGTGPAGEGAAMNASKYGRKLAVVDRRVVGGNCTHLGTIPSKAL-RHSVKQIIEFNTNPMFRQI
STHA_PSEAE      ---VVILGTGPAGEGAAMNASKYGRKLAVVDRRVVGGNCTHLGTIPSKAL-RHSVKQIIEFNTNPMFRQI
STHA_PSEAB      ---VVILGTGPAGEGAAMNASKYGRKLAVVDRRVVGGNCTHLGTIPSKAL-RHSVKQIIEFNTNPMFRQI
STHA_PSEA8      ---VVILGTGPAGEGAAMNASKYGRKLAVVDRRVVGGNCTHLGTIPSKAL-RHSVKQIIEFNTNPMFRQI
GSHR_NEUCR      -TDFLVIGGGSGGIATARAAAKYGIKSMVVEGKRLGGTCVNVGCVPKKVTFYAALVAETIHQAKDYGFSV
STHA_YERPY      -----------------------GARVAVIERNNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_YERPS      -----------------------GARVAVIERNNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_YERPP      -----------------------GARVAVIERNNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_YERPN      -----------------------GARVAVIERNNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_YERPG      -----------------------GARVAVIERNNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_YERPE      -----------------------GARVAVIERNNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_YERPB      -----------------------GARVAVIERNNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_YERPA      -----------------------GARVAVIERNNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_YERP3      -----------------------GARVAVIERNNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_ERWCT      -----------------------GAKIAVIERHNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
MERA_ALCSP      -----------------------GANVTLIERGTIGGTCVNVGCVPSKIMIRAAHIAHLRRES-------
TYTR_TRYCO      ---LVIIGAGSGGLEAGWNAATLYVDVQTVHGPALGGTCVNVGCVPKKLMVTGAQYMDQLRESAGFGWEF
STHA_SODGM      -----------------------GARVAIIERDNVGGGCTHWGTIPSKAL----------RQAVSRIIEI
STHA_VIBSL      ---VIVIXXXXXXXXXXXXLTKAGLNVAIIEKESVGGGCTHWGTIPSKAL----------RHAVSRIIEF
GSHRC_PEA       -----IIGAGSGGVRAARFSSNFGAKVGICELPGVGGTCVIRGCVPKKILVYGASYGGELQDARNFGWEL
STHA_ERWT9      -----------------------GARIAVIERHNIGGGCTHWGTIPSKAL----------RHAVSRIIEF
MERA_ACICA      -----------------------GAHVSLIERGTIGGTCVNVGCVPSKIMIRAAHIAHLRRES-------
STHA_PROMH      -----------------------GKRVAVIERDQVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_AZOVI      ---VVVIGTGPAGEGAAMNAVKAGRKVAVVDRPQVGGNCTHLGTIPSKAL-RHSVRQIMQYNNNPLFRQI
STHA_AZOVD      ---VVVIGTGPAGEGAAMNAVKAGRKVAVVDRPQVGGNCTHLGTIPSKAL-RHSVRQIMQYNNNPLFRQI
STHA_HAHCH      ---VVVIGAGPAGEGAAMNAAKHGKRVAVIEKSQVGGNCTHMGTIPSKAL-RHAVKQIIQFNTNTMFRDI
GSHRC_ORYSJ     -----VIGAGSGGVRGSRTSASFGAKVAICEQGGHGGTCVIRGCVPKKILVYGSSFRGEFEDAKNFGWEI
STHA_ECO81      -----------------------GARVAVIERQNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_SHIFL      -----------------------GARVAVIERQNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_SALG2      -----------------------GARVAVIERHNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_MARAV      ---VVVIGAGPSGEGAAMNAAKHNRRVAIIEKPTVGGNCTHWGTIPSKALRHS------VKQIITFNTNI
STHA_ECOLC      -----------------------GARVAVIERQNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_ECOHS      -----------------------GARVAVIERQNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_VIBVY      ---VIVIXXXXXXXXXXXXLTKAGLKVAVVEKESVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_VIBVU      ---VIVIXXXXXXXXXXXXLTKAGLKVAVVEKESVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_SALTY      -----------------------GARVAVIERHNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_SALTI      -----------------------GARVAVIERHNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_SALPK      -----------------------GARVAVIERHNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_SALPB      -----------------------GARVAVIERHNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_SALPA      -----------------------GARVAVIERHNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_SALEP      -----------------------GARVAVIERHNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_ESCF3      -----------------------GARVAVIERQNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_ENT38      -----------------------GARVAVIERHNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_ECOUT      -----------------------GARVAVIERQNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_ECOSM      -----------------------GARVAVIERQNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_ECOSE      -----------------------GARVAVIERQNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_ECOLU      -----------------------GARVAVIERQNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_ECOLI      -----------------------GARVAVIERQNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_ECOL6      -----------------------GARVAVIERQNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_ECOL5      -----------------------GARVAVIERQNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_ECOK1      -----------------------GARVAVIERQNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_ECODH      -----------------------GARVAVIERQNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_ECOBW      -----------------------GARVAVIERQNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_ECO8A      -----------------------GARVAVIERQNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_ECO7I      -----------------------GARVAVIERQNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_ECO5E      -----------------------GARVAVIERQNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_ECO55      -----------------------GARVAVIERQNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_ECO45      -----------------------GARVAVIERQNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_ECO24      -----------------------GARVAVIERQNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_SALPC      -----------------------GARVAVIERHNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_SALCH      -----------------------GARVAVIERHNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_ECO27      -----------------------GARVAVIERQNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
MERA_SHIFL      -----------------------GARVTLIERGTIGGTCVNVGCVPSKIMIRAAHIAHLRRESPFDGGIA
DLDH_TRYCR      ---------------ASIKAAQLGMKTACVEKRGLGGTCLNVGCIPSKALLATHVYHDAHANFARYGL-M
STHA_KLEP7      -----------------------GARVAVIERHNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_SHIB3      -----------------------GARVAVIERQNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_ECO57      -----------------------GARVAVIERQNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
DLDH_DICDI      ---------------------QLGMKVTVVEKRGLGGTCLNVGCIPSKALL----NASHLYEEATTKMS-
STHA_VIBCM      -----------------------GKNVAIIEKESVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_VIBCH      -----------------------GKNVAIIEKESVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_VIBC3      -----------------------GKNVAIIEKESVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_KLEP3      -----------------------GVRVAVIERHNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_VIBPA      ---VIVIXXXXXXXXXXXXLTKAGLNVAIVEKESVGGGCTHWGTIPSKAL----------RHAVSRIIEF
STHA_PSEPK      ----------------------------VDDRRQVGGNCTHLGTIPSKAL-RHSVRQIMQFNTNPMFRAI
STHA_PSEP1      ----------------------------VDDRRQVGGNCTHLGTIPSKAL-RHSVRQIMQFNTNPMFRAI
STHA_HAMD5      -----------------------GQSVAVVERKNVGGGCTHSGTIPSKAL----------RHVISRIIEF
STHA_PSEU5      ---VVVLGSGPAGEGAAMNAVKAGRKVAVVDRPLVGGNCTHLGTIPSKAL-RHSVRQIMQYNTNPLFRQI
STHA_CITK8      -----------------------GARVAVIERHNVGGGCTHWGTIPSKAL----------RHAVSRIIEF
TYTR_TRYBB      ---LVVIGAGSGGLEAGWNAATLYKKVAVIDVQALGGTCVNVGCVPKKLMVTGAQYMDHLRESAGFGWEF
GSHR_CALJA      ----------------------------------LGGTCVNVGCVPKKVMWNTAVHSEFLHDHGDYGFSS
STHA_PSEPW      ----------------------------------------------------------------------
STHA_PSEU2      ----------------------------------------------------------------------
STHA_PSESM      ----------------------------------------------------------------------
STHA_PSEPG      ----------------------------VDDRRQVGGNCTHLGTIPSKAL-RHSVRQIMQFNTNPMFRAI
STHA_PSEE4      ----------------------------------------------------------------------
STHA_PSE14      ----------------------------------------------------------------------
GSHR_HUMAN      ----------------------------------LGGTCVNVGCVPKKVMWNTAVHSEFMHDHADYGFP-
TYTR_LEIDO      ---LVVLGAGSGGLEAGXXQATHGPPALV----ALGGTCVNVGCVPKKLMVTGAQYMDLIRESGGFGWEM
STHA_PSEFS      ----------------------------------------------------------------------
GSHR_MOUSE      ----------------------------------LGGTCVNVGCVPKKVMWNTAVHSEFMHDHVDYGFQS
STHA_VIBF1      -------------------------NVAIIERESVGGGCTHWGTIPSKAL----------RHAVSRIIEF
GSHR_HAEIN      -------------------AASYGKKCAIIEAKHLGGTCVNVGCVPKKVMFGAHIAEAINNYAPDYGFDV
STHA_PSEFL      ----------------------------------------------------------------------
STHA_PSEF5      ----------------------------------------------------------------------
GSHR_DICDI      -----------------------GDRIGIVEVTRPGGTCVNVGCVPKKVMWNTSFIKEMINAAPSYGFDF
STHA_PHOPR      -----------------------GLNVAVIERENVGGGCTHWGTIPSKALRAVSRIIEYNQNPLYCKNNS
TYTR_TRYCR      ---LVVIGAGSGGLEAAWNAATLYKDVQMVHGSALGGTCVNVGCVPKKLMVTGAQYMEHLRESAGFGWEF
STHA_PSEPF      ----------------------------------------------------------------------
TYTR_CRIFA      ---LVVIGAGSGGLEAGWNAASLHKKVAVIDLQALGGTCVNVGCVPKKLMVTGANYMDTIRESAGFGWEL
STHA_MARMS      --------------------------VAVIEASSVGGSCTHLGTIPSKAL------RHAVKEIIAFNTN-
GSHR_CANGA      ----------------------------LIEGKALGGTCVNVGCVPKKVMWYASDLATRLTHAHEYGL-A
GSHR_ECOLI      -------------------AAMYGQKCALIEAKELGGTCVNVGCVPKKVMW----HAAQIREAIHMGPDY
GSHR_ASHGO      ----------------------------LIEGKALGGTCVNVGCVPKKVMWYASDLAHRLLHARDYGL-L
TRXR2_BOVIN     ---LLVIGGGSGGLACAKEAAQLGKKVAVLDRWGLGGTCVNVGCIPKKLMHQAALLGGMIRDAPHYGWGV
GSHR_RAT        -------------------------------------------CVPKKVMWNTAVHSEFIHDHVDYGFQN
GSHR_CAEEL      ---LIVIGAGSGGLSCSKRAADLGANVALIDAVGIGGTCANVGCIPKKLMHQAAIVGKELKHADKYGWNG
YKGC_ECOLI      --QAVIIGFGKAGKTLAVTLAKAGWRVALIEQSNAGGTCINIGCIPTKTLVHDAQQTDFVRA-------I
TRXR2_RAT       ---LLVIGGGSGGLACAKEAAQLGRKVAVADKWGLGGTCVNVGCIPKKLMHQAALLGGMIRDAQHYGWEV
GSHR_YARLI      ----------------------------LIEGKALGGTCVNVGCVPKKVMWNASDLAGRIRQAKEYGFDV
DLDH_RHIET      ----------------------------------------------------------------------
IRC15_YEAST     ---VLVIGCGPGGFTAAMQASQAGLTACVDQRASLGGAYLVDGAVPSKTXXXXXXXXXXXXXXXXXXXRG
TRXR2_HUMAN     -------------------AAQLGRKVAVVDRWGLGGTCVNVGCIPKKLMHQAALLGGLIQDAPNYGWEV
DLDH_ACHLA      -------------------AAQYGAKVALVEKEVVGGICLNHGCIPTKTFLKSAKVFNTVKKSMDFGVST
TRXR2_MOUSE     ---LLVIGGGSGGLACAKEAAQLGKKVAVADKWGLGGTCVNVGCIPKKLMHQAALLGGMIRDAHHYGWEV
STHA_PSEMY      ---VVVLGSXXXXXXXXXXXXXXXRKVAVVDRPLVGGNCTHLGTIPSKAL-RHSVRQIMQFNTNPMFRQI
GSHR_SCHPO      -----------------------GAKVALIEASGLGGTCVNYGCVPKKIMWNIADLVAKMKTAKQNGFNS
TRXR1_DROME     ---LIVIGGGSAGLACAKEAVLNGARVACLDKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNV
GSHR_KLULA      ----------------------------LIEAKAMGGTCVNKGCVPKKVMWYASDLATRIGHAHSYNLF-
TRXR2_DROME     ---------------------------------GIGGTCVNVGCIPKKLMHQASLLGEAVHEAVAYGWNV
GSHR_YEAST      ----------------------------LVEAKALGGTCVNVGCVPKKVMWYASDLATRVSHANEYGL-Y
TRXR1_BOVIN     -------------------------------RWGLGGTCVNVGCIPKKLMHQAALLGQALRDSRNYGWNV
TRXR_PLAF7      ----VVIGGGPGGMASAKEAAAHGARVLLFDKWGIGGTCVNVGCVPKKLMYAGHMGSIFKLDSKAYGWKF
TRXR_PLAF5      ----VVIGGGPGGMASAKEAAAHGARVLLFDKWGIGGTCVNVGCVPKKLMYAGHMGSIFKLDSKAYGWKF
TRXR1_MOUSE     -------------------------------RWGLGGTCVNVGCIPKKLMHQAALLGQALKDSRNYGWKV
TRXR1_PIG       -------------------------------RWGLGGTCVNVSCIPKKLMHQAALLGQALRDSRNYGWNV
TRXR3_HUMAN     ---------------------------------GLGGTCVNVGCIPKKLMHQAALLGQALCDSRKFGWEY
TRXR3_MOUSE     -------------------AANLGKKVMVLDTWGLGGTCVNVGCIPKKLMHQAALLGHALQDAKKYGWEY
TRXR1_PONAB     -------------------------------RWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV
TRXR1_HUMAN     -------------------------------RWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV
GSHR_PLAFK      ------------------------AKVALVEKSRLGGTCVNVGCVPKKIMFNAASVHDILENSRHYGFDT
GSHR_DEBHA      ----------------------------------MGGTCVNVGCVPKKVMWYAGDLAEKRHHLKSYGLST
GSHR_PLAF7      ------------------------AKVALVEKSRLGGTCVNVGCVPKKIMFNAASVHDILENSRHYGFDT
TRXR1_CAEEL     ---LIVIGGGSGGLAAAKEASRLGKKVACLDSWGLGGTCVNVGCIPKKLMHQASLLGHSIHDAKKYGWKL
TRXR1_RAT       ----------------------------------------------------------------------
MERA_SERMA      -----------------------GAQVTLIERGTIGGTCVNVGCVPSKIMIRAAHIAHLRRESPFDG---
NAOX_METJA      ----------------------------------------------------------------------
NORW_ERWCT      ----------------------------------------------------------------------
AIFM3_MOUSE     ----------------------------------------------------------------------
TRXB_LISMO      ---VIIIGAGPAGMTAALYTSRADLDTLMIERGVPGGQMVNT-------------------------AEV
CDR_PYRFU       ----------------------------------------------------------------------
NORW_CITK8      ----------------------------------------------------------------------
NORW_ECOLU      ----------------------------------------------------------------------
NORW_ECOL5      ----------------------------------------------------------------------
MDAR1_ARATH     ----------------------------------------------------------------------
NORW_SHIFL      ----------------------------------------------------------------------
NORW_SHIF8      ----------------------------------------------------------------------
NORW_ECOL6      ----------------------------------------------------------------------
XECC_XANP2      ----------------------------------------------------------------------
NORW_SHISS      ----------------------------------------------------------------------
NORW_ECOUT      ----------------------------------------------------------------------
NORW_ECOK1      ----------------------------------------------------------------------
NORW_ECO45      ----------------------------------------------------------------------
NAPE_ENTFA      ----------------------------------------------------------------------
NORW_ECOSM      ----------------------------------------------------------------------
NAOX_ENTFA      --KVVVVGCTHAGTSASILANHPEAEVTVYERDNISFLSCIALYVGGVVKNAADLFYSNPEELASLGATV
TRXB_METJA      ----IIIGAGPGGLTAGIYAMRGKLNALCIEKENAGG------------------------RIAEAGI-V
NORW_KLEP7      ----------------------------------------------------------------------
TRXB_LISIN      ---VIIIGAGPAGMTAALYTSRADLDTLMIERGVPGGQMVNT-------------------------AEV
NORW_ECO27      ----------------------------------------------------------------------
NAOX_STRP6      ----------------------------------------------------------------------
NORW_SALTI      ----------------------------------------------------------------------
NORW_KLEP3      ------------------------------------------------TLIAADSMDEYNKPDLSHVISR
CDR_PYRAB       ----------------------------------------------------------------------
NORW_ESCF3      ----------------------------------------------------------------------
NORW_ECOHS      ----------------------------------------------------------------------
NORW_ECO8A      ----------------------------------------------------------------------
NORW_ECO5E      ----------------------------------------------------------------------
NORW_ECO57      ----------------------------------------------------------------------
NORW_ECO55      ----------------------------------------------------------------------
OOXA2_RHIME     ---VLISGAGPAGMTAALEASAAGARVAVLDENPRPGGQIYRDI-------------------------T
NORW_SALHS      ----------------------------------------------------------------------
NORW_SALEP      ----------------------------------------------------------------------
NORW_SALTY      ----------------------------------------------------------------------
NORW_SALA4      ----------------------------------------------------------------------
NORW_SALSV      ----------------------------------------------------------------------
NORW_SHIDS      ----------------------------------------------------------------------
NORW_SALG2      ----------------------------------------------------------------------
NORW_ECOSE      ----------------------------------------------------------------------
NORW_ECO24      ----------------------------------------------------------------------
NASD_BACSU      ----------------------------------------------------------------------
TRXB_CHLPN      -SRLIIIGSGPSGYTAAIYASRALLHPLLFEGSGISGGQLMT---------TTEVENFPGFPEGILGPKL
NORW_ECOLI      ----------------------------------------------------------------------
NORW_ECOLC      ----------------------------------------------------------------------
NORW_ECODH      ----------------------------------------------------------------------
NORW_ECOBW      ----------------------------------------------------------------------
Y636_METJA      --KIAVVGAGPAGRTSAMFLAKNGFDVDLFEKDRVGGTCLNYGCT-----YITGLR-EMADIINNLSILK
NORW_SHIBS      ----------------------------------------------------------------------
NORW_SHIB3      ----------------------------------------------------------------------
RURE_ACIAD      MHPIVIIGSGMAGYTLAREFRKLNPEHELV-------------------MICADDAVNYAKPTLSNALSG
NASB_BACSU      ----------------------------------------------------------------------
TRXB_CHLTR      --KLVIIGSGPAGYTAAIYASRALLTPVLFEGSGIAGGQLMT---------TTEVENFPGFPEGVLGHQL
NORW_VIBFM      ----------------------------------------------------------------------
CDR_PYRKO       ----------------------------------------------------------------------
NORW_SALAR      ----------------------------------------------------------------------
CDR_PYRHO       ----------------------------------------------------------------------
MDAR_PEA        ----------------------------------------------------------------------
NORW_SALPC      ----------------------------------------------------------------------
NORW_SALCH      ----------------------------------------------------------------------
CDR_STAHJ       ----------------------------------------------------------------------
TRXB_CHLMU      --KLAIIGSGPAGYTAAIYASRALLTPILFEGSGIAGGQLMT---------TTEVENFPGFPQGVLGHQL
TRXB_STRCL      ---VIIIGSGPAGYTAALYTARASLQPLVFEGAVTAGGALMN---------TTDVENFPGFRDGIMG---
MDAR3_ARATH     ----------------------------------------------------------------------
MDARS_CUCSA     ----------------------------------------------------------------------
BEDA_PSEPU      ----------------------------------------------------------------------
NORW_SALPK      ----------------------------------------------------------------------
NORW_SALPA      ----------------------------------------------------------------------
AHPF_STAES      ---VLIVGGGPASGSAAIYTARKGLRTGIVA-DRIGGQ--VND-------------TAGIENFITVKETT
AHPF_STAEQ      ---VLIVGGGPASGSAAIYTARKGLRTGIVA-DRIGGQ--VND-------------TAGIENFITVKETT
NORW_ENT38      ----------------------------------------------------------------------
CDR_STAAW       ----------------------------------------------------------------------
CDR_STAAS       ----------------------------------------------------------------------
CDR_STAAN       ----------------------------------------------------------------------
CDR_STAAM       ----------------------------------------------------------------------
CDR_STAAB       ----------------------------------------------------------------------
CDR_STAA9       ----------------------------------------------------------------------
CDR_STAA2       ----------------------------------------------------------------------
CDR_STAA1       ----------------------------------------------------------------------
AHPF_STAAW      ---VLIVGGGPASGSAAIYTARKGLRTGIVA-DRIGGQ--VND-------------TAGIENFITVKETT
AHPF_STAAN      ---VLIVGGGPASGSAAIYTARKGLRTGIVA-DRIGGQ--VND-------------TAGIENFITVKETT
AHPF_STAAM      ---VLIVGGGPASGSAAIYTARKGLRTGIVA-DRIGGQ--VND-------------TAGIENFITVKETT
AHPF_STAAC      ---VLIVGGGPASGSAAIYTARKGLRTGIVA-DRIGGQ--VND-------------TAGIENFITVKETT
AHPF_STAA8      ---VLIVGGGPASGSAAIYTARKGLRTGIVA-DRIGGQ--VND-------------TAGIENFITVKETT
TRXB_STAAW      ---IAIIGAGPAGMTAAVYASRANLKTVMIERGIPGGQMANTEEVENEMITGPDLSTKMFEHAKKFGA--
TRXB_STAAS      ---IAIIGAGPAGMTAAVYASRANLKTVMIERGIPGGQMANTEEVENEMITGPDLSTKMFEHAKKFGA--
TRXB_STAAR      ---IAIIGAGPAGMTAAVYASRANLKTVMIERGIPGGQMANTEEVENEMITGPDLSTKMFEHAKKFGA--
TRXB_STAAN      ---IAIIGAGPAGMTAAVYASRANLKTVMIERGIPGGQMANTEEVENEMITGPDLSTKMFEHAKKFGA--
TRXB_STAAM      ---IAIIGAGPAGMTAAVYASRANLKTVMIERGIPGGQMANTEEVENEMITGPDLSTKMFEHAKKFGA--
TRXB_STAAC      ---IAIIGAGPAGMTAAVYASRANLKTVMIERGIPGGQMANTEEVENEMITGPDLSTKMFEHAKKFGA--
NAOX_MYCPN      ----------------------------------------------------------------------
AIFM1_HUMAN     ----------------------------------------------------------------------
FENR_SALAI      ---VAVIGAGPSGLFAAYYAGFRGLSVAVVDALPEPGGQV-TAMYPEKLIH-----------------DV
CDR_STAAR       ----------------------------------------------------------------------
NORW_SALNS      ----------------------------------------------------------------------
NORW_SALDC      ----------------------------------------------------------------------
R34K_CLOPA      ---LVIIGAGPAGLTAAIYAIRAKLNTLVLENELVGG----------------QIRETYTVENFP-GFNV
NORW_VIBVU      ----------------------------------------------------------------------
NORW_ECO81      ----------------------------------------------------------------------
FENR_SALTO      ---IAVVGAGPAGLFAAYYAGFRGLSVAVVDALPEPGGQI-TAMYPEKLIH-----------------DV
AHPF_STAAR      ---VLIVGGGPASGSAAIYTARKGLRTGIVA-DRIGGQ--VND-------------TAGIENFITVKETT
AIFM1_DICDI     ----------------------------------------------------------------------
TRXB_RICFE      -TKVLIIGSGPAGLSAAIYTARAALKPILINGMQPGGQLTITTDVENYPGFAETVQGPWLMEQMSMQANV
TRXB_MYCSM      ----------------------------------------------------------------------
MDAR2_ARATH     ----------------------------------------------------------------------
YMER_STAAU      ----------------------------------------------------------------------
AIFM1_RAT       ----------------------------------------------------------------------
AIFM1_MOUSE     ----------------------------------------------------------------------
AHPF_STAAS      ---VLIVGGGPASGSAAIYTARKGLRTGIVA-DRIGGQ--VND-------------TAGIENFITVKETT
TODA_PSEP1      ----------------------------------------------------------------------
STHA_PECCC      ----------------------------------------------------------------------
CDR_STAES       ----------------------------------------------------------------------
CDR_STAEQ       ----------------------------------------------------------------------
TRXB_RICCN      -TKVLIIGSGPAGLSAAIYTARAALKPILINGMQPGGQLTITTDVENYPGFAETVQGPWLMEQMYMQANV
NORW_VIBVY      ----------------------------------------------------------------------
NORW_ECO7I      ----------------------------------------------------------------------
NIRB_KLEOX      ----------------------------------------------------------------------
NAOX_LACLM      ----------------------------------------------------------------------
TRXB_STRCO      ---VIIIGSGPAGYTAALYTARASLKPLVFEGAVTAGGALMN---------TTEVENFPGFQDGIMG---
TRXB_SCHPO      --KVVIIGSGPAGHTAAIYLARGELKPVMYEANGIAAGGQLTTTT-----------------------DV
FENR_LACCB      --EITVIGGGPVGMFAAFYAGLRQADVLLLESDELGGQT--GNLYPDKILY-----------------DI
FENR_LACC3      --EITVIGGGPVGMFAAFYAGLRQADVLLLESDELGGQT--GNLYPAKILY-----------------DI
TRXB_BACSU      ---VIIIGAGPAGMTAAVYTSRANLSTLMIERGIPGGQMANTE-------------------------DV
TRXB_STAES      ---VAIIGAGPAGMTAAVYASRANLKTVMIERGMPGGQMANTE-------------------------EV
TRXB_STAEQ      ---VAIIGAGPAGMTAAVYASRANLKTVMIERGMPGGQMANTE-------------------------EV
THCD_RHOER      ----------------------------------------------------------------------
TERPA_PSESP     ----------------------------------------------------------------------
FENR1_BACP2     ---VTIIGGGPAGMYTAFYSGMRDLKTKVLENESLGGKILL---YPEKVIW-----------------DV
DHNA_BACSU      ----------------------------------------------------------------------
CDR_STAA8       ----------------------------------------------------------------------
TRXB_SPIBA      ---LVIVGGGPGGLAAAIYAGRAGLTPVIF-----------LGIETSSQLMTTTEVENYPGFKTIQG---
TRXB_COXBU      ----------------------------------------------------------------------
HCAD_ECOLU      ----------------------------------------------------------------------
CDR_STAS1       ----------------------------------------------------------------------
CDR_STAAT       ----------------------------------------------------------------------
CDR_STAAE       ----------------------------------------------------------------------
CDR_STAAC       ----------------------------------------------------------------------
CDR_STAA3       ----------------------------------------------------------------------
TRXB_BORBU      ----------------------------------------------------------------------
DHNA_BACYN      ----------------------------------------------------------------------
CAMA_PSEPU      ----------------------------------------------------------------------
AIFM3_HUMAN     ----------------------------------------------------------------------
TRXB_RICPR      -TKVLIIGSGPAGLSAAIYTARSALKPILINGMQPGGQLTMTTDVENYPGFAETIQGPWLMEQMSMQANV
NORW_SERP5      ----------------------------------------------------------------------
HCAD_ECO24      ----------------------------------------------------------------------
HCAD_ECO7I      ----------------------------------------------------------------------
HCAD_ECOSM      ----------------------------------------------------------------------
AIFM1_DROME     ----------------------------------------------------------------------
AHPF_PSEPU      ----------------------------------------------------------------------
AHPF_PSEPK      ----------------------------------------------------------------------
TRXB_RICTY      -TKVLIIGSGPAGLSAAIYTARSSLKPILINGMQPGGQLTMTTDVENYPGFAKTIQGPWLMEQMSIAKNV
TRXB_ECOLI      ----------------------------------------------------------------------
TRXB_ECO57      ----------------------------------------------------------------------
TRXB_DICDI      --KVVIIGSGPAGHTAGIYAGRARLEPLMFEGFMAGG-------VAAGGQLTT---TTEIENFPGFPIDI
NORW_SALPB      ----------------------------------------------------------------------
NORW_AERS4      ----------------------------------------------------------------------
MDAR_SOLLC      ----------------------------------------------------------------------
AHPF_XANCH      ----------------------------------------------------------------------
AHPF_SALTY      ----------------------------------------------------------------------
MDAR4_ARATH     ----------------------------------------------------------------------
HCAD_ECOSE      ----------------------------------------------------------------------
HCAD_ECO5E      ----------------------------------------------------------------------
HCAD_ECO57      ----------------------------------------------------------------------
HCAD_ECO55      ----------------------------------------------------------------------
FENR_FRASC      ----------------------------------------------------------------------
HCAD_ECOLI      ----------------------------------------------------------------------
HCAD_ECOLC      ----------------------------------------------------------------------
HCAD_ECOHS      ----------------------------------------------------------------------
HCAD_ECODH      ----------------------------------------------------------------------
HCAD_ECOBW      ----------------------------------------------------------------------
TRXB_MYCPU      ---VAIIGAGPGALTAAIYTSRGNLDTVFIDNAAPGGKLIYASKIPGDTIVGTDLAIRFFEHAQAFGA--
AHPF_ECOLI      ----------------------------------------------------------------------
TRXB_EUBAC      ----------------------------------------------------------------------
FENR_LACF3      ----------------------------------------------------------------------
TRXB_CLOLI      ----------------------------------------------------------------------
MDARP_ARATH     ----------------------------------------------------------------------
HCAD_PHOLL      ----------------------------------------------------------------------
FENR_ACHLI      ----------------------------------------------------------------------
DLDH_HYMDI      ---LVVIGSGPGGYVAAIKAAQLGMLTVCIEKPTFGGTCLNVGCIPSK----------------------
YDGE_SCHPO      ----------------------------------------------------------------------
FENR_FRAAA      ----------------------------------------------------------------------
FENR1_BACSK     ----------------------------------------------------------------------
NIRB_ECOLI      ----------------------------------------------------------------------
MNMG_PERMH      ---VVVIGGGHAGIEAALASAKLGVKTALIDKEKVG----LMPCNPAIGGIAKGI---VVREIDAFGGEM
TRXB_RICBR      -TKVLIIGSGPAGLSAAIYAARASLNPILINGIQPGGQLTITTDVENYPGFAESVQGPWLMEQMRMAENV
GGR2_METBU      ---VIVVGAGPGGSIAAKTAAKEGLDVLMIEKEGVGKFHLKQHIEPDPRWICADVKGSYIISPDGTRIEM
FENR_SYMTH      ---VTLIGAGPTGLFGVFYAGMRGMKTKVIEAPEVGGQ--LAALYPEKDIF-----------------DV
FENR_RALPJ      -TDVLVVGAGPVGLFAAFQAGVLGMSCVLVDADRPGGQ--CTELYPEKPIYDIPALVSCTAQ--------
BAIH_EUBSP      --KVLVIGAGPGGMMAAVTAAERGHDVTVWEADDIGGQLNLAVVAPGK----------------------
NIR_EMENI       ----------------------------------------------------------------------
FENR_LACRJ      ----------------------------------------------------------------------
FENR_LACRD      ----------------------------------------------------------------------
BPHG_BURXL      ----------------------------------------------------------------------
AHPF_PSEAE      ----------------------------------------------------------------------
TRXB_NEUCR      -SKVVIIGSGPAAHTAAIYLARAELKPVLYEANGIAAGGQLTTTTEIENF-----------PGFPDGI-M
FENR_ACIC1      ----------------------------------------------------------------------
TRXB_TREPA      ----------------------------------------------------------------------
TODA_PSEPU      ----------------------------------------------------------------------
FENR_STRSY      ---ITIIGGGPVGLFAAFYAHLRQAKVKIIDSPQLGGQPAIL--YPEKAILDIPAFPSLTGQELTDNL--
FENR_STRS2      ---ITIIGGGPVGLFAAFYAHLRQAKVKIIDSPQLGGQPAIL--YPEKAILDIPAFPSLTGQELTDNL--
BNZD_PSEPU      ----------------------------------------------------------------------
THI4_HALWD      -TEVIIVGGGPSGLVTAKELAERGVDVTIVEKNNXXXMNKVTVRDPAQSVL-DELDVPYEESDEASGLYV
FENR_NOCSJ      ---LLVIGAGPTGLFATYYAGFRGFRVAVVDSPELGGQ--ITAMYPEKQIL-----------------DV
FENR_LACDB      ----------------------------------------------------------------------
FENR_LACDA      ----------------------------------------------------------------------
TRXB_PENCH      ----------------------------------------------------------------------
TRXB1_ARATH     ----------------------------------------------------------------------
MNMG_SULSY      ---VVVIGGGHAGIEAALASAKLGTKTALIDKEKIG----LMPCNPSIGGIAKGI---VVREVDALG---
FENR2_BACSK     MFDLTIIGGGPAGLFAAFYAGMRKMKVKVIESPQLGGQ--LSALYPDKYIY-----------------DV
FENR1_OCEIH     ---VTIVGGGPAGLYSAFYSGLREMKTKIIDYQAELGGKV--HIYPEKVIWDIGGLTP-----------M
TRXB_YARLI      ---VVIIGSGPAAHTAAIYLSRAEIKPTLYEANGIAAGGQLTT--------TTEIENFPGFPDGIMGSQL
NORW_AERHH      ----------------------------------------------------------------------
FENR_SULTO      ---MVVIGGGPVGLYATFYAGLRDMKALLIDQDELGGQ--LVTLYPEKMILAYELAQQLVEQAKMFSPDI
FENR_BURVG      ----------------------------------------------------------------------
FENR1_EXIS2     ---VTIIGGGPVGLFTAFYSGMRQMKTKVIESPQLGGQ------------LATLYPEKYIYDIAGFP---
TRXB_ASHGO      --KVTIIGSGPAAHTAAIYLARAEIKPTLYEANGVAAGGQLTTTT-----------------------EI
TRXB2_ARATH     -TKVCIVGSGPAAHTAAIYASRAELKPLLFE------GWMANDIAPGGQLTTTTDVENFPGPEGILGIDI
NORW_VIBF1      ----------------------------------------------------------------------
FENR1_BACA2     ----------------------------------------------------------------------
TRXB_CANGA      --KVVIIGSGPAAHTAAIYLARAEIKPTMYEANGIAAGGQLTTTT-----------------------EI
GGR_UNCMA       ---VIVVGAGPGGSLAAKTAAEQGLDVLLIEKEGVGKAGLQEFVEPDPKWISADIKCARIFSPDGTMVEL
FENR_BURP8      ----------------------------------------------------------------------
FENR1_BACSU     ----------------------------------------------------------------------
THI4_HALSA      -TDVIIVGGGPSGLMAAKELADRDVDVTIIEKNNXXXMNKLTVRSPAEAVL-DDLGVPYEYDEENDGLAV
THI4_HALS3      -TDVIIVGGGPSGLMAAKELADRDVDVTIIEKNNXXXMNKLTVRSPAEAVL-DDLGVPYEYDEENDGLAV
PYRD1_MOUSE     ----------------------------------------------------------------------
FENR2_OCEIH     ---VTIIGAGPTGLFTAFYGGMREASVKIIESPHIGGQ--LTALYPEK----------YIYDIA--GFPK
PYRD1_RAT       ----------------------------------------------------------------------
DHNA_ECOLI      ----------------------------------------------------------------------
TRXB_BUCAI      ----------------------------------------------------------------------
CRTI_MYXXA      ---VIVVGAGPGGLSAAINLAGQGFRVTVVEKDAVPG---------------------------------
PURT_SYNP6      ----------------------------------------------------------------------
PURT_SYNE7      ----------------------------------------------------------------------
MNMG2_FUSNN     ---IIVVGGGHAGCEAALASARMGMKTAIISLDTIG----VMSCNPS---LGGPAKSHLAREIDALGGEM
FENR_PROVI      ----------------------------------------------------------------------
MNMG_DESAP      ---VIVVGGGHAGCEAALASARLGCRTLLLTL-----SIDFVALMPCNPAIGGPGKSHLVREIDALGGEM
FENR_IGNH4      ----------------------------------------------------------------------
FENR_DEIGD      -TEILVIGGGPAGLHAAFYAAWRGLSVRVLEARGEVGGQLL-----------------------------
DHA_BACSH       ----------------------------------------------------------------------
YEIT_ECO57      --KVAIIGAGPAGLQASVTLTNQGYDVTIYEKEAHPG-GWLRNGIPQFRL-PQSVLDAEIARIEKMGVTI
TRXB_MYCPN      ----------------------------------------------------------------------
TRMFO_RHIME     -----VIGGGLAGSEAAWQIAEAGVPVILHEMRGVRG----TDAHKTESLAELVCSNSFRSDDATSNA-V
MNMG_MYCPN      ---LTVIGGGHAGLEAAFIASKLGLKVNVLDPNHVGSC-------PCNPAIGGPAKGIVTREIDVLG---
MNMG_CAMHC      ---IIVIGGGHAGIEACLAAARMGAKTLLITAEQIGAAS----CNPA---IGGLAKGHLVKEIDALGGQM
YEIT_SALTY      --KVAIIGAGPAGLQASVTLTHLGYDVTIYEKQPQPG-GWLRHGIPAFRL-PQSVLDQEIARIVEMGVNI
YEIT_SALTI      --KVAIIGAGPAGLQASVTLTHLGYDVTIYEKQPQPG-GWLRHGIPAFRL-PQSVLDQEIARIVEMGVNI
THI4_HALMA      ---VIIVGGGPSGLMAAKELAERGVQVMVVEKNNXXXMNKVTVRDPAQQVL-DELEVDHKRSKDSEGLYV
TETX_BACFR      ---VAIIGGGPVGLTMAKLLQQNGIDVSVYERDNFGGTLDLHKGSGQEAMKKAGLLQTYYDLALPMGVNI
STCD_RHIME      --KVVVVGTGPAGLEAARVAGERGHEVIVFEAASDPGGQVRLTAQSPRRREMISIIDWRMSQCEKLGVTF
MICA2_HUMAN     -TKCLIVGGGPCGLRTAIELAYLGAKVVVVERDSFSRNNVL-----------------------------
FTHS_ARATH      ----------------------------------------------------------------------
YPDA_BACSU      --KAIIIGGGPCGLSAAIHLKQIGIDALVIEKGNV-----------------------------------
MNMG_COXBU      ---VIVVGGGHAGTEAALVAARMGARTLLLTHETLGQMS----CNPA---IGGIGKSHLVKEIDALG---
MNMG_COXBR      ---VIVVGGGHAGTEAALVAARMGARTLLLTHETLGQMS----CNPA---IGGIGKSHLVKEIDALG---
MNMG_COXBN      ---VIVVGGGHAGTEAALVAARMGARTLLLTHETLGQMS----CNPA---IGGIGKSHLVKEIDALG---
MNMG_CAMFF      ---VIVVGGGHAGIEASLAAAKMGAKTLLITAEQIGAAS----CNPA---IGGLAKGHLVKEIDALGGQM
PYRD1_PONAB     ----------------------------------------------------------------------
MNMG_UREPA      ---VIVIGAGHAGLEAAFATSNLNLQTALITLDGIG----MMPCNPS---IGGPAKGIVTREIDALG---
MNMG_UREP2      ---VIVIGAGHAGLEAAFATSNLNLQTALITLDGIG----MMPCNPS---IGGPAKGIVTREIDALG---
MICA2_MOUSE     -TKCLIVGGGPCGLRTAIELAYLGAKVVVVEK--------------------------------------
LSDA_DROME      ----------------------------------------------------------------------
HMT2_SCHPO      ----------------------------------------------------------------------
FTHS_SPIOL      ----------------------------------------------------------------------
YEIT_ECOLI      --KVAIIGAGPAGLQASVTLTNQGYDVTIYEKEAHPG-GWLRNGIPQFRL-PQSVLDAEIARIEKMGVTI
TRMFO_SINMW     ---VHVIGGGLAGSEAAWQIAEAGVPVILHEMRGVRG----TDAHKTDSLAELVCSNSFRSDDATSNA-V
PURT_CHLTE      ----------------------------------------------------------------------
MNMG_XANOR      ---VIVIGGGHAGTEAALASARAGAHTLLLTHETVGAMS----CNPA---IGGIGKGHLVKEIDALG---
MNMG_XANOM      ---VIVIGGGHAGTEAALASARAGAHTLLLTHETVGAMS----CNPA---IGGIGKGHLVKEIDALG---
MNMG_UREU1      ---VIVIGAGHAGLEAAFATSNLNLQTALITLDGIG----MMPCNPS---IGGPAKGIVTREIDALG---
MNMG_BACSK      ---VIVIGAGHAGVEAGLAAARMGANTLMLTLN--LDAVAFMPCNPS---VGGPAKGIVVREIDALGGEM
LEU1_PROMP      ----------------AIVGANAFAHESGIHQDGVLKNRLTYEIIDAKTVGLNDNKISLGKLSGRSAVRA
FENR_RHORT      ----------------------------------------------------------------------
AHPF_XANCH      --RVAVIGGGNSGVEAAIDLAGIVAHVTLVEDDKLRADEVLQRKLRSNVRIITSAQTTEVGDGQKVTGLV
AHPF_PSEAE      --RVAVIGGGNSGVEAAIDLAGIVAHVTLLEFD----SKLRADAVLQRKLVITSALTSEVKDGQKVTGLV
DHA_BACSH       --KVTVIGGGIAGTNAAKIAVGMGADVTVID---------------------------------------


                         .         .         *         .         .         .         .:140
query           GNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAVGDERIRADVVLI
DLDH1_BACSU     EN-------VTVDFTKVQEWKASVVNKLTGGVAGLLKGNKVDVVKGEAYFVDSNSVRVMDENSAQTYTII
DLDH_CHLPN      -------DGYTIDYPAMAKRKNTVVQGIRQGLEGLIRSNKITVLKGTGSLVSSEVKVIGQDTIKANHIIL
DLDH_ZYMMO      FKPDFDLDKIIARSREVATRL-----ASGVKTL--LRKNKVEVISGVGQLTGNQQMLVGEEKIEAKDIII
DLDH_HALVO      VDMSQLRDWKSGVVDQLTGGVEKLCKAN-----------GVNLVEGTARFKDENAVRIGSETIEFEHCII
DLDH_CHLTR      EG-------FSINYPAMVQRKDSVVRSIRDGLNGLIRSNKITVFSGRGSLISSTEVKILGENIKAHSIIL
DLDH_CHLMU      NGFSIDYPAMVQRKDTVVRSIR--------DGLNGLRSNKITVFSGRGSLISSTEVKILGETIKAQSIIL
DLDH1_BACST     EN-------VTIDFAKVQEWKASVVKKLTGGVEGLLKGNKVEIVKGEAYFVDANTVRVGDQTYTFKNAII
DLDH_STAAW      -------ESVSLNFQKVQEFKSSVVNKLTGGVEGLLKGNKVNIVKGEAYFVDNNSLRVMDEKSAQTYAII
DLDH_STAAU      -------ESVSLNFQKVQEFKSSVVNKLTGGVEGLLKGNKVNIVKGEAYFVDNNSLRVMDEKSAQTYAII
DLDH_STAAS      -------ESVSLNFQKVQEFKSSVVNKLTGGVEGLLKGNKVNIVKGEAYFVDNNSLRVMDEKSAQTYAII
DLDH_STAAR      -------ESVSLNFQKVQEFKSSVVNKLTGGVEGLLKGNKVNIVKGEAYFVDNNSLRVMDEKSAQTYAII
DLDH_STAAN      -------ESVSLNFQKVQEFKSSVVNKLTGGVEGLLKGNKVNIVKGEAYFVDNNSLRVMDEKSAQTYAII
DLDH_STAAM      -------ESVSLNFQKVQEFKSSVVNKLTGGVEGLLKGNKVNIVKGEAYFVDNNSLRVMDEKSAQTYAII
DLDH_STAAC      -------ESVSLNFQKVQEFKSSVVNKLTGGVEGLLKGNKVNIVKGEAYFVDNNSLRVMDEKSAQTYAII
DLDH_CHLP8      SE-------LSFDLAQAXXXXXXXXXXXXXGVEFMLKKAKVEVWRGEAVLTGSKGVKVGSERLEAANIIV
DLDH_CHLTE      GN-------VSFDLAQAVKRSRNVALKSSKGVAYLLKKXXXXXXXXXXXXTGGAMVTMPDGSVRAKNIIV
DLDH2_HALMA     --DPAVDMAGMTEWK--DGVVTRLTRG----VESLCKNAGVNLVEGTAEFVDDGTVRVGSESLSFEHAIV
DLDH_THESC      --KPE------LDLKKLGAWRDGVVKKLTGGVAGLLKGNKVELLRGFARFKGPREIEVNGETYGAQSFII
DLDH3_PSEAE     SPELDLAQMMKQKDESVAALTRGVEFL--------FRKHKVQWIKGWARLQGEGRVGVGHAQLEARDIVI
DLDH3_PSEPU     KPTLNLAQMMKQKDESVTGLTKGIEYL--------FRKNKVDWIKGWGRLDGVGKVVVKAEALQAKDIVI
DLDH_PIG        SE-------VRLNLEKMMEQKSNAVKALTGGIAHLFKQNKVVRVNGYGKITGKNQVTASTEVINTKNILI
DLDH_CANFA      SE-------VRLNLEKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTASTQVIDTKNILI
DLDH_MOUSE      ---PE----VRLNLEKMMEQKHSAVKALTGGIAHLFKQNKVVHVNGFGKITGKNQVTASTQVIDTKNILV
DLDH_CRIGR      SE-------VRLNLEKMMEQKSSAVKALIGGIAHLFKQNKVVHVNGFGKITGKNQVTASSQVIGTKNILI
DLDH_RAT        ---PE----VRLNLEKMMEQKRSAVKALTGGIAHLFKQNKVVHVNGFGKITGKNQVTASTQVIGTKNILI
DLDH_MACFA      SE-------VRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVIHVNGYGKITGKNQVTAGTQVVDTKNILI
DLDH_HUMAN      SE-------VRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTAGTQVIDTKNILI
DLDH_AZOVI      GE-------VAIDVPTMIARKDQIVRNLTGGVASLIKANGVTLFEGHGKLLAGKKVEVSSQVLDTENVIL
DLDH_PONAB      SE-------VRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTAGTQVIDTKNILI
DLDH2_BACSU     AG-------VSLNFEKVQQRKQAVVDKLAAGVNHLMKKGKIDVYTGYGRILGPSIFSPGEENLIPKQVII
DLDH1_PSEAE     --QAPSIDIARVEWK--DAIVDRLTSG----VAALLKKHGVDVVQGWARILDGKSVAVGSQRIECEHLLL
DLDH_PSEFL      KG-------VTIDVPAMVARKANIVKNLTGGIATLFKANGVTSFEGHGKLLANKQVEVTGQVLEAENVII
DLDH2_PSEAE     KG-------VTIDVPAMVARKANIVKNLTGGIATLFKANGVTSFEGHGKLLANKQVEVTGQVLEAENVII
DLDH2_PSEPU     GE-------VKMDVAAMVGRKAGIVKNLTGGVATLFKANGVTSIQGHGKLLAGKKVEVTKEVIEAENVIL
DLDH_SHIFL      GEPKTDIDKIRTKEKVINQLTGGLA--------GMAKGRKVKVVNGLGKFTGANTLEVEGENINFDNAII
DLDH_SCHPO      -----DTKRRGIDVSGVSVNLSQMMKAK--DDSVKSLTSGIEYLFGTGSFIDPQTLSVADQTIKAKNFII
DLDH_ECOLI      GEPKTDIDKIRTKEKVINQLTGGLA--------GMAKGRKVKVVNGLGKFTGANTLEVEGENINFDNAII
DLDH_ECOL6      GEPKTDIDKIRTKEKVINQLTGGLA--------GMAKGRKVKVVNGLGKFTGANTLEVEGENINFDNAII
DLDH_ECO57      GEPKTDIDKIRTKEKVINQLTGGLA--------GMAKGRKVKVVNGLGKFTGANTLEVEGENINFDNAII
MERA_STAES      STGAADLAQLTEQK---DGLVSQMRQEKYIDL---IEEYGFDLIRGEASFIDDKTIQVNGQNITSKSFLI
MERA_STAAU      STGAADLAQLTEQK---DGLVSQMRQEKYIDL---IEEYGFDLIRGEASFIDDKTIQVNGQNITSKSFLI
DLDH_PEA        SN-------VEIDLAAMMGQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKFVSPSEISVDNTVVKGKHIII
DLDH_YEAST      ANFQKAKDDAGIELLFKKNKVTYYKGNGSFEDETKIRVTPVDGLEGTVK--EDHILDVKN-------IIV
GSHR_ANASP      GKAELNWEHF---ITSIDKEVRRLSQLH----ISFLEKAGVELISGRATLVDNHTVEVGERKFTADKILI
DLDH1_PSEPU     ASP-------RLDIGQSVAWKDGIVDRLTTGVAALLKKHGVKVVHGWAKVLDGKQVEVDGQRIQCEHLLL
DLDH_BUCAI      -NKPXXXXXXXXNWK------QHIVNKLTDGLSSMRKKRKIRIFQGHAIFTDKSLCVTNTETIFFDNAII
DLDH3_HALMA     DPTVALDEMINWKDGVVDQLTSGIEQLCTA--------AGVNLLKGTAEFADENKVRIGSESLKFENCII
DLDH_MYCPN      NGQ------VALNWNQLLEQXXXXXXXXXXXXXAIIASAKAETVMGEAKVLDPNTVEVAGKTYTTKSIVV
DLDH_HALSA      DPDVDVAEMVDWKVDQLTGGVEKLCKAN-----------GVNLIEGRAEFAGSDKLRVGSETIEYEHAIV
DLDH_MANSE      GE-------VKFNFKAMMDYKVNAVKALTGGIAMLFQKNKVKLVRGAGTIVAPNXXXXXXXXXXXTVILI
STHA_MYCTU      ----RVKD--RITPADLLARTQHVIGKEVDVVRNQLMRNRVDLIVGHGRFIDPHTILVEDQARRGDYIII
STHA_MYCTA      ----RVKD--RITPADLLARTQHVIGKEVDVVRNQLMRNRVDLIVGHGRFIDPHTILVEDQARRGDYIII
STHA_MYCBT      ----RVKD--RITPADLLARTQHVIGKEVDVVRNQLMRNRVDLIVGHGRFIDPHTILVEDQARRGDYIII
STHA_MYCBP      ----RVKD--RITPADLLARTQHVIGKEVDVVRNQLMRNRVDLIVGHGRFIDPHTILVEDQARRGDYIII
STHA_MYCBO      ----RVKD--RITPADLLARTQHVIGKEVDVVRNQLMRNRVDLIVGHGRFIDPHTILVEDQARRGDYIII
DLDH_BUCBP      -------EKLDINLKEIQCNQKKIIESFSSGISNLARKRNVRIIFGYAKFLDANSIFVQGEHVSFNKIVI
MERA_THIFE      ---PFDGGIQAVA-PTIQRTALLVQQQARVDELRHAKYEGITVLRGEARFKDSRSVVVGERVVMFDRCLV
DLDH_HAEIN      -SEP------RIELDEVRAGKEAVVAKLTGGLAGMAKARKVTVVEGLATFTDSHTLVARDRTVKFDNAII
DLDH_BUCAP      XXXXXXXXXXXXXXXXXXXXL-------TTGLSNMGEKRKVRIVQGKALFNTDHSVLVKNKKNDFTIAII
MERA_BACCE      S--ASNVDLAPL-VKQKNDLVTEMRNEKYV---NLIDDYGFELIKGESKFVNENTVEVNGNQITAKRFLI
DLDH_SYNY3      NG-------VTFTREAIAAHANDLVSKIQSDLTNSLTRLKVDTIRGWGKVSGPQVTVIGDNETRAKEIML
DLDH_RHOCA      GAK------VKVDWAKIDGNTKGIEFLFKKNKVTYLR--------GWGSIPAPGQVKVGDEVHTAKNIVI
GSHR_BURCE      AATSHSWTSLIAAKDAEIARLEGVYQ-RLIENAN------VEIFKGRAQIAGPNRVTVTGASVSARTILI
DLDH_VIBCH      GEPKTDIDKVRLKEKVINQLTGGLA--------GMAKMRKVNVVNGYGKFTGPNTIEVDGEEVTFDNAIV
GSHRP_SPIOL     GGELEDAKNYGWELEKIDFNWKKLLQKKTDEIIRLLSNAGVKLYEGEGKIVGPNEVQVTQLSYSAKHILI
DLDH1_ARATH     SS-------VEVDLPAMLAQKDNAVKNLTRGIEGLFKKNKVTYVKGYGKFISPNEVSVGNTIVKGKHIIV
MERA_ENTAG      GMPPTSPTILRERLLAQQARVEELRHAKYEGILDG--NSAITVLHGEARFKDDQSLIVGERVVMFDRCLV
DLDH_MYCGE      -NGXXXXXXXXXXXXXXEVVDKLVAGVKTI-----IKGAKVESIEGEATVIDKNKVQVXXXXXXXXXIIV
DLDH_VIBPA      GEPQTDINKIRIKEKVVNQLTGGLS--------GMAKMRNVTVVNGYGKFTGPNSILVEGEGVNFDNAIV
MERA_PSEAE      ATVP-----------TID-RSKLLAQQQAVDELRHAKYEGITVVHGEARFKDDQSLTVGERVVMFDRCLV
DLDH_MYCTU      -------GEVTFDYGIAYDRSRKVAEGRVAGVHFLMKKNKITEIHGYGTFADANTLLVGTESVTFDNAII
DLDH_MYCBO      -------GEVTFDYGIAYDRSRKVAEGRVAGVHFLMKKNKITEIHGYGTFADANTLLVGTESVTFDNAII
DLDH_RALEH      GD-------VKVDVAKMLKRKDDIVGKMTKGIEFLFRKNKVTLLKGYGKFVGKSAVDVAGEVVTAKQVII
GSHR_STRTR      GEYGFDVTINNFDFATLKANRQAYIDRIHGSFERGFDSNGVERVYEYARFVDPHTVEVAGELYTAPHILI
DLDH3_BACSU     -----PAGAISVDWSKMQSRKXXXXXXXXXXXXYLMKKNQIQVVKGTASFLSERKLLIGKEIREADQVLI
DLDH_MYCLE      GDASFDYGIAY-------DRSRKVSEGRVAGVHFLMKKNKITEIHGYGRFTDANTLSVELSKVTFNNVII
GSHRP_TOBAC     DVEPRFDWSTLIANK--NAELQRLTGIYK----NILKNAGVTLIEGRGKVVDPHTVDVDGKLYSAKNILI
DLDH2_ARATH     SS-------VEVDLPAMLAQKDTAVKNLTRGVEGLFKKNKVNYVKGYGKFLSPSEVSVDNVVVKGKHIIV
STHA_COLP3      NSNPQNEQVKQLTFQDILSHASAVIQKQVSLRSGFYNRNRVEHIQGQASFIDAHTISISHEKISAKQIMI
MERA_SHEPU      NHAPQLSRALLTQQQTARVEELRAAKYQNILETN----PALSLLKGWAQFKNANTLIVREQAVHADKILI
GSHRP_SOYBN     DSEPKHDWSSFIANK--NAELQRLTGIYK----NILNNAGVKLIEGHGKMIDPHTVDVNGKLYSAKHILV
MERA_PSEFL      ---PFDGGIAA----TVPARSKLLAQQQAVDELRHAKYEGITVLHGEARFKDDQSLVVGEREVTFDRCLV
DLDH_TRYBB      GGAGVTMDVAKM-------------QQQKEKSVNGL-TSGVEYLLGEAGFVTPNTLNVKDEAIEAKNTII
GSHRC_ARATH     -NEKVDKKLLQKEILRLNNIYKRL-----------LANAAVKLYEGEGRVVGPNEVEVRQISYTAKHILI
STHA_SERP5      TLSATFPDILRHADNVINQQTR---MRQGFYERNQCK-----LFAGDARFIDANTVSVSQDTIRADHIVI
STHA_PHOLL      NQNPLYSDNSRV-LRSSFAEILRRAE-MVINQQTRMRQNGCRMFSGEATFIDDHRVSVNHDILSADKIII
GSHRC_BRARP     NVDFNWKKLLQKEILRLNNIYKRL-----------LANAAVKLYEGEGRIVGPNEVEVRQISYTAKHILI
STHA_YERE8      NQNPLYSDNARTSFSDILNHADRVINQQTRMRQGFYDRNHCQMFSGDASFIDANTINVRNDTLRADNIVI
MERA_STRLI      ---------------------------------------GWQIVHGTATFADGPMLEVGTATVEAAHYLI
GSHR_PSEAE      GE-------AQFDWATLIGNKNREIQRLNGIYRNLLVNSGVTLLEGHARLLDAHSVEVDGQRFSAKHILV
GSHRP_PEA       DSEPKHDWSSLIANK--NAELQRLTGIYK----NTLKNAGVKLIEGRGKIVDAHTVDVDGKLYSAKHILV
STHA_CHRSD      G-EPRWFSFPRVLERTIDQQVEMRTQFYSRNRIN--------LFFGVARFRDEHTLTVRDEELCAQQFVI
GSHRP_ARATH     ETEPSHDWTTLIANK--NAELQRLTGIYK----NILSKANVKLIEGRGKVIDPHTVDVDGKIYTTRNILI
STHA_PSEA7      G-EPRWFSFPDVLKSADRVISKQVASRTGYYARNR-----IDMFTGTASFVDERTVEVAVERLVADQFVI
STHA_PSEAE      G-EPRWFSFPDVLKSADRVISKQVASRTGYYARNR-----IDMFTGTASFVDERTVEVAVERLVADQFVI
STHA_PSEAB      G-EPRWFSFPDVLKSADRVISKQVASRTGYYARNR-----IDMFTGTASFVDERTVEVAVERLVADQFVI
STHA_PSEA8      G-EPRWFSFPDVLKSADRVISKQVASRTGYYARNR-----IDMFTGTASFVDERTVEVAVERLVADQFVI
GSHR_NEUCR      EQTPFDWPTFKQKRDAYVARLNGIYE-------RNLANDKVEYVHGWAKLLSPNSVEVTLDDVNAKKILI
STHA_YERPY      NQNPLYSDNART-IKSSFADILNHAD-RVINQQTRMRQNHCHMFSGDASFIDANTVNVRSDTLQADNIVI
STHA_YERPS      NQNPLYSDNART-IKSSFADILNHAD-RVINQQTRMRQNHCHMFSGDASFIDANTVNVRSDTLQADNIVI
STHA_YERPP      NQNPLYSDNART-IKSSFADILNHAD-RVINQQTRMRQNHCHMFSGDASFIDANTVNVRSDTLQADNIVI
STHA_YERPN      NQNPLYSDNART-IKSSFADILNHAD-RVINQQTRMRQNHCHMFSGDASFIDANTVNVRSDTLQADNIVI
STHA_YERPG      NQNPLYSDNART-IKSSFADILNHAD-RVINQQTRMRQNHCHMFSGDASFIDANTVNVRSDTLQADNIVI
STHA_YERPE      NQNPLYSDNART-IKSSFADILNHAD-RVINQQTRMRQNHCHMFSGDASFIDANTVNVRSDTLQADNIVI
STHA_YERPB      NQNPLYSDNART-IKSSFADILNHAD-RVINQQTRMRQNHCHMFSGDASFIDANTVNVRSDTLQADNIVI
STHA_YERPA      NQNPLYSDNART-IKSSFADILNHAD-RVINQQTRMRQNHCHMFSGDASFIDANTVNVRSDTLQADNIVI
STHA_YERP3      NQNPLYSDNART-IKSSFADILNHAD-RVINQQTRMRQNHCHMFSGDASFIDANTVNVRSDTLQADNIVI
STHA_ERWCT      NQNPDNSRIIRSSFSDILRHADSVIGQQTRMRQGFYERNQCELFSGEASFIDAHTIAVHHETLTAANIII
MERA_ALCSP      ---PFDGGIAA----TVPARSKLLAQQQAVDELRHAKYEGITVLHGEARFKDDQSLAVGGERVVADRCLV
TYTR_TRYCO      -----DASTIKANWKTLIAAKNAAVLDINKSYEDMFKTEGLEFFLGWGALEQKNVVTVREERLQAEHIII
STHA_SODGM      NQSPGNTRLPHTGFSDILCHADQVINQQTHMRQGFYERNHCQIFTGEASFVDEHQVQIGDETLSAENIVI
STHA_VIBSL      NSNP----LFCQNNKSIHSTFSNLGHAKSVDKQTRLRQGFYDLVFGTARFIDTHTISVTEEHYSADKFVI
GSHRC_PEA       -NENVDFNWKKLEINRLNGIYKRL-----------LSNAGVKLFEGEGKIASPNEVEVTQLSYSAKHILI
STHA_ERWT9      NQNPLYSDLLRSSFADILNHTENVVSQQTHMRQGFYERNHCEIFQGDARFIDANTLEIETERLTAEKFVI
MERA_ACICA      ---PFDGGIAA----TVPARSKLLAQQQAVEELRHAKYEGITVVHGEARFKDEQSLVVGGERVVADRCLV
STHA_PROMH      NQNPLYSDQSRLINSSFSQILRQASTVISQQTKMRYERNHCTMYSGEAAFIDDHRISVRYDILSADNFII
STHA_AZOVI      G-EPRWFSFADVLKSAEQVIAKQVSSRTGYYARNRIDT-----FFGTASFCDEHTIEVVHETLVAKQFVI
STHA_AZOVD      G-EPRWFSFADVLKSAEQVIAKQVSSRTGYYARNRIDT-----FFGTASFCDEHTIEVVHETLVAKQFVI
STHA_HAHCH      G-EPRWFSFPRVLQNAERVIGKQVKIRTQFYARNR-----VDLYRGRASFIDENRIEVGKEVLYGKQIVI
GSHRC_ORYSJ     NGD-------------INFNWKRLLENKTQEIVRLLGNSGVTMIEGAGSLVDAHTVEVSKQRYTAKHILI
STHA_ECO81      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALSVETLTAEKFVI
STHA_SHIFL      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALSVETLTAEKFVI
STHA_SALG2      NHNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNAHFIDEHTLALECETLTAEKFVI
STHA_MARAV      G-EPRWFSFPRVAQKVIGKQVKLRTQFYS---RNR-----VDLINGRAAFVDKHRLEIRGETIHFKQAII
STHA_ECOLC      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALSVETLTAEKFII
STHA_ECOHS      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALSVETLTAEKFII
STHA_VIBVY      NSNPKNNSSLHATFSTILGHAKSVIDKQTRLRQGFYDRNQCQLIFGTARFTDAHTISVGTEEVTADKFVI
STHA_VIBVU      NSNPKNNSSLHATFSTILGHAKSVIDKQTRLRQGFYDRNQCQLIFGTARFTDAHTISVGTEEVTADKFVI
STHA_SALTY      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNAHFIDEHTLALECETLTAEKFVI
STHA_SALTI      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNAHFIDEHTLALECETLTAEKFVI
STHA_SALPK      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNAHFIDEHTLALECETLTAEKFVI
STHA_SALPB      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNAHFIDEHTLALECETLTAEKFVI
STHA_SALPA      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNAHFIDEHTLALECETLTAEKFVI
STHA_SALEP      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNAHFIDEHTLALECETLTAEKFVI
STHA_ESCF3      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALSVETLTAEKFVI
STHA_ENT38      NQNPLYSDLLRSSFADILNHADTVINQQTRMRQGFYERNHCEILQGDAHFVDEHTLALSVETITAEKFVI
STHA_ECOUT      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALSVETLTAEKFVI
STHA_ECOSM      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALSVETLTAEKFVI
STHA_ECOSE      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALSVETLTAEKFVI
STHA_ECOLU      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALSVETLTAEKFVI
STHA_ECOLI      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALSVETLTAEKFVI
STHA_ECOL6      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALSVETLTAEKFVI
STHA_ECOL5      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALSVETLTAEKFVI
STHA_ECOK1      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALSVETLTAEKFVI
STHA_ECODH      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALSVETLTAEKFVI
STHA_ECOBW      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALSVETLTAEKFVI
STHA_ECO8A      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALSVETLTAEKFVI
STHA_ECO7I      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALSVETLTAEKFVI
STHA_ECO5E      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALSVETLTAEKFVI
STHA_ECO55      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALSVETLTAEKFVI
STHA_ECO45      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALSVETLTAEKFVI
STHA_ECO24      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALSVETLTAEKFVI
STHA_SALPC      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNAHFIDEHTLALECETLTAEKFVI
STHA_SALCH      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNAHFIDEHTLALECETLTAEKFVI
STHA_ECO27      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALSVETLTAEKFVI
MERA_SHIFL      ATTPTIQRTXXXXXXXXRVDELRHAKYEGILEGN----PAITVLHGSARFKDNRNLIVGGERVVADRCLI
DLDH_TRYCR      GGEGVTMDSAKMQQQK-----ERAVKGLTGGVEYLFKKNKVTYYKGEGSFETAHSIRVNQEMFETKKTII
STHA_KLEP7      NQNPLYSDHSRL-LRSSFADI--LNHADSVINQQTHMRQGFEILQGNAHFVDEHTLALECETVTAEKFVI
STHA_SHIB3      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLVLSVETLTAEKFVI
STHA_ECO57      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALSVETLTAEKFVI
DLDH_DICDI      ----------KYGVKCSGVELDLGAMMQYKDKSVSGLTSGIEGLFGFGKITGPNTVEVSVKTIETKNIVI
STHA_VIBCM      NSNPKNNSSIHATFSTILSHAKSVIDKQTRLRQGFYDRNQCTLIFGAAHFIDAHTVAVKKDTYSADKFVI
STHA_VIBCH      NSNPKNNSSIHATFSTILSHAKSVIDKQTRLRQGFYDRNQCTLIFGAAHFIDAHTVAVKKDTYSADKFVI
STHA_VIBC3      NSNPKNNSSIHATFSTILSHAKSVIDKQTRLRQGFYDRNQCTLIFGAAHFIDAHTVAVKKDTYSADKFVI
STHA_KLEP3      NQNPLYSDHSRL-LRSSFADI--LNHADSVINQQTHMRQGFEILQGNAHFVDEHTLALECETVTAEKFVI
STHA_VIBPA      NSNPRNNTSLHATFSDILGHAKTVIDKQTRLRQGFYDRNDCTLLFGTARFIDTHSIAVTEETYSADKFVI
STHA_PSEPK      G-EPRWFSFPDVLKSAEKVIAKQVASRTGYYARNR-----VDVFVGTGSFADEQTVEVVCEKLNAKHIII
STHA_PSEP1      G-EPRWFSFPDVLKSAEKVIAKQVASRTGYYARNR-----VDVFVGTGSFADEQTVEVVCEKLNAKHIII
STHA_HAMD5      NQNPEHLQSIHPSFYHILQHANHVIRKQVSMRFDFYQRNHCHLFFGHARFIDPYKLEVIRNTLSADHIVI
STHA_PSEU5      G-EPRWFSFPDVLKSAEKVISKQVTSRTSYYARNRIDT-----FFGTASFSDEQSVEVVCEKLVANQFVI
STHA_CITK8      NQNPLYSDLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNAHFVDENTLALECETLTAEKFVI
TYTR_TRYBB      DGS------------SVKANWKKLAKNEAVLDINKSYTEGLDFFLGWGSLESKNVVVVREERLQADHILL
GSHR_CALJA      CEGKFNWRVIKEKRDTYVSRLNTIYQ-------NNLTKAHIEIIHGHAVFTSDTTIEVSGRKYTAPHILI
STHA_PSEPW      ----------------------------------------VDLFFGTGSFADEQTVEVVCEKLNAKHIII
STHA_PSEU2      ---------------------KQVASRTSYYARNR-----VDVFFGTGSFADENVVCTNGEKLVANQIII
STHA_PSESM      ---------------------KQVASRTSYYARNR-----VDVFFGTGSFADETSVNVVCEKLVANQIII
STHA_PSEPG      G-EPRWFSFPDVLKSAEKVISKQVASRTGYYARNR-----VDVFFGTGSFADEQTVEVVCEKLNAKHIII
STHA_PSEE4      ----------------------------------------VDVFFGTGSFADEQTVEVVCEKLVAKHIII
STHA_PSE14      ---------------------KQVASRTSYYARNR-----VDVFFGTGSFADETSVNVVCEKLVANQIII
GSHR_HUMAN      --SCEGKFNWRVIKEKRDAYVSRLNAIYQ----NNLTKSHIEIIRGHAAFTDPKTIEVSGKKYTAPHILI
TYTR_LEIDO      DREPNWKTLIAAKNKVVNS-INESYKSMFADT------EGLSFHMGFGALQDAHTVVVRKETLDTEYILI
STHA_PSEFS      ----------------------------------------VDLFFGTGSFADEQTVEVVCEKLVAKHIII
GSHR_MOUSE      CEGKFSWHVIKQKRDAYVSRLNTIYQ-------NNLTKSHIEIIHGYATFADGPTVEVNGKKFTAPHILI
STHA_VIBF1      NSNPKNNTSLHSTFSDILGHAKSVIDKQTRMRQGFYDRNQCSLIFGEASFVEKNTVAVSIETYTADKFII
GSHR_HAEIN      --EVKKFDFSKL-IESRQAYISRIHTSYN----NVLAKNNIDVINGFGKFVDAHTIEVTKEQVTADHILI
STHA_PSEFL      ----------------------------------------VDLFFGTGSFADEQTVEVVCEKLVAKHIII
STHA_PSEF5      ----------------------------------------VDVFFGTGSFADEQTVEVVCEKLVAKHIII
GSHR_DICDI      GGQQ-----VKFNWPTIKARDEYIKRLNGIYDSN-LAKDNIVRINGYGRFSGPKEIQVNGEKYTADHILI
STHA_PHOPR      SLHSTFSQILGHAQDVVN---KQTRMRQGFYDRNKC-----SLIFGEASFIDAHTVRVKNDLYSADKFVI
TYTR_TRYCR      -----DRTTLRAEWKKLIAVKDEAVLNINKSYEEMFRTEGLEFFLGWGSLESKNVVNVREERLETENILL
STHA_PSEPF      ----------------------------------------VDVFFGTGSFADEQTIEVVCEKLVAKHIII
TYTR_CRIFA      DREPNWKALIAAKNKAVSG-INDSYEGMFADT------EGLTFHQGFGALQDNHTVLVREETLDTEYILL
STHA_MARMS      ---PMFRDIGEFSFPKVLDRANRVIDKQVMGRTEYYARNRIDIYFGRGKFKDANTIEVGPELLEAKKVVI
GSHR_CANGA      QNVPLSKESITFNWPEFKKKRDAYIHRLNGIYENNLKKEGVEVVFGWAKFNKDGNVEVTKEVYSADRILV
GSHR_ECOLI      GF---DTTINKFNWETLIA--SRTAYIDRIHTSNVLGKNNVDVIKGFARFVDAKTLEVNGETITADHILI
GSHR_ASHGO      QEVDISKEKLHFNWKEFAGKRNAYVERLNGIYERNLAKEGVEYVHGWARFNSEGQVEVTTEKYTADHILI
TRXR2_BOVIN     AQAPHSWATL---ADAVQNHVKSLNWGHRI----QLQDRKVKYFNVKASFVDTHTVSKGGEELSAEHIVI
GSHR_RAT        CKSKFNWHVIKEKRDAYVSRLNNIYQ-------NNLTKSHIEVIHGYATFRDPQPTAVNGKKFTAPHILI
GSHR_CAEEL      IDQEKIKHDWNVLSKNVNDRVKANNWIYRV----QLNQKKINYFNAYAEFVDKDIVITGTDKLSAPNVVI
YKGC_ECOLI      QRKNEVVNFLR------NKNFHNLADMPNID-----------VIDGQAEFINNHSLRVGNLEIHGEKIFI
TRXR2_RAT       AQPVQHNWKAMAE--AVQNHVKSLNWGHRV----QLQDRKVKYFNIKASFVNEHTVHGVDKQLSAKHIVI
GSHR_YARLI      DPKYADNDWSGFKAKR-DAYVKRLNGIYE----RNLQKEGVEYVFGWATLYKPLVHVKSDDGYSAKKIMI
DLDH_RHIET      ----------------------------------------------------------------------
IRC15_YEAST     TRLFPAKFDMQAAQSALKHNIEELGNVYK----RELSKNNVTVYKGTAAFKDPHHVEIAQRGMKAKYIVV
TRXR2_HUMAN     A-QPVPHDW-RKMAEAVQNHVKSLNWGHRV----QLQDRKVKYFNIKASFVDEHTVAKGGKEISADHIII
DLDH_ACHLA      SGE------VGFDWSKIVSRKDGVVKQLTNGVAFLLKKNGVDVYNGFGDIKSANEVVVNGESLKTKNVII
TRXR2_MOUSE     AQP------VQHNWKTMAEAVQNHVKSLNWGHRVQLQDRKVKYFNIKASFVDEHTVRGVDKGLSAEHIVI
STHA_PSEMY      G-EPRWFSFPDVLKSAEKVIAKQVTSRTGYYARNRIDT-----YFGTASFADEQTVEVVCEKLVAKQIVI
GSHR_SCHPO      QLGSFDWGMIKRKRDAYIGRLNGIYE-------RNVNKDGVAYISGHASFVSPTEVAVGTQVFSAKYILI
TRXR1_DROME     DEKPDWHKLV----QSVQNHIKSVNWVTRVD----LRDKKVEYINGLGSFVDSHTLLAGERTITAQTFVI
GSHR_KLULA      ----EDLPLTKENL-TFNFKKKRDAYIHRLNGIRNLTKEGVDYVYGWASFTVDGKVQVKKETYTADHILV
TRXR2_DROME     DDRPDWRKLVR----SVQNHIKSVNWVTRVD----LRDKKVEYVNSMATFRDSHTIGAEHRQVTSEYVVV
GSHR_YEAST      QNLPLDKEHLTFNWPEFKQKRDAYVHRLNGIYQKNLEKEKVDVVFGWARFNKDGNVEVQKEVYSANHILV
TRXR1_BOVIN     ------EETVKHDWERMTEAVQNHIGSLNWGYRVALREKKVTYENAYGEFVGPHRIKAGKEKISAERFLI
TRXR_PLAF7      DNLKHDKKLVT----TVQSHIRSL----NFSYMTGLRSSKVKYINGLAKLKDKNTVSYGDETVTGKYILI
TRXR_PLAF5      DNLKHDKKLVT----TVQSHIRSL----NFSYMTGLRSSKVKYINGLAKLKDKNTVSYGDETVTGKYILI
TRXR1_MOUSE     ------EDTVKHDWEKMTESVQSHIGSLNWGYRVALREKKVVYENAYGRFIGPHIVATGKEKISAERFLI
TRXR1_PIG       ------EETIKHDWERMTEAVQNHIGSLNWGYRVALREKKVTYENAYGQFVGPHRIKAGKEKISAEKFLI
TRXR3_HUMAN     NQQ------VRHNWETMTKAIQNHISSLNWGYRLSLREKAVAYVNSYGEFVEHHKIKATNKKYTAAQFVI
TRXR3_MOUSE     NQQVKHNWEAMTE--AIQSHIGSLNWGYRVT----LREKGVTYVNSFGEFVDLHKIKATNKKYTASKFVI
TRXR1_PONAB     -EETVKHDWDRM-IEAVQNHIGSLNWGYRV----ALREKKVVYENAYGQFIGPHRIKAGKEKISAERFLI
TRXR1_HUMAN     -EETVKHDWDRM-IEAVQNHIGSLNWGYRV----ALREKKVVYENAYGQFIGPHRIKAGKEKISAERFLI
GSHR_PLAFK      KNLPLLVERRDKYIQRLNNIYRQNLSKDKVDTASFL-SENRILIKGTXXXXXXXXGPLNEEILEGRNILI
GSHR_DEBHA      TDDKVDFDWSTFKDKR-DAYVKRLNGIYE----RNLKNEGVDYIYGFAHFADVEVTLTGDQELSGSKTLI
GSHR_PLAF7      KNLPLLVERRDKYIQRLNNIYRQNLSKDKVDTASFL-SENRILIKGTXXXXXXXXGPLNEEILEGRNILI
TRXR1_CAEEL     ---PEGK----VEHQWNHLRDSVQDHIASLNWGYRLREKTVTYINSYGEFTGPFEISATNEKLTADRFLI
TRXR1_RAT       ------------------------------------------------KFIGPHKIMAGKEKVSAERFLI
MERA_SERMA      GMPPTPPTILRERLAQQQARVEELRHAKYEGILD--GNSAITVRHGEARFKDDRDLSVGERVVMFDRCLV
NAOX_METJA      -----------------------------------------------------------------DYLVL
NORW_ERWCT      -------------------------------------------------------VVCGTDRYDYHKLVF
AIFM3_MOUSE     -------------------------------------------------------------------LLL
TRXB_LISMO      ENYPGFDSILGPDLSD-----KMLSGAKQF---------GAEYAYGDIKEVEFKTVTAGSKTYKARAIII
CDR_PYRFU       -----------------------------------LKAEVIEVETGYVRVREN-----GEEKYEWDYLVF
NORW_CITK8      ---------------------------------------------------DAHVVKSQDKQWQFDKLVL
NORW_ECOLU      ---------------------------------------------------EAHVVKSQNNQWQYDKLVL
NORW_ECOL5      ---------------------------------------------------EAHVVKSQNNQWQYDKLVL
MDAR1_ARATH     ---------------------------------NWYKEKGIDLIVGKADLASKTLVSDDGKIYKYQTLLI
NORW_SHIFL      ---------------------------------------------------EAHVVKSQNNQWQYDKLVL
NORW_SHIF8      ---------------------------------------------------EAHVVKSQNNQWQYDKLVL
NORW_ECOL6      ---------------------------------------------------EAHVVKSQNNQWQYDKLVL
XECC_XANP2      -----------------------------------------------AKVIDNHTVEAAGKVFKAKNLIL
NORW_SHISS      ---------------------------------------------------EAHVVKSQNNQWQYDKLVL
NORW_ECOUT      ---------------------------------------------------EAHVVKSQNNQWQYDKLVL
NORW_ECOK1      ---------------------------------------------------EAHVVKSQNNQWQYDKLVL
NORW_ECO45      ---------------------------------------------------EAHVVKSQNNQWQYDKLVL
NAPE_ENTFA      -------------------------------TGEKMESRGVNVFSNEITAIQPHQVTVGEERVENDKLII
NORW_ECOSM      ---------------------------------------------------EAHVVKSQNNQWQYDKLVL
NAOX_ENTFA      KMEHNVEE-INVDDKTV--------------TAKNLQTGATETV-------------------SYDKLVM
TRXB_METJA      ENYPGFEEIRGYELAE---KFKNHAEKFKLPI---IYDEVIKIETKER----PFKVITKNSEYLTKTIVI
NORW_KLEP7      ----------------------------------------VSDIDAENRLVKSH-----DNQWRYDKLVL
TRXB_LISIN      ENYPGFDSILGPDLSD-----KMLSGAKQF---------GAEYAYGDIKEVEFKTVTAGSKTYKARAIII
NORW_ECO27      ---------------------------------------------------EAHVVKSQNNQWQYDKLVL
NAOX_STRP6      ----------------------------------------------------------------------
NORW_SALTI      ---------------------------------------------------DAHVVKSQDKQWQYDKLVL
NORW_KLEP3      GQKADDLTLQSAGAEQYNLRLFPHTWVSDIDAENRL-------------------VKSQDNQWRYDKLVL
CDR_PYRAB       -----------------------------------LNAEVIEVDTGYVRVREKD----GEKSYEWDYLVF
NORW_ESCF3      ---------------------------------------------------EAHVVKSQNNQWQYDKLVL
NORW_ECOHS      ---------------------------------------------------EARVVKSQNNQWQYDKLVL
NORW_ECO8A      ---------------------------------------------------EARVVKSQNNQWQYDKLVL
NORW_ECO5E      ---------------------------------------------------EARVVKSQNNQWQYDKLVL
NORW_ECO57      ---------------------------------------------------EARVVKSQNNQWQYDKLVL
NORW_ECO55      ---------------------------------------------------EARVVKSQNNQWQYDKLVL
OOXA2_RHIME     RNRPERKSYLGPDY----WKGKQLAEVSTIDYAPRATVEGRDETVAKVRNVVGVTVGGSARMIEADAVVL
NORW_SALHS      ---------------------------------------------------DAHVVKSQDKQWQYDKLVL
NORW_SALEP      ---------------------------------------------------DAHVVKSQDKQWQYDKLVL
NORW_SALTY      ---------------------------------------------------DAHVVKSQDKQWQYDKLVL
NORW_SALA4      ---------------------------------------------------DAHVVKSQDKQWQYDKLVL
NORW_SALSV      ---------------------------------------------------DAHVVKSQDKQWQYDKLVL
NORW_SHIDS      ---------------------------------------------------EARVVKSQNNQWQYDKLVL
NORW_SALG2      ---------------------------------------------------DAHVVKSQDKQWQYDKLVL
NORW_ECOSE      ---------------------------------------------------EARVVKSQNNQWQYDKLVL
NORW_ECO24      -------------------------------------------------------------------LVL
NASD_BACSU      -----DTDIKDITLNDWDWYEENNIQLYTNETVIKVDTEN-KTVITDADRIQPY-----------DELIL
TRXB_CHLPN      MNNMKEQ--------AVRFGTKTLAQD----------------IISVDFSVRPFILKSKEETYSCDACII
NORW_ECOLI      ---------------------------------------------------EARVVKSQNNQWQYDKLVL
NORW_ECOLC      ---------------------------------------------------EARVVKSQNNQWQYDKLVL
NORW_ECODH      ---------------------------------------------------EARVVKSQNNQWQYDKLVL
NORW_ECOBW      ---------------------------------------------------EARVVKSQNNQWQYDKLVL
Y636_METJA      GEKVHLEEII--SFKELQEKINKIQDRIRNKLEKETKELGVNIKYKEFK---------NKHKNDYDYIIY
NORW_SHIBS      ---------------------------------------------------EARVVKSQNNQWQYDKLVL
NORW_SHIB3      ---------------------------------------------------EARVVKSQNNQWQYDKLVL
RURE_ACIAD      NKAPEQIPLGDAEKMSTQLKLQILSEAINPETHEKLEKNGQETIQPYSKLV------------------L
NASB_BACSU      -----------------------------------------------------------------DKLIV
TRXB_CHLTR      ------MDLMKTQAQRFGTQVLS-KDITAVDFSVR-----------------PFVLKSGKETFTCDACII
NORW_VIBFM      -------------------------------------------------------ITANGEQYTYDKLVL
CDR_PYRKO       ----------------------------------------------------------------------
NORW_SALAR      ---------------------------------------------------DAHVVKSQDKQWQYDKLVL
CDR_PYRHO       -----------------------------------LNAEVIEVDTGYVRVRENG----GEKSYEWDYLVF
MDAR_PEA        --------------------------------------------IVSADLAAKFLKSANGEHFDYQTLVI
NORW_SALPC      ---------------------------------------------------DAHVVKSQDKQWQYDKLVL
NORW_SALCH      ---------------------------------------------------DAHVVKSQDKQWQYDKLVL
CDR_STAHJ       -----------------------------------------------------------------DKLIL
TRXB_CHLMU      -------------MENMKMQAQRF---------------GTQVIAKDITSVDPFVLKSGEDTFTCDACII
TRXB_STRCL      ---PDLMDNMRAQAERFGAELIP-DDVVSVDLTGDIKT-----VTDSAGTVH-----------RAKAVIV
MDAR3_ARATH     ------------------------------------KQKGIELILSKADLSAKSLVSATGDVFKYQTLII
MDARS_CUCSA     ------------------------------------KEKGIELILSEADLPAKRLRSAHGKIYNYQTLII
BEDA_PSEPU      --------------------------------------------------------------ISADAIVI
NORW_SALPK      ---------------------------------------------------DAHVVKSQDKQWQYDKLVL
NORW_SALPA      ---------------------------------------------------DAHVVKSQDKQWQYDKLVL
AHPF_STAES      GSEFSSN------------LAEHIAQ-YDIDTMTGIRATNIEKTDSAIR-----VTLENDAVLESKTVII
AHPF_STAEQ      GSEFSSN------------LAEHIAQ-YDIDTMTGIRATNIEKTDSAIR-----VTLENDAVLESKTVII
NORW_ENT38      -----------------------------------------------------HCVKAKDKQWHYDKLVL
CDR_STAAW       ----------------------------------------------------------------------
CDR_STAAS       ----------------------------------------------------------------------
CDR_STAAN       ----------------------------------------------------------------------
CDR_STAAM       ----------------------------------------------------------------------
CDR_STAAB       ----------------------------------------------------------------------
CDR_STAA9       ----------------------------------------------------------------------
CDR_STAA2       ----------------------------------------------------------------------
CDR_STAA1       ----------------------------------------------------------------------
AHPF_STAAW      GSEFSSNLAAHIDQYDIDAMTGRATDIEKTDEAIKVTLENGAVL-------------------ESKTVII
AHPF_STAAN      GSEFSSNLAAHIDQYDIDAMTGRATDIEKTDEAIKVTLENGAVL-------------------ESKTVII
AHPF_STAAM      GSEFSSNLAAHIDQYDIDAMTGRATDIEKTDEAIKVTLENGAVL-------------------ESKTVII
AHPF_STAAC      GSEFSSNLAAHIDQYDIDAMTGRATDIEKTDEAIKVTLENGAVL-------------------ESKTVII
AHPF_STAA8      GSEFSSNLAAHIDQYDIDAMTGRATDIEKTDEAIKVTLENGAVL-------------------ESKTVII
TRXB_STAAW      --------------------VYQYGDIKSVEDKGEYK-----------------VINFGNKELTAKAVII
TRXB_STAAS      --------------------VYQYGDIKSVEDKGEYK-----------------VINFGNKELTAKAVII
TRXB_STAAR      --------------------VYQYGDIKSVEDKGEYK-----------------VINFGNKELTAKAVII
TRXB_STAAN      --------------------VYQYGDIKSVEDKGEYK-----------------VINFGNKELTAKAVII
TRXB_STAAM      --------------------VYQYGDIKSVEDKGEYK-----------------VINFGNKELTAKAVII
TRXB_STAAC      --------------------VYQYGDIKSVEDKGEYK-----------------VINFGNKELTAKAVII
NAOX_MYCPN      ----------------------------------------------------------------------
AIFM1_HUMAN     ---------------------------------------GVAVLTGKKVVVRDNMVKLNDSQITYEKCLI
FENR_SALAI      AGFPRGRDLI----------ANLVAQAAPFDPRYLLGTRAEKLTYVDGR---PVLGLAGGEQLACGAVVI
CDR_STAAR       ----------------------------------------------------------------------
NORW_SALNS      ---------------------------------------------------DAHVVKSQDKQWQYDKLVL
NORW_SALDC      ---------------------------------------------------DAHVVKSQDKQWQYDKLVL
R34K_CLOPA      ISGADLADKMEEHAASIGVNIDQFSNIEKIKLSD-----------------DEKIIETEDVIYKVKALII
NORW_VIBVU      ----------------------------------------------------------------------
NORW_ECO81      ---------------------------------------------------EAHVVKSQNNQWQYDKLVL
FENR_SALTO      AGFPKGRDLV----------ANLVAQAAPFAPRYLLGTRAEKLSYADGR---PVLGLAGGEQLHCGAVVI
AHPF_STAAR      GSEFSSNLAAHIDQYDIDAMTGRATDIEKTDEAIKVTLENGAVL-------------------ESKTVII
AIFM1_DICDI     --------------------------------------------------IDEKLVLLNDGKIRYDKCLI
TRXB_RICFE      GTEIISDYVEKVDLSKRPFKV---------------------------------FTGAGNE-YEAESIII
TRXB_MYCSM      -----------------------------------LRMEDVDAVQLEGPV---KTVVVGDETHQARAVIL
MDAR2_ARATH     ------------------------------------KDHGIELVLGRVKSVDVRLLSSTGETISYKFLII
YMER_STAAU      ----------------------------------------------------------------------
AIFM1_RAT       ---------------------------------------GVAVLTGKKVVVRGNMVKLNDSQITFEKCLI
AIFM1_MOUSE     ---------------------------------------GVAVLTGKKVVVRGNMVKLNDSQITFEKCLI
AHPF_STAAS      GSEFSSNLAAHIDQYDIDAMTGRATDIEKTDEAIKVTLENGAVL-------------------ESKTVII
TODA_PSEP1      --------------------------------------------------------------LSADAIVI
STHA_PECCC      ----------------------------------------------------------------------
CDR_STAES       -----------------------------------------------------------------DTLIL
CDR_STAEQ       -----------------------------------------------------------------DTLIL
TRXB_RICCN      GTEIVSDYVEKVDLSKRPFKV---------------------------------FTGAGNE-YDAESIII
NORW_VIBVY      ----------------------------------------------------------------------
NORW_ECO7I      ---------------------------------------------------EAHVVKSQNNQWQYDKLVL
NIRB_KLEOX      -------------------------------------SESVASIDREARVVRD---AFGHET-HWDKLVL
NAOX_LACLM      -----------------------------------------------------------DEIIEADKLVL
TRXB_STRCO      ---PELMDNMRAQAERFGAELIP-DDVVAVDLSGEIKT----------------VTDTAGTVHRAKAVIV
TRXB_SCHPO      ENFPGFPDGINGTTLTENFR------AQSLRFGTEIITETVSKLDLSSRPFKYWLEGAEEEEPHADSVIL
FENR_LACCB      GGFPHGKDLVKTQLVHFHPEVKTATEVQTIDQ-------------------DPDTLHTSQGDFRSKTVIV
FENR_LACC3      GGFPHGKDLVKTQLVHFHPEVKTATEVQTIDQ-------------------DPDTLHTSQGDFRSKTVIV
TRXB_BACSU      ENYPGFESILGPELSN-----KMFEHAKKF---------GAEYAYGDIKEVEYKVVKAGSKEYKARAVII
TRXB_STAES      ENFPGFEMITGPDLST-----KMFEHAKKF---------GAEYQYGDIKSVDYKVINLGNKEITAHAVII
TRXB_STAEQ      ENFPGFEMITGPDLST-----KMFEHAKKF---------GAEYQYGDIKSVDYKVINLGNKEITAHAVII
THCD_RHOER      --------------------------------------------------------------IEYDHLIL
TERPA_PSESP     -----------------------------------------------------------------DHLIL
FENR1_BACP2     GGLPPTRQLIQQLEKQAKTFEPEIALNQKITSFERDEHQNILLTAEN-----------GDRHLTKTLILA
DHNA_BACSU      ----------------------------------------------------------------------
CDR_STAA8       ----------------------------------------------------------------------
TRXB_SPIBA      ------PDLVQNQVD------------QAEHCGAQLFYEDVTKIDATAR---PFKITHGNEIMTCDALIF
TRXB_COXBU      --------------------------------AERLDTQFIFDHINEADLNQRPFLLKGDNATYSDALII
HCAD_ECOLU      ------------------------------------------------------LVLTNGESWQWDQLFM
CDR_STAS1       ----------------------------------------------------------------------
CDR_STAAT       ----------------------------------------------------------------------
CDR_STAAE       ----------------------------------------------------------------------
CDR_STAAC       ----------------------------------------------------------------------
CDR_STAA3       ----------------------------------------------------------------------
TRXB_BORBU      ---------------------------------------------------------------KSKAVII
DHNA_BACYN      ----------------------------------------------------------------------
CAMA_PSEPU      -------------LRTPDAYAAQNIQLLGGTQVTAINRDRQQVILSDGRALD------------YDRLVL
AIFM3_HUMAN     -------------------------------------------------------------------LLL
TRXB_RICPR      GTEIISDYVERVDLSKRPFKI---------------------------------FTGTGNE-YEADSIII
NORW_SERP5      ----------------------------------------------------------------------
HCAD_ECO24      ------------------------------------------------------LVLTNGESWHWDQLFI
HCAD_ECO7I      ------------------------------------------------------LVLTNGESWHWDQLFI
HCAD_ECOSM      ------------------------------------------------------LVLANGESWHWDQLFI
AIFM1_DROME     ------------------------------------------------------IVTLNDGEISYDECLI
AHPF_PSEPU      ----------------------------------------------------------GGASLKAKTVIL
AHPF_PSEPK      ----------------------------------------------------------GGASLKAKTVIL
TRXB_RICTY      GTE------------IINDYVER------VDLSKR-----------------PFKIFTGGNKYEADSIII
TRXB_ECOLI      -----------------------------------------------------------------DALII
TRXB_ECO57      -----------------------------------------------------------------DALII
TRXB_DICDI      GSELMDK-----------------MREQNIKCGTTIETKTISKVDLKQRPFTIYVEDEEDKPIKAQSIII
NORW_SALPB      ---------------------------------------------------DAHVVKSQDKQWQYDKLVL
NORW_AERS4      -------------------------------------------------------------------LVL
MDAR_SOLLC      --------------------------------------KGISLILSKADLASKTLVSAAGESFKYQTLVI
AHPF_XANCH      ----------------------------------------------------------------------
AHPF_SALTY      --------------------------------------------------------------LKARSIII
MDAR4_ARATH     ------------------------------------KEKGIELILGKADLAAKTLVSGTGQVFKYQTLLA
HCAD_ECOSE      ------------------------------------------------------LVLTNGESWHWDQLFI
HCAD_ECO5E      ------------------------------------------------------LVLANGESWHWDQLFI
HCAD_ECO57      ------------------------------------------------------LVLANGESWHWDQLFI
HCAD_ECO55      ------------------------------------------------------LVLTNGESWHWDQLFI
FENR_FRASC      -------------------------------------------------------------RVRAKVVVI
HCAD_ECOLI      ------------------------------------------------------LVLTNGESWHWDQLFI
HCAD_ECOLC      ------------------------------------------------------LVLTNGESWHWDQLFI
HCAD_ECOHS      ------------------------------------------------------LVLTNGESWHWDQLFI
HCAD_ECODH      ------------------------------------------------------LVLTNGESWHWDQLFI
HCAD_ECOBW      ------------------------------------------------------LVLTNGESWHWDQLFI
TRXB_MYCPU      ----------------------KYEYGKVVDLIN-IKDDLKELVLEDGK------------KIQAKSVII
AHPF_ECOLI      --------------------------------------------------------------LKARSIIV
TRXB_EUBAC      ---------------------------------------------------------------KAKSVIL
FENR_LACF3      ------------------------------------------------------------------VIAM
TRXB_CLOLI      ---------------------------------------------------------------KAKAVIV
MDARP_ARATH     ----------------------------------------------------------------------
HCAD_PHOLL      ------------------------------------------------------VVLENGGKLRYDKLLL
FENR_ACHLI      ----------------------------------------------------------------------
DLDH_HYMDI      ----------------------------------------------------------------------
YDGE_SCHPO      -------------------------------------------------------------------LIL
FENR_FRAAA      -------------------------------------------------------------RVRARVVVI
FENR1_BACSK     ----------------------------------------------------------------------
NIRB_ECOLI      ---------------------------------------GIKVLVGERAITEKVIHSSAGRTVFYDKLIM
MNMG_PERMH      G---KAIDATGIQFKTLNTRAVRSPRAQADKEEYRLNTENLTVIEGEATLKESSYEVEGVEKIRAKSVVV
TRXB_RICBR      GT------------KIVNDYVEK------VDLSQR-----------------PFKVSTGSREYEAESIII
GGR2_METBU      AEEMSGGEVGYVLERKIFDRA--LANESALAGAERVKTRATDLIIENDTVCGIKLMHLGKEEVRSKIVIG
FENR_SYMTH      AGFP------RISAKRLVEQCKEQADSQRVDKLNRLEDGTFELVTHTG------------ERHYSKAVII
FENR_RALPJ      ----ELVDRLMAQCAPFNYPILCGRRAETVETLERVTTSAGDVFDCAAVLITAGNGAFTPQRVALPEAAA
BAIH_EUBSP      ----------------------------------------------------------------------
NIR_EMENI       -----------------------------------------------------------------DILVL
FENR_LACRJ      -------------------------------------------------------------RSRAVIIAL
FENR_LACRD      -------------------------------------------------------------RSRAVIIAL
BPHG_BURXL      ----------------------------------------------------------------------
AHPF_PSEAE      ----------------------------------------------------------------------
TRXB_NEUCR      GQELMDK-----------------MKAQSERFGTQIISETVAKVDLSARPFKYATEWSPEEYHTADSIIL
FENR_ACIC1      --------------------------------------------------------------IHAKAIIV
TRXB_TREPA      -------------------------------------------------------ITTGTGAYTAMSVIL
TODA_PSEPU      --------------------------------------------------------------LSADAIVI
FENR_STRSY      -----------------------LAQLAPFDTTICLNETLTAIEPGETITLTTN---KGNHQTKTLIIAM
FENR_STRS2      -----------------------LAQLAPFDTTICLNETLTAIEPGETITLTTN---KGNHQTKTLIIAM
BNZD_PSEPU      --------------------------------------------------------------LSADAIVI
THI4_HALWD      ADGPHAVSSLIKSACDAGAEVQNMTEFTDVVTRENHRVGGIVLNWTPVHALPRELTCVDPVAVESDLVVD
FENR_NOCSJ      AGFPSVKGRDLVE--------GLVAQAATADPTYLLDRTATTLHEDDDAENGAVVVGLDDTEVRAKAVLI
FENR_LACDB      ----------------------------------------------------------GEYQVRSIIVAT
FENR_LACDA      ----------------------------------------------------------GEYQVRSIIVAT
TRXB_PENCH      ----------------------------------------------------------GSEPVRADAVII
TRXB1_ARATH     ----------------------------------------------------PFKLFTDSKAILADAVIL
MNMG_SULSY      GEMAKAIDQTGIQFKVLNTRAVRSPRAQAVNKTNNIEDEVIDIVLKENKNEVDGVITDKGLKIKTKAVVV
FENR2_BACSK     AGFPKVKAQDLVDQLT--------AQAQQFQP---------EIVLEEAKQEDETFVLTTDANIHTKAVLI
FENR1_OCEIH     SGENVIKQMVE-QAMTFDPTVVLNEKVESID-KNEMGLFQLHTASGEIHYSKTIIVAVGGGIL-------
TRXB_YARLI      -MEDMRKQSIRFGTEIITETVSK------VDLSQRPFKYWTEFNEDE----EPHT---------ADAIIL
NORW_AERHH      ----------------------------------------------------------------------
FENR_SULTO      RIK-EWADMIE--------RTQDNMWVVKTDKGNSFKTKTILIAAGIGKMTPSRLGAKGEVEYENKGVYY
FENR_BURVG      ----------------------------------------------------------------------
FENR1_EXIS2     --KVKAQDLVD----------RLLEQANEFDPTYVLG----ETVLAYERLDDGLIRLVTNEHYTKTVILT
TRXB_ASHGO      ENFPGFPDGL-----TGSDLMERM-KAQSVKFGTEVVTETVAKVDLSARPFKLWTEFNEDEETTTDAIIL
TRXB2_ARATH     -------------VEKFRKQSERFGTTIFTETVNKVDFSS-----------KPFKLFTDSRTVLADSVII
NORW_VIBF1      ----------------------------------------------------------------------
FENR1_BACA2     ----------------------------------------------------------------------
TRXB_CANGA      ENFPGFPDGM------TGSELMDRMRAQSTKFGTEIITETIAKVDLSSRPFKLWTEFNEDEPITTDAIVI
GGR_UNCMA       SEKMAGNEVGFVERKIFDRELAKMAAKAGAEV--QVKTQATGLIIENGQVCGITGKRHGDETARAKVVVA
FENR_BURP8      ----------------------------------------------------------------------
FENR1_BACSU     -------------------------------------------VTGFERLDDGTIVLTGSEGKKTRTVIL
THI4_HALSA      ADAPHACSAMITAACDAGARIQNMTEFTDIVVRDDHAVAGAVVNWTPVHSLPRELTCVDPIALEADVVVD
THI4_HALS3      ADAPHACSAMITAACDAGARIQNMTEFTDIVVRDDHAVAGAVVNWTPVHSLPRELTCVDPIALEADVVVD
PYRD1_MOUSE     ----------------------------------------------------------------------
FENR2_OCEIH     VHAQELIDRLEEQAKFFDPEI---VLGQAIDKVERLEDETIRLTTGEVHLTKTIIITAGNGAFQ------
PYRD1_RAT       ----------------------------------------------------------------------
DHNA_ECOLI      ----------------------------------------------------------------------
TRXB_BUCAI      ---------------------------------------------------NPFFLIGENNKYTADSVII
CRTI_MYXXA      ----------------------------------------------------------------------
PURT_SYNP6      ----------------------------------------------------------------------
PURT_SYNE7      ----------------------------------------------------------------------
MNMG2_FUSNN     G---RNIDKTFIQIRVLNTRVRSLAQADKMAYANEMKTDNLSVIQG------------------------
FENR_PROVI      ----------------------------------------------------------------------
MNMG_DESAP      G---RNTDRAAIQVRMLNTGKGPAVRALRAQTDKRLYQEGMRRTVEGQPLLD------------------
FENR_IGNH4      ----------------------------------------------------------------------
FENR_DEIGD      ----------------------------------------------------------------------
DHA_BACSH       ----------------------------------------------------------------------
YEIT_ECO57      KNNEIGKTLTLEQLKAENRAV-------------------------------------------------
TRXB_MYCPN      ------------------------------------------------KAADTFILYLDDKTVVAKTVIY
TRMFO_RHIME     G-------VLHAEMRLAGSLIMRCADLNQVPAGGALAVEGFAEAV-SAAIADHPLITVLREEIRGDLAII
MNMG_MYCPN      GMQGKAADATALQYKLLNAQIDKIAYRQQID-----QTPNIELIAGEAGKVKGVVLADGSE-LASDAVIV
MNMG_CAMHC      G---VCTDFAGIQFRTLN----------------------------------------------------
YEIT_SALTY      ----------------------------------------------------------------------
YEIT_SALTI      ----------------------------------------------------------------------
THI4_HALMA      ANGPEACSGLIKAACDAGAKMQNMTEFTDIVIREDHRVGGIVMNWTPVHALPREITCVDPIAVEADLVID
TETX_BACFR      ADK-------------------------------------------------------------------
STCD_RHIME      HNTWAEAEAIQAESDVVIIATGGLPHTEVLSRGNELVVSAWDIISGDAK---------------------
MICA2_HUMAN     ----------------------------------------------------------------------
FTHS_ARATH      ----------------------------------------------------------------------
YPDA_BACSU      ----------------------------------------------------------------------
MNMG_COXBU      GIMALAADQAGIHFRTLNAR--------------------------------------------------
MNMG_COXBR      GIMALAADQAGIHFRTLNAR--------------------------------------------------
MNMG_COXBN      GIMALAADQAGIHFRTLNAR--------------------------------------------------
MNMG_CAMFF      G---------------------------------------------------------------------
PYRD1_PONAB     ----------------------------------------------------------------------
MNMG_UREPA      GIQGKAADATTMQMKILNAQIDKIAYQRWFKQQIK-QQKNLDLIIAEVSLVENNIVVLSDQKIQADYVII
MNMG_UREP2      GIQGKAADATTMQMKILNAQIDKIAYQRWFKQQIK-QQKNLDLIIAEVSLVENNIVVLSDQKIQADYVII
MICA2_MOUSE     ----------------------------------------------------------------------
LSDA_DROME      ----------------------------------------------------------------------
HMT2_SCHPO      ----------------------------------------------------------------------
FTHS_SPIOL      ----------------------------------------------------------------------
YEIT_ECOLI      KNNEVGNTLTLEQLKAENRAV-------------------------------------------------
TRMFO_SINMW     G-------VLHAEMRLAGSIIMRCADLNQVPAGGALAVEGFAEAVSAAIAAHP-LITVLREEIRGDLAII
PURT_CHLTE      ----------------------------------------------------------------------
MNMG_XANOR      GAMAHAADLAGIQWRTLNASKGPAVRATRCQADRNLYRTAIRCIV-------------------------
MNMG_XANOM      GAMAHAADLAGIQWRTLNASKGPAVRATRCQADRNLYRTAIRCIV-------------------------
MNMG_UREU1      GIQGKAADATTMQMKILNAQIDKIAYQRWFKQQIK-QQKNLDLIIAEVSLVENNIVILSDQKIQADYVII
MNMG_BACSK      GRNIDKTHIQMRMLNTGKGPAVRALRAQAYQQEMKRTIEEQENLLLRQGMVDRLIIEDGECRYRAKAVVV
LEU1_PROMP      RLEEMGYDLSREDLNDAFARFKELADRKREITDRDLESEQVQLPESKFQLSHVQVSCGSTSKPTATVTLI
FENR_RHORT      ----------------------------------------------------------------------
AHPF_XANCH      YKDRTGGDIQHIELEGVFVQIGLLPNTEFLRGTVALSPRG-EIIVDDRGQTDPGVFAAGD----------
AHPF_PSEAE      YKDRNSEEFKSIELEGIFVQIGLLPNTEWLKGSVELSPRGEIIVDARGETSLPGIFAAGD----------
DHA_BACSH       ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPT
DLDH1_BACSU     ATGSRPIELPNFKYS-ERVLNSTGALALKEIPKKLVVIGGGYIGTELGTAYANFGTELVILEGGDEILPG
DLDH_CHLPN      ATGSEPRPFPGV-PFSSRILSSTGILELEVLPKKLAIIGGGVIGCEFASLFHTLGVEITVIEALDHILAV
DLDH_ZYMMO      ATGARARQLPNVHSDGKHIWTYHHALKPPAMPKKLLVIGSGAIGIEFASFYADFGAEVSIVEHAPQILPM
DLDH_HALVO      ATGSRVIQIPGFDFGDEPVWSSRDALEADTVPERLVVVGGGYIGMELSTTFAKLGADVTVVEMLDDILPG
DLDH_CHLTR      ATGSEPRAFPGIPFSAERILCSTGVLNLKEIPQKMAIIGGGVIGCEFASLFHTLGSEVSVIEASSQILAL
DLDH_CHLMU      ATGSEPRAFPGVSQQSPRILCSTGVLNLKEIPQKMAIIGGGVIGCEFASLFHTLGSEVSVIEASQQILAL
DLDH1_BACST     ATGSRPIELPNFK-FSNRILDSTGALNLGEVPKSLVVIGGGYIGIELGTAYANFGTKVTILEGAGEILSG
DLDH_STAAW      ATGSRPIEIPNFK-FGKRVIDSTGALNLQEVPGKLVVVGGGYIGSELGTAFANFGSEVTILEGAKDILGG
DLDH_STAAU      ATGSRPIEIPNFK-FGKRVIDSTGALNLQEVPGKLVVVGGGYIGSELGTAFANFGSEVTILEGAKDILGG
DLDH_STAAS      ATGSRPIEIPNFK-FGKRVIDSTGALNLQEVPGKLVVVGGGYIGSELGTAFANFGSEVTILEGAKDILGG
DLDH_STAAR      ATGSRPIEIPNFK-FGKRVIDSTGALNLQEVPGKLVVVGGGYIGSELGTAFANFGSEVTILEGAKDILGG
DLDH_STAAN      ATGSRPIEIPNFK-FGKRVIDSTGALNLQEVPGKLVVVGGGYIGSELGTAFANFGSEVTILEGAKDILGG
DLDH_STAAM      ATGSRPIEIPNFK-FGKRVIDSTGALNLQEVPGKLVVVGGGYIGSELGTAFANFGSEVTILEGAKDILGG
DLDH_STAAC      ATGSRPIEIPNFK-FGKRVIDSTGALNLQEVPGKLVVVGGGYIGSELGTAFANFGSEVTILEGAKDILGG
DLDH_CHLP8      ATGAQPRVIPGLEPDGKKIITSREALILKDVPESMIVVGGGAIGVEMAWFYAKAGAKVTIVELMPRLLPA
DLDH_CHLTE      ATGSTPRVIPGLEPDGKKIITSREALILKEVPKSMIVVGGGAIGVEMAWFYAKAGSKVTIVELMPRMLPA
DLDH2_HALMA     ATGSRPMAVPGFEFDGEHILSSKDALALESVPEKLLVVGAGYIGMELSTVFAKLGAEVTVVEMLDDVLPG
DLDH_THESC      ATGSEPMPLK-GFPFGEDVWDSTRALRVEEIPKRLLVIGGGAVGLELGQIYHRLGSEVTLIEYMPEILPA
DLDH3_PSEAE     ATGSEPAPLPGVPVDNQRILDSTGALELVEVPRHLVVIGAGVIGLELGSVWRRLGAQVTVLEYLERICPG
DLDH3_PSEPU     ATGSEPTPLPGVTIDNQRIIDSTGALSLPQVPKHLVVIGAGVIGLELGSVWRRLGSQVTVIEYLDRICPG
DLDH_PIG        ATGSEVTPFPGITIDEDTVVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVELLGHVGGI
DLDH_CANFA      ATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGV
DLDH_MOUSE      ATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKLVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGI
DLDH_CRIGR      ATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKLVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGI
DLDH_RAT        ATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKLVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGI
DLDH_MACFA      ATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGI
DLDH_HUMAN      ATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGV
DLDH_AZOVI      ASGSKPVEIPPAPVDQDVIVDSTGALDFQNVPGKLGVIGAGVIGLELGSVWARLGAEVTVLEAMDKFLPA
DLDH_PONAB      ATGSEVTPFPGIMIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGV
DLDH2_BACSU     ATGSRPRMLPGLEVDGKSVLTSDEALQMEELPQSXXXXXXXXXXXEWASMLHDFGVKVTVIEYADRILPT
DLDH1_PSEAE     AAGSQSVELPIL-PLGGKVISSTEALAPGSLPKRLVVVGGGYIGLELGTAYRKLGVEVAVVEAQPRILPG
DLDH_PSEFL      ASGSRPVEIPPAPLSDDIIVDSTGALEFQAVPKKLGVIGAGVIGLELGSVWARLGAEVTVLEALDKFLPA
DLDH2_PSEAE     ASGSRPVEIPPAPLTDDIIVDSTGALEFQAVPKKLGVIGAGVIGLELGSVWARLGAEVTVLEALDKFLPA
DLDH2_PSEPU     ASGSRPIDIPPAPVDQNVIVDSTGALEFQAVPKRLGVIGAGVIGLELGSVWARLGAEVTVLEALDTFLMA
DLDH_SHIFL      AAGSRPIQLPFIPHEDPRIWDSTDALELKEVPERLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPA
DLDH_SCHPO      ATGSEVKPFPGVTIDEKKIVSSTGALSLSEVPKKMTVLGGGIIGLEMGSVWSRLGAEVTVVEFLPAVGGP
DLDH_ECOLI      AAGSRPIQLPFIPHEDPRIWDSTDALELKEVPERLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPA
DLDH_ECOL6      AAGSRPIQLPFIPHEDPRIWDSTDALELKEVPERLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPA
DLDH_ECO57      AAGSRPIQLPFIPHEDPRIWDSTDALELKEVPERLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPA
MERA_STAES      ATGASPAVPEIPGMNEVDYLTSTSALELKEVPQRLAVIGSGYIAAELGQMFHNLGTEVTLMQRSERLFKT
MERA_STAAU      ATGASPAVPEIPGMNEVDYLTSTSALELKEVPQRLAVIGSGYIAAELGQMFHNLGTEVTLMQRSERLFKT
DLDH_PEA        ATGSDVKSLPGVTIDEKKIVSSTGALALSEIPKKLVVIGAGYIGLEMGSVWGRIGSEVTVVEFASEIVPT
DLDH_YEAST      ATGSEVTPFPGIEIDEEKIVSSTGALSLKEIPKRLTXXXXXXXXLEMGSVYSRLGSKVTVVEFQPQIGAS
GSHR_ANASP      AVGGRP--IKPELPGMEYGITSNEIFHLKTQPKHIAIIGSGYIGTEFAGIMRGLGSQVTQITRGDKILKG
DLDH1_PSEPU     ATGSSSVELPML-PLGGPVISSTEALAPKALPQHLVVVGGGYIGLELGIAYRKLGAQVSVVEARERILPT
DLDH_BUCAI      ATGSKPIKIPSIPHDDIRIWDSTDALSLKKIPNNFLIIGSGIIGLEMATIYSALGSKVDIIDRFNHFLPV
DLDH3_HALMA     ATGSRPIEIPGFGFEDERIVSSDGALNFDTVPDELVIVGAGYIGMELATVYSRLGSDVSVIEMLEQALPS
DLDH_MYCPN      ATGSRPRYLTLARQNGF-VIDSTQALSLEGVPRKLXXXXXXXXXXEFAFLYASLGSEVTILQGVDRILEI
DLDH_HALSA      STGSRPIEVPGFDFGDDPVLDSRQALAMAELPSSMVIVGGGYIGMELSTVFAKLGVDVTVVEMLDGILPQ
DLDH_MANSE      ATGSEVTPFPGVTFDEKQIITSTGALSLESVPKKMLVIGAGVIGLELGSVYQRLGADVTAIEFLGSIGGI
STHA_MYCTU      ATGTRPARPSGVEFDEERVLDSDGILDLKSLPSSMVVVGAGVIGIEYASMFAALGTKVTVVEKRDNMLDF
STHA_MYCTA      ATGTRPARPSGVEFDEERVLDSDGILDLKSLPSSMVVVGAGVIGIEYASMFAALGTKVTVVEKRDNMLDF
STHA_MYCBT      ATGTRPARPSGVEFDEERVLDSDGILDLKSLPSSMVVVGAGVIGIEYASMFAALGTKVTVVEKRDNMLDF
STHA_MYCBP      ATGTRPARPSGVEFDEERVLDSDGILDLKSLPSSMVVVGAGVIGIEYASMFAALGTKVTVVEKRDNMLDF
STHA_MYCBO      ATGTRPARPSGVEFDEERVLDSDGILDLKSLPSSMVVVGAGVIGIEYASMFAALGTKVTVVEKRDNMLDF
DLDH_BUCBP      ATGSLSKKLSYIPYDDIRIWNSSFAVSIPSIPKKXXXXXXXXXXXEMATIYSALGSNVDIIDNSHDILPH
MERA_THIFE      ATGASPAVPPIPGLKDTPYWTSTEGLVSESIPERLAVIGSSVVALELAQAFARLGSHVTILA-RGTLFLR
DLDH_HAEIN      AAGSRPVQLPFIPHEDPRIWDSTDALKLKEVPKKXXXXXXXXXXXXXXTVYNALGSEVEVVEMFDQVIPA
DLDH_BUCAP      ATGSKPIKIPSLPNEDNRIWNSTDALSLKSIPNRFLXXXXXXXXLEMATIYSALGSKVDIVDRFNAFLPS
MERA_BACCE      ATGASSTAPNIPGLDEVDYLTSTSLLELKKVPNRLTVIGSGYIGMELGQLFHNLGSEVTLIQRSERLLKE
DLDH_SYNY3      CPGSVPFVPPGIEIDHKTVFTSDEAVKLETLPQWIAIIGSGYIGLEFSDVYTALGCEVTMIEALPDLMPG
DLDH_RHOCA      ATGSESSGLPGIEIDEQTVVTSTGALSLAKVPKSMVVIGAGVIGLELGSVYARLGAEVTVVEYLDAITPG
GSHR_BURCE      ATGARPVMPPVA--GANLMITSDDVFDLPVGPPRIAIIGGGYIACEFAGIFNGLGRHVVQLHRGSQVLRG
DLDH_VIBCH      AAGSRPIKLPFIPHEDPRIWDSTDALELKEVPXXXXXXXXXXXXXEMATVYHSLGSKIDVVEMFDQLIPA
GSHRP_SPIOL     ATGSRAQR-PNI-PGQELAITSDEALSLEEFPKRVVILGGGYISVEFASIWRGMGADVNLCFRKELPLRG
DLDH1_ARATH     ATGSDVKSLPGITIDEKKIVSSTGALSLSEVPKKLIVIGAGYIGLEMGSVWGRLGSEVTVVEFAGDIVPS
MERA_ENTAG      ATGASPAVPPIPGLKESPYWTSTEALASDTIPERLAVIGSSVVALELAQAFARLGSKVTALA-RNTLFFR
DLDH_MYCGE      ATGSRPRYLTL--PGFEKIIDSTQALALEGVPKKFXXXXXXXXXXEFAFLFASLGSEVTIIQGVDRILEV
DLDH_VIBPA      AAGSRPIKLPFIPHEDPRIWDSTDALELKEVPEKXXXXXXXXXXXXXXTVYHSLGSKVEVVEMFDQVIPA
MERA_PSEAE      ATGASPAVPPIPGLKESPYWTSTEALASDTIPERLAVIGSSVVALELAQAFARLGSKVTVLA-RNTLFFR
DLDH_MYCTU      ATGSSTRLVPGTSLSAN-VVTYEEQILSRELPKSXXXXXXXXXXMEFGYVLKNYGVDVTIVEFLPRALPN
DLDH_MYCBO      ATGSSTRLVPGTSLSAN-VVTYEEQILSRELPKSXXXXXXXXXXMEFGYVLKNYGVDVTIVEFLPRALPN
DLDH_RALEH      ATGSKARHLPGIKVDNDLVSDNEGALKFPAVPKKLGVIGAGVIGLELGSVWRRLGSDVTVLEALPAFLGA
GSHR_STRTR      ATGGHP--LYPNIPGSEYGITSDGFFELDEVPKRTAVIGAGYIAVEVAGVLNALGSDTHLFVRKDRPLRT
DLDH3_BACSU     ASGSEPIELPFAPFDGEWILDSKDALSLSEIPSSLXXXXXXXXXCEYAGLFARLGSQVTIIETADRLIPA
DLDH_MYCLE      ATGSKTRLVPGTLLS-TNVITYEEQILTRELPDSXXXXXXXXXXXEFGYVLKNYGVDVTIVEFLPRAMPN
GSHRP_TOBAC     SVGGRPF-IPDI-PGSEYAIDSDAALDLPTKPNKIAIVGGGYIALEFAGIFNGLKSEVHVFIRQKKVLRG
DLDH2_ARATH     ATGSDVKSLPGITIDEKKIVSSTGALSLTEIPKKLIVIGAGYIGLEMGSVWGRLGSEVTVVEFAADIVPA
STHA_COLP3      ATGSRPYRPDDIDFDHPRVYDSDSILSLKHAPQHVIIYGAGVIGSEYASIFRGLGVKVDLINTRERLLSF
MERA_SHEPU      ATGSTPTIPPIDGLTETPYWTSTEALFAQELPQHLVVIGSSVVALEIAQAYRRLGSEVTILA-RHTLLYR
GSHRP_SOYBN     AVGGRPF-IPDI-PGKELAIDSDAALDLPTKPVKIAIVGGGYIALEFAGIFNGLKSEVHVFIRQKKVLRG
MERA_PSEFL      ATGASPAVPPIPGLKESPYWTSTEALVSDTIPARLAVIGSSVVALELAQAFARLGSQVTILA-RSTLFFR
DLDH_TRYBB      ATGSEPTALPFLPFDEKVVLSSTGALALQQVPKKMXXXXXXXXXLELGSVWARLGSDVTVVEFAPRCAPT
GSHRC_ARATH     ATGSRAQK-PNI-PGHELAITSDEALSLEEFPKRAIVLGGGYIAVEFASIWRGMGATVDLFFRKELPLRG
STHA_SERP5      ACGSRPYNPSSVDFNHPRIYNSDSILELNHEPRHVIIYGAGVIGCEYASIFRGLNVKVDLINTRDRLLAF
STHA_PHOLL      ATGSRPYCPPDVDFTHSRIYNSDSILKLDHEPRHVIIYGAGVIGCEYASIFRGLGVKVDLINTRNHLLAF
GSHRC_BRARP     ATGSRAQK-PNI-PGHELAITSDEALSLEEFPKRAIVLGGGYIAVEFASIWRGMGATVDLFFRKELPLRG
STHA_YERE8      ATGSRPYRPANVDFTHERIYDSDTILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAF
MERA_STRLI      ATGSAPTAPHIDGLDQVDYLTSTTAMELQQLPEHLLILGGGYVGLEQAQLFARLGSRVTL-AVRSRLASR
GSHR_PSEAE      ATGGWP-QVPDI-PGKEHAITSNEAFFLERLPRRVLVVGGGYIAVEFASIFNGLGAETTLLYRRDLFLRG
GSHRP_PEA       SVGGRPF-IPDI-PGKEYAIDSDAALDLPSKPQKIAIVGGGYIALEFAGIFNGLKSEVHVFIRQKKVLRG
STHA_CHRSD      ATGSRPYRPADINFRHPRIYCSDTILGLSHTPRTLIIFGAGVIGSEYASIFSGLGVKVDLIDMRERLLSF
GSHRP_ARATH     AVGGRPF-IPDI-PGKEFAIDSDAALDLPSKPKKIAIVGGGYIALEFAGIFNGLNCEVHVFIRQKKVLRG
STHA_PSEA7      ATGSRPYRPSDINFNHPRVYDSDTILSLSHTPRRLIIYGAGVIGCEYASIFSGLGVLVDLIDTRDQLLSF
STHA_PSEAE      ATGSRPYRPSDINFNHPRVYDSDTILSLSHTPRRLIIYGAGVIGCEYASIFSGLGVLVDLIDTRDQLLSF
STHA_PSEAB      ATGSRPYRPSDINFNHPRVYDSDTILSLSHTPRRLIIYGAGVIGCEYASIFSGLGVLVDLIDTRDQLLSF
STHA_PSEA8      ATGSRPYRPSDINFNHPRVYDSDTILSLSHTPRRLIIYGAGVIGCEYASIFSGLGVLVDLIDTRDQLLSF
GSHR_NEUCR      AVGGNPT-IPPHIPGSEYGTNSDGFFDIDTLPKKVALVGAGYIAVEFAGMLNALGVETHLFIRHDTFLRS
STHA_YERPY      ATGSRPYRPVNVDFNHERIYDSDTILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAF
STHA_YERPS      ATGSRPYRPVNVDFNHERIYDSDTILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAF
STHA_YERPP      ATGSRPYRPVNVDFNHERIYDSDTILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAF
STHA_YERPN      ATGSRPYRPVNVDFNHERIYDSDTILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAF
STHA_YERPG      ATGSRPYRPVNVDFNHERIYDSDTILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAF
STHA_YERPE      ATGSRPYRPVNVDFNHERIYDSDTILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAF
STHA_YERPB      ATGSRPYRPVNVDFNHERIYDSDTILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAF
STHA_YERPA      ATGSRPYRPVNVDFNHERIYDSDTILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAF
STHA_YERP3      ATGSRPYRPVNVDFNHERIYDSDTILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAF
STHA_ERWCT      ATGSHPAEVDFNHP---RIYDSDSILQLDHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAF
MERA_ALCSP      ATGASPAVPPIPGLKESPYWTSTEALVSDTIPERLAVIGSSVVALELAQAFARLGSKVTILA-RSTLFFR
TYTR_TRYCO      ATGSWPQMLKI--PGIEHCISSNEAFYLEEPPRRVLTVGGGFISVEFANAYKPVGGKVTLCYRNNPILRG
STHA_SODGM      ACGSRPYQPQDVDFDHPRIYDSDSILDLKHDPHHVIIYGAGVIGCEYASIFRGMNVKVDLINTRDRLLAF
STHA_VIBSL      ATGSRPYQPDNVDFMHERVYDSDSILSLKHDPQHIIIYGAGVIGCEYASIFRGLGVKTDLINTRDRLLSF
GSHRC_PEA       ATGSRAQR-PNI-PGQELGITSDEALSLEEFPKRAVILGGGYIAVEFASIWRGMGSSVNLVFRKELPLRG
STHA_ERWT9      ACGSRPYHPPDVDFTHPRIYDSDSILNLHHEPGHVIIYGAGVIGCEYASIFRGLAVKVDLINTRDRLLAF
MERA_ACICA      ATGASPAVPPIPGLKESPYWTSTEALVSDTLPERLAVIGSSVVALELAQAFARLGSQVTILA-RNTLFFR
STHA_PROMH      ATGSRPYCPPDVDFSHSRIYNSDTILDLEHEPRHVIIYGAGVIGCEYASIFRGLRVKVDLINTRDHLLSF
STHA_AZOVI      ATGSRPYRPADVDFTHPRIYDSDTILSLGHTPRRLIIYGAGVIGCEYASIFSGLGVLVDLIDNRDQLLSF
STHA_AZOVD      ATGSRPYRPADVDFTHPRIYDSDTILSLGHTPRRLIIYGAGVIGCEYASIFSGLGVLVDLIDNRDQLLSF
STHA_HAHCH      ATGSRPYLPEDVDFTHRRIYNSDSILKLSHTPRTLIIYGAGVIGCEYASIFVGLGVKVDLINPGERLLSF
GSHRC_ORYSJ     ATGSRAQRVNI--PGKELAITSDEALSLEELPKRAVILGGGYIAVEFASIWKGMGAHVDLFYRKELPLRG
STHA_ECO81      ACGSHPTDVDFTHP---RIYDSNSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_SHIFL      ACGSHPTDVDFTHP---RIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_SALG2      ACGSHPNDVDFSHP---RIYDSDSILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_MARAV      ATGSRPYLPPDVDFRHHRIYNSDSILNLSHTPRTLIIYGAGVIGSEYASIFAGLGVKVDLINPGSRLLSF
STHA_ECOLC      ACGSHPTDVDFTHP---RIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_ECOHS      ACGSHPTDVDFTHP---RIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_VIBVY      ATGSRPYQPADVDFNHERIYDSDSILSLKHDPRHIIIYGAGVIGCEYASIFRGLGVKTDLINTRDRLLAF
STHA_VIBVU      ATGSRPYQPADVDFNHERIYDSDSILSLKHDPRHIIIYGAGVIGCEYASIFRGLGVKTDLINTRDRLLAF
STHA_SALTY      ACGSHPNDVDFSHP---RIYDSDSILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_SALTI      ACGSHPNDVDFSHP---RIYDSDSILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_SALPK      ACGSHPNDVDFSHP---RIYDSDSILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_SALPB      ACGSHPNDVDFSHP---RIYDSDSILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_SALPA      ACGSHPNDVDFSHP---RIYDSDSILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_SALEP      ACGSHPNDVDFSHP---RIYDSDSILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_ESCF3      ACGSHPTDVDFTHP---RIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_ENT38      ACGSHPDDVDFSHP---RVYDSDSILSLHHEPRHVLIYGAGVIGCEYASIFRGMEVKVDLINTRDRLLAF
STHA_ECOUT      ACGSHPTDVDFTHP---RIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_ECOSM      ACGSHPTDVDFTHP---RIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_ECOSE      ACGSHPTDVDFTHP---RIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_ECOLU      ACGSHPTDVDFTHP---RIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_ECOLI      ACGSHPTDVDFTHP---RIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_ECOL6      ACGSHPTDVDFTHP---RIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_ECOL5      ACGSHPTDVDFTHP---RIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_ECOK1      ACGSHPTDVDFTHP---RIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_ECODH      ACGSHPTDVDFTHP---RIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_ECOBW      ACGSHPTDVDFTHP---RIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_ECO8A      ACGSHPTDVDFTHP---RIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_ECO7I      ACGSHPTDVDFTHP---RIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_ECO5E      ACGSHPTDVDFTHP---RIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_ECO55      ACGSHPTDVDFTHP---RIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_ECO45      ACGSHPTDVDFTHP---RIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_ECO24      ACGSHPTDVDFTHP---RIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_SALPC      ACGSHPSDVDFSHP---RIYDSDSILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_SALCH      ACGSHPSDVDFSHP---RIYDSDSILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_ECO27      ACGSHPTDVDFPHP---RIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
MERA_SHIFL      ATGASPAVPPIPGLKDTPYWTSTEALVSETIPKRLAVIGSSVVALELAQAFARLGAKVTILA-RSTLFFR
DLDH_TRYCR      ATGSEPTELPFLPFDEKVVLSSTGALALPRVPKTMXXXXXXXXXLELGSVWARLGAKVTVVEFAPRCAPT
STHA_KLEP7      ACGSHPADVDFHHP---RIYDSDSILSLQHEPRHVIIYGAGVIGCEYASIFRGMEVKVDLINTRDRLLAF
STHA_SHIB3      ACGSHPTDVDFTHP---RIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
STHA_ECO57      ACGSHPTDVDFTHP---RIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
DLDH_DICDI      ATGSEVTSLPNVNIDEESIISSTGALALKSVPKKXXXXXXXXXXXXXXXXWSRLGSETTVVEFTNRIAAG
STHA_VIBCM      ATGSHPKDVDFGHP---RIYDSDSILNLEHDPRHIIIYGAGVIGCEYASIFRGLDVKTDLINTRDRLLSF
STHA_VIBCH      ATGSHPKDVDFGHP---RIYDSDSILNLEHDPRHIIIYGAGVIGCEYASIFRGLDVKTDLINTRDRLLSF
STHA_VIBC3      ATGSHPKDVDFGHP---RIYDSDSILNLEHDPRHIIIYGAGVIGCEYASIFRGLDVKTDLINTRDRLLSF
STHA_KLEP3      ACGSHPADVDFHHP---RIYDSDSILSLQHEPRHVIIYGAGVIGCEYASIFRGMEVKVDLINTRDRLLAF
STHA_VIBPA      ATGSRPYRPSDVDFLHERIYDSDSILSLKHDPRHIIIYGAGVIGCEYASIFRGLGVKTDLINTRDRLLEF
STHA_PSEPK      ATGSRPYRPADIDFHHPRVYDSDTILSLSHTPRKLIVYGAGVIGCEYASIFSGLGVLVELVDNRGQLLSF
STHA_PSEP1      ATGSRPYRPADIDFHHPRVYDSDTILSLSHTPRKLIVYGAGVIGCEYASIFSGLGVLVELVDNRGQLLSF
STHA_HAMD5      ATGSHPESIDFTHPDSDSILELKE----EQQPKHIIIYGAGVIGCEYASIFRGLGVKVDLINTRNHLLAF
STHA_PSEU5      ATGSRPYRPADIDFNHPRIYDSDTILTLSHTPRRMIIYGAGVIGCEYASIFSGLGVLVDLIDNREQLLSF
STHA_CITK8      ACGSHPADVDFAHP---RIYDSDSILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAF
TYTR_TRYBB      ATGSWP-QMP-AIPGVEHCISSNEAFYLPEPPRRVLTVGGGFISVEFANAYKPPGGKVTLCYRNNLILRG
GSHR_CALJA      ATGGMPSSPHESQIPGASLITSDGFFELEELPSRSVIVGAGYIAVEIAGILSALGSKTSLMIRHDKVLRS
STHA_PSEPW      ATGSRPYRPADIDFHHPRVYDSDTILSLSHTPRKLIVYGAGVIGCEYASIFSGLGVLVELVDNRGQLLSF
STHA_PSEU2      ATGSRPYRPADIDFSHKRIYDSDTILSLGHTPRKLIIYGAGVIGCEYASIFSGLGVLVELVDNRDQLLSF
STHA_PSESM      ATGSRPYRPADIDFSHKRIYDSDTILSLGHTPRKLIIYGAGVIGCEYASIFSGLGVLVELVDNRDQLLSF
STHA_PSEPG      ATGSRPYRPADIDFHHPRVYDSDTILSLSHTPRKLIVYGAGVIGCEYASIFSGLGVLVELVDNRGQLLSF
STHA_PSEE4      ATGSRPYRPADIDFHHPRVYDSDTILSLSHTPRKLIVYGAGVIGCEYASIFSGLGVLVELVDNRGQLLSF
STHA_PSE14      ATGSRPYRPADIDFSHKRIYDSDTILSLGHTPRKLIIYGAGVIGCEYASIFSGLGVLVELVDNRDQLLSF
GSHR_HUMAN      ATGGMPSTPHESQIPGASLITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRS
TYTR_LEIDO      ATGSWPTRLGV--PGDEFCITSNEAFYLEDAPKRMLCVGGGYIAVEFANGYKPCGGYVDLCYRGDLILRG
STHA_PSEFS      ATGSRPYRPADIDFHHPRIYDSDTILSLGHTPRKLIIYGAGVIGCEYASIFSGLGVLVELVDNRDQLLSF
GSHR_MOUSE      ATGGVPTVPHESQIPGASLITSDGFFQLEDLPSRSVIVGAGYIAVEIAGILSALGSKTSLMIRHDKVLRN
STHA_VIBF1      ATGSRPYRPEGINFNHSRVYDSDSILSLKHDPRHIIIYGAGVIGSEYASIFRGLGVKVDLVNTRDRLLSF
GSHR_HAEIN      ATGGRPYR-PNIKGQ-EYGIDSDGFFALTELPKRAAVIGAGYIAVELSGVLNSLGVETHLLVRRHAPMRN
STHA_PSEFL      ATGSRPYRPADIDFHHPRIYDSDTILSLGHTPRKLIIYGAGVIGCEYASIFSGLGVLVELVDNRDQLLSF
STHA_PSEF5      ATGSRPYRPADIDFSHPRIYDSDTILSLGHTPRKLIVYGAGVIGCEYASIFSGLGVLVELVDNRGQLLSF
GSHR_DICDI      AAGGRPT-VPDV-PGKELGITSDGFFELEDLPKSTLVVGAGYIAVELAGVLHSLGSETTMVIRQKQFLRT
STHA_PHOPR      ATGSRPYHPEGVDFDHSRVYDSDSILQLEHDPRHIIIYGAGVIGSEYASIFRGLGVKVDLINTRHRLLEF
TYTR_TRYCR      ASGSWPH-MPNI-PGIEHCISSNEAFYLPEPPRRVLTVGGGFISVEFANAYKPKDGQVTLCYRGEMILRG
STHA_PSEPF      ATGSRPYRPADIDFHHPRIYDSDTILSLGHTPRKLIVYGAGVIGCEYASIFSGLGVLVELVDNRGQLLSF
TYTR_CRIFA      ATGSWPQHLGIEGDD--LCITSNEAFYLDEAPKRALCVGGGYISIEFANAYKARGGQVDLAYRGDMILRG
STHA_MARMS      ATGSRPYRPANIDFSHPRIYCSDTILSLSHTPRSLIIYGAGVIGCEYASIFCGLGVRVELINPAKKLLSF
GSHR_CANGA      ATGGKP-VYPEKVPGFELGTDSDGFFRLEEQPKKVVVVGAGYIGIELAGVFHGLGSDSHLVIRGKTVLRK
GSHR_ECOLI      ATGGRPSHPDI--PGVEYGIDSDGFFALPALPERVAVVGAGYIAVELAGVINGLGAKTHLFVRKHAPLRS
GSHR_ASHGO      ATGGEP-VLPEGIPGAEYGVDSDGFFRLEEQPKKVVISGSGYIATEFAGVFNGLGTETHIVIRKDHVLTK
TRXR2_BOVIN     ATGGRPRYPTHIEGALEYGITSDDLFWLKESPGKTLVVGASYVALECA-XXXXXXXXXXXVMIRSVPLRA
GSHR_RAT        ATGGVPTVPHENQIPGASLITSDGFFQLEDLPSRSVIVGAGYIAVEIAGILSALGSKTSLMIRHDKVLRS
GSHR_CAEEL      STGLRPK-YPNI-PGAELGITSDDLFTLASVPGKTLIVGGGYVALECAGFLSAFNQNVEVLV---RSIPL
YKGC_ECOLI      NTGAQXXXXXXXXXXXXXXXDSTGLLNLKELPXXXXXXXXXXXXVEFASMFANFGSKVTILEAASLFLPR
TRXR2_RAT       ATGGRPKYPTQVKGALEHGITSDDIFWLKESPGKTLVVGASYVALECAGFLTGIGLDTT-VMMRSVPLRG
GSHR_YARLI      ATGGKPR-LPDV-PGAEYGIDSDGFFALETQPKRVAVVGGGYIGVELAGVFHGLNSETTLFCRGQTVLRA
DLDH_RHIET      ---------------------------------------------EFASFYRSMGVDVTVVEVMPTIMPV
IRC15_YEAST     ATGSAVIQCPGVAIDNDKIISSDKALSLDYIPSRFTIMGGGTIGLEIACIFNNLGSRVTIVESQSEICQN
TRXR2_HUMAN     ATGGRPRYPTHIEGALEYGITSDDIFWLKESPGKTLVVGASYVALECAGFLTGIGLDTTIMM---RSIPL
DLDH_ACHLA      ATGSSAPPIPGVKEAYEKVVTSRELLNVKNYPKSXXXXXXXXXXXEFATVFNSFGSKVTIIEMMDGILPT
TRXR2_MOUSE     ATGGRPRYPTQVKGALEYGITSDDIFWLKESPGKTLVVGASYVALECAGFLTGIGLDTT-VMMRSIPLRG
STHA_PSEMY      ATGSRPYRPADVDFRHPRIYDSDTILSLGHTPRRLIIYGAGVIGCEYASIFSGLGVLVDLIDNRDQLLSF
GSHR_SCHPO      AVGGHPI-WPSHIPGAEYGIDSDGFFELESQPKRVAIVGAGYIAVELAGVFAALGTETHMFIRQSKFLRK
TRXR1_DROME     AVGGRPRDIPGAVEYG---ITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPT-VMVRSIVLRG
GSHR_KLULA      ATGGKPI-YPAKIPGYDYGVSSDEFFELEDQPKKVVVVGAGYIGVEIAGVFNGLGSDSHLVIRGETVLRK
TRXR2_DROME     AVGGRPRDIPGAVELG---ITSDDIFSYEREPGRTLVVGAGYVGLECACFLKGLGYEPT-VMVRSIVLRG
GSHR_YEAST      ATGGKAI-FPENIPGFELGTDSDGFFRLEEQPKKVVVVGAGYIGIELAGVFHGLGSETHLVIRGETVLRK
TRXR1_BOVIN     ATGERPRYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
TRXR_PLAF7      ATGCRPHIPDDVEGAKELSITSDDIFSLKKDPGKTLVVGASYVALECSGFLNSLGYDVT-VAVRSIVLRG
TRXR_PLAF5      ATGCRPHIPDDVEGAKELSITSDDIFSLKKDPGKTLVVGASYVALECSGFLNSLGYDVT-VAVRSIVLRG
TRXR1_MOUSE     ATGERPRYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
TRXR1_PIG       ATGERPRYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
TRXR3_HUMAN     ATGERPRYLGI-QGDKEYCITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGFGLDVT-VMVRSILLRG
TRXR3_MOUSE     ATGERPRYLGI-QGDKEYCITSDDLFSLPYCPGCTLVVGASYVGLECAGFLAGLGLDVT-VMVRSVLLRG
TRXR1_PONAB     ATGERPRYLGIPG-DKEYCISSDDLFSLPYCPGKTLIVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
TRXR1_HUMAN     ATGERPRYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
GSHR_PLAFK      AVGNKPVFPPVKGI--ENTISSDEFFNIKE-SKKIGIVGSGYIAVELINVIKRLGIDSYIFARGNRILRK
GSHR_DEBHA      ATGGYAINPPNV--EGHELGTTSDFFELQKQPKSVAVVGAGYIGVELSGIFKALGSETHLVIRGDTVLRS
GSHR_PLAF7      AVGNKPVFPPVKGI--ENTISSDEFFNIKE-SKKIGIVGSGYIAVELINVIKRLGIDSYIFARGNRILRK
TRXR1_CAEEL     STGLRPKEIPGVK---EYTITSDDLFQLPYSPGKTLCVGASYVSLECAGFLHGFGFDVT-VMVRSILLRG
TRXR1_RAT       ATGERPRYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
MERA_SERMA      ATGASPAMPPIPGLKESPYWTSTEALVSDTIPERLAVIGSSVVALELAQAFARLGSQVTIL-ARNTLFFR
NAOX_METJA      ATGAEPFIPPIEGKDLDGVFKVRTIEDLKYIEEKVAVVGAGAIGLEMAYGLKCRGLDVLVVEMAPQVLPR
NORW_ERWCT      ATGASAIVPPIPGREHMLTLNSQQEYRTHEAAERVLVLGAGLIGTELAMDLSRAGKRVTLVDCASSILPA
AIFM3_MOUSE     APGSSPKTLTCKGKDVENVFTIRTPEDANRVGRNAVVVGAGFLGMEVAAYLTEKAHSVSVVE-------L
TRXB_LISMO      ATGAEHRKLGAA---GEEELSGRGVSYCAVCDRELIVVGGGDSAVEEGTYLTRYADKVTIVHRRDKLR--
CDR_PYRFU       ANGASPQDLPGVPPDAVAITEYMEKNKV----EDVVIIGTGYIALEMAEAFVTRGKNVTLIGRSERVLKT
NORW_CITK8      ATGASAFVPPVAGRELMLTLNSQQEYRACETQQRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILAS
NORW_ECOLU      ATGASAFVPPVPGRELMLTLNSQQEYRACETQRRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILAS
NORW_ECOL5      ATGASAFVPPV--PGRELILTLNSQQEYRACETQLLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILAS
MDAR1_ARATH     ATGSRLSEIGVQEADVKNIFYLREIEDSDELAGKAVIIGGGFLGLEISSALRANNHEVTMVFPEPWLVHR
NORW_SHIFL      ATGASAFVPPVPGRELMLTLNSQQEYRACETQRRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILAS
NORW_SHIF8      ATGASAFVPPVPGRELMLTLNSQQEYRACETQRRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILAS
NORW_ECOL6      ATGASAFVPPVPGRELMLTLNSQQEYRACETQRRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILAS
XECC_XANP2      AVGAGPGTLDVPGVNAKGVFDHATLVELDYEPSTXXXXXXSKTAVEYGCFFNATGRRTVMLVRTEPLKLI
NORW_SHISS      ATGASAFVPPVPGRELMLTLNSQQEYRACETQRRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILAS
NORW_ECOUT      ATGASAFVPPVPGRELMLTLNSQQEYRACETQRRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILAS
NORW_ECOK1      ATGASAFVPPVPGRELMLTLNSQQEYRACETQRRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILAS
NORW_ECO45      ATGASAFVPPVPGRELMLTLNSQQEYRACETQRRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILAS
NAPE_ENTFA      SPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKVVVIGSGYXXXXXXXXXXXXXXKVTVIDILDRPLGV
NORW_ECOSM      ATGASAFVPPVPGRELMLTLNSQQEYRACETQRRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILAS
NAOX_ENTFA      TTGSWXXXXXXXXXDAENILLCKNYSQANVIIEKAXXXXXXXXXXELVEAFVESGKQVTLVDGLDRILNK
TRXB_METJA      ATGTKPKKLGLNEDKGRGISYCTMCDAFFYLNKEVIVIGRDTPAIMSAINLKDIAKKVIVITDKSELKAA
NORW_KLEP7      ATGATPRELMTLNSQREYGAAQSQLHDA----KRVLIVGGGLIGCELAMDFCRAGKAVTVVDNSASVLAA
TRXB_LISIN      ATGAEHRKLGAA---GEEELSGRGVSYCAVCDRELVVVGGGDSAVEEGTYLTRYADKVTIVHRRDKLR--
NORW_ECO27      ATGASAFVPPVPGRELMLTLNSQQEYRACETQRRVLIVGGGLIGSELAMDFCRAGKMVTLIDNAASILAS
NAOX_STRP6      --------------------------------KRVAVVGAGYIGVELAEAFQRKGKEVVLIDVVDTCLAG
NORW_SALTI      TTGATAFVPPIAGRELMLTLNSQQEYRACETPQRVLIVGGGLIGSELAMDFCRAGKTVTLMDNAASLLAS
NORW_KLEP3      ATGATPFIPPV--PGRELMLTLNQLHDA----KRVLIVGGGLIGCELAMDFCRAGKAVTVVDNSASVLAA
CDR_PYRAB       ANGASPQVPAIEGVDLKGVFTAREYMEKNRV-EDVVIVGGGYIGLEMAEAFVAQGKRVTMIVRGERILRR
NORW_ESCF3      ATGANAFVPPVPGRELMLTLNSQQEYRACETQRRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILAS
NORW_ECOHS      ATGASAFVPPVPGRELMLTLNSQQEYRACETQRRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILAS
NORW_ECO8A      ATGASAFVPPVPGRELMLTLNSQQEYRACETQRRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILAS
NORW_ECO5E      ATGASAFVPPVPGRELMLTLNSQQEYRACETQRRVLIVGGGLIGSELAMDFCRAGKMVTLIDNAASILAS
NORW_ECO57      ATGASAFVPPVPGRELMLTLNSQQEYRACETQRRVLIVGGGLIGSELAMDFCRAGKMVTLIDNAASILAS
NORW_ECO55      ATGASAFVPPVPGRELMLTLNSQQEYRACETQRRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILAS
OOXA2_RHIME     ATGAQERPMPVPGWTLQRVMTXXXXXXXXXMPSEPIVL-AGCGPLLYLLASQLIDAGVSDLTVLDTAQST
NORW_SALHS      ATGAAAFVPPIAGRELMLTLNSQQEYRACETQQRVLIVGGGLIGSELAMDFCRAGKTVTLMDNAASLLAS
NORW_SALEP      ATGAAAFVPPIAGRELMLTLNSQQEYRACETQQRVLIVGGGLIGSELAMDFCRAGKTVTLMDNAASLLAS
NORW_SALTY      ATGATAFVPPIAGRELMLTLNSQQEYRACETQQRVLIVGGGLIGSELAMDFCRAGKTVTLMDNAASLLAS
NORW_SALA4      ATGATAFVPPIAGRELMLTLNSQQEYRACETQQRVLIVGGGLIGSELAMDFCRAGKTVTLMDNAASLLAS
NORW_SALSV      ATGATAFVPPITGRELMLTLNSQQEYRACETQQRVMIVGGGLIGSELAMDFCRAGKTVTLMDNAASLLAS
NORW_SHIDS      ATGASAF-VPSV-PGRELMLTLNSQQEYRACETQLLIVGGGLIGSELAMDFCRAGKMVTLIDNAASILAS
NORW_SALG2      ATGAAAFVPPIAGRELMLTLNSQQEYRACETQQRVLIVGGGLIGSELAMDLCRAGKTVTLMDNAASLLAS
NORW_ECOSE      ATGASAFVPPVPGRELMLTLNSQQEYRACETQRRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILAS
NORW_ECO24      ATGASAFVPPVPGRELMLTLNSQQEYRACETQRRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILAS
NASD_BACSU      ATGSVPFILPIPGADKKGVTAFRDIKDTDTMLKKXXXXXXXXXXXXXXXXXXXXXMDVSVIHLAPFLMER
TRXB_CHLPN      ATGASAKEIPGAGNDEQKGVTACAVCD-GASPKDLYVIGGGDSALEEALYLTRYGSHVYVVHRRDKLRAS
NORW_ECOLI      ATGASAFVPPVPGRELMLTLNSQQEYRACETQRRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILAS
NORW_ECOLC      ATGASAFVPPVPGRELMLTLNSQQEYRACETQRRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILAS
NORW_ECODH      ATGASAFVPPVPGRELMLTLNSQQEYRACETQRRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILAS
NORW_ECOBW      ATGASAFVPPVPGRELMLTLNSQQEYRACETQRRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILAS
Y636_METJA      ATG---RNYPS-NYNGYEVLTHKDIPNLRELPENILIIGGGVVATEYASIFSDFGCNVVL----------
NORW_SHIBS      ATGASAFVPPVPGRELMLTLNSQQEYRACETQRRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILAS
NORW_SHIB3      ATGASAFVPPVPGRELMLTLNSQQEYRACETQRRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILAS
RURE_ACIAD      AVGANPTRLAIAGDGSDDIHVVNSLIDYRAFRENLVILGAGLIGCEFANDLQHTGHQVTVIDPLGRLLPA
NASB_BACSU      ATGSSPHILPIPGADKKGVYGFRTIEDCQALMQKXXXXXXXXXXXXXXXXXQHLGMDVSVIHHSAGIMQK
TRXB_CHLTR      ATGASAKRLSIPGAGDNEF--WQKGVTACAVDKDLFVVGGGDSALEEAMFLTRYGKRVFVVHRRDTLRAS
NORW_VIBFM      ATGSHTFVPPFHGDGCEDILTLNSLKEFSAIQQKILVIGGGLIGTELAMDLANAGKMVTLVEPNSHLLAN
CDR_PYRKO       --------------------------------ENVVVIGTGYIAIEMAEAFVERGKNVTLIGRSERVLKT
NORW_SALAR      ATGAAAFVPPVAGRELMLTLNSQQEYRACETQQRVLIVGGGLIGSELAMDFCRAGKTVTLMDNAASLLAS
CDR_PYRHO       ANGASPQDLP---PDALAIREYMEKYKV----ENVVXXXXXXXXXEMAEAFAAQGKNVTMIVRGERVLRR
MDAR_PEA        ATGSAVIRLTVIGANAKNIFYLREVDDADKLYEKRVVVGGGYIGLELSAVLKLNDLDVTMVYPEPWCMPR
NORW_SALPC      ATGAAALVPPIAGRELMLTLNSQQEYRACEIPQRVLIVGGGLIGSELAMDFCRAGKTVTLMDNAASLLAS
NORW_SALCH      ATGAAALVPPIAGRELMLTLNSQQEYRACEIPQRVLIVGGGLIGSELAMDFCRAGKTVTLMDNAASLLAS
CDR_STAHJ       SPGAGANSLGF---DSDYIFTLRNMEDTDAIDQKALVVGAGYISLEVLENLYARGLDVTLIHRSEKVNKL
TRXB_CHLMU      ATGASAKRLSIPGAGDNEF--WQKGVTACAVCDDLFVIGGGDSALEEAMFLTRYGKRVFVVHRRDTLRAS
TRXB_STRCL      TTGSQHRKLGLPREDAGRGVSWCATCDGFFFKDQIVVVGGGDTAMEEATFLSRFAKSVTIVHRRDSLR--
MDAR3_ARATH     ATGSTVLRLTVKGADSKNILYLREIDDADKLVEAIXXXXXXXXGLELSAVLRINNLDVTMVFPEPWCMPR
MDARS_CUCSA     ATGSTVIKLSVQGADAKNIFYLREIDDADQLVEAIXXXXXXYIGLELGAALRINNFDVSMVYPEPWCMPR
BEDA_PSEPU      ATGSRARMLSLPGSQLPGVVTLRTYGDVQLLRDRLLIVGGGLIGCEVATTARKLGLSVTILEAGDELLRV
NORW_SALPK      ATGAAAFVPPIAGRELMLTLNNQQEYRACETPQRVLIVGGGLIGSELAMDFCRAGKTVTLMDNAASLLAS
NORW_SALPA      ATGAAAFVPPIAGRELMLTLNNQQEYRACETPQRVLIVGGGLIGSELAMDFCRAGKTVTLMDNAASLLAS
AHPF_STAES      STGASWRKLNI--PGEDRLINKGVAFPLFENKD-VAVIGGGNSGVEAAIDLAGIVKHVTLLQERLRSLPN
AHPF_STAEQ      STGASWRKLNI--PGEDRLINKGVAFPLFENKD-VAVIGGGNSGVEAAIDLAGIVKHVTLLQERLRSLPN
NORW_ENT38      ATGASAFVPLIEGHELMLTLNSQQEYKACETAQRVMIVGGGLIGTELAMDFCRAGKSVTLVDHAARILSA
CDR_STAAW       --------------------------------DKVLVVGAGYVSLEVLENLYERGLHPTLIHRSDKINKL
CDR_STAAS       --------------------------------DKVLVVGAGYVSLEVLENLYERGLHPTLIHRSDKINKL
CDR_STAAN       --------------------------------DKVLVIGAGYVSLEVLENLYERGLHPTLIHRSDKINKL
CDR_STAAM       --------------------------------DKVLVIGAGYVSLEVLENLYERGLHPTLIHRSDKINKL
CDR_STAAB       --------------------------------DKVLVVGAGYVSLEVLENLYKRGLHPTLIHRSDKINKL
CDR_STAA9       --------------------------------DKVLVIGAGYVSLEVLENLYERGLHPTLIHRSDKINKL
CDR_STAA2       --------------------------------DKVLVIGAGYVSLEVLENLYERGLHPTLIHRSDKINKL
CDR_STAA1       --------------------------------DKVLVIGAGYVSLEVLENLYERGLHPTLIHRSDKINKL
AHPF_STAAW      ATGAGWRKLNI--PGEEQLINKGVAFPLFENKD-VAVIGGGNSGVEAAIDLAGIVNHVTLFEF------A
AHPF_STAAN      ATGAGWRKLNI--PGEEQLINKGVAFPLFENKD-VAVIGGGNSGVEAAIDLAGIVNHVTLFEF------A
AHPF_STAAM      ATGAGWRKLNI--PGEEQLINKGVAFPLFENKD-VAVIGGGNSGVEAAIDLAGIVNHVTLFEF------A
AHPF_STAAC      ATGAGWRKLNI--PGEEQLINKGVAFPLFENKD-VAVIGGGNSGVEAAIDLAGIVNHVTLFEF------A
AHPF_STAA8      ATGAGWRKLNI--PGEEQLINKGVAFPLFENKD-VAVIGGGNSGVEAAIDLAGIVNHVTLFEF------A
TRXB_STAAW      ATGAEYKKIPGEQELGGRGVSYCAVCDGAFFKNKLFVIGGGDSAVEEGTFLTKFADKVTIVHRRDELR--
TRXB_STAAS      ATGAEYKKIPGEQELGGRGVSYCAVCDGAFFKNKLFVIGGGDSAVEEGTFLTKFADKVTIVHRRDELR--
TRXB_STAAR      ATGAEYKKIPGEQELGGRGVSYCAVCDGAFFKNKLFVIGGGDSAVEEGTFLTKFADKVTIVHRRDELR--
TRXB_STAAN      ATGAEYKKIPGEQELGGRGVSYCAVCDGAFFKNKLFVIGGGDSAVEEGTFLTKFADKVTIVHRRDELR--
TRXB_STAAM      ATGAEYKKIPGEQELGGRGVSYCAVCDGAFFKNKLFVIGGGDSAVEEGTFLTKFADKVTIVHRRDELR--
TRXB_STAAC      ATGAEYKKIPGEQELGGRGVSYCAVCDGAFFKNKLFVIGGGDSAVEEGTFLTKFADKVTIVHRRDELR--
NAOX_MYCPN      --------------------------------KSVAIVGSGYIGLELAEAAWQCGKQVTVIDMLDKPAGN
AIFM1_HUMAN     ATGGTPRSLSAIDRAGAEVKSFRSLEKISREVKSITIIGGGFLGSELACALRALGTEVIQLGNMGKILPE
FENR_SALAI      TGGLGPRPLPVA----ERFLGTGIVYFVPQPADDVLIVGGGDSAFDWASTLQPLARSVTLVHRREXXXXX
CDR_STAAR       --------------------------------DKVLVVGAGYVSLEVLENLYERGLHPTLIHRSDKINKL
NORW_SALNS      ATGATAFVPPIAGRELMLTLNSQQEYRACETQQRVLIVGGGLIGSELAMDFCRAGKTVTLMDNAASLLAS
NORW_SALDC      ATGATAFVPPIAGRELMLTLNSQQEYRACETQQRVLIVGGGLIGSELAMDFCRAGKTVTLMDNAASLLAS
R34K_CLOPA      ATGAKSRRLPI--PEEEKVIHYCELCDGALYQGKLVVVGGGNSAVEAAIFLTKYARNITIVHQFDYLQAQ
NORW_VIBVU      ------------------------------------------------------GKQVTVVEPNARLLAN
NORW_ECO81      ATGASAFVPPVPGRELMLTLNSQQEYRACETQRRVXXXXXXXXXSELAMDFCRAGKMVTLIDNAASILAS
FENR_SALTO      TGGLGPRPLPVA----ERFVGTGIIYFVPQTGQDVLIVGGGDSAFDWASTLQPLARSVTLVHRREKFXXX
AHPF_STAAR      ATGAGWRKLNI--PGEEQLINKGVAFPLFENKD-VAVIGGGNSGVEAAIDLAGIVNHVTLFEF------A
AIFM1_DICDI     ATGGEPRQLKFTSTNDKKISTYRTVEDFRKLYEHVTVLGGGFLGSELTCAFQDKNIKIDQIFPESGVLST
TRXB_RICFE      CTGAEAKWLSIASEQEFRCATCDGFFFKNQ---EIVVVGGGNSAVEEALYLTNHASKVTITHRRDSFR--
TRXB_MYCSM      AMGAAARHLGVPGEEGMGVSTCATCDGFFFRDQDIVVVGGGDSAMEEATFLTRFARSVTLIHRRDEFRAS
MDAR2_ARATH     ATGARAEEFGVEGSDAENVCYLRDLADANRLATVIVVIGGGYIGMECAASLVINKINVTMVFPEAHCMAR
YMER_STAAU      ----------------------------------------------------------------------
AIFM1_RAT       ATGGTPRSLSAIDRAGAEVKSFRALEKISREVKSITVIGGGFLGSELACALQASGIEVIQLGNMGKILPE
AIFM1_MOUSE     ATGGTPRSLSAIDRAGAEVKSFRALEKISREVKSITVIGGGFLGSELACALQASGIEVIQLGNMGKILPQ
AHPF_STAAS      ATGAGWRKLNI--PGEEQLINKGVAFPLFENKD-VAVIGGGNSGVEAAIDLAGIVNHVTLFEF------A
TODA_PSEP1      ATGSRARTMALPGSQLPGVVTLRTYGDVQVLRDRLLIVGGGLIGCEVATTARKLGLSVTILEAGDELLRV
STHA_PECCC      ----------------------------------------------------------------------
CDR_STAES       SPGASANRLNT---HSDISFTVRNLEDTNTKAQRALVVGAGYISLEVLENLHHRGLDVTWIHRSTNINKL
CDR_STAEQ       SPGASANRLNT---HSDISFTVRNLEDTNTKAQRALVVGAGYISLEVLENLHHRGLDVTWIHRSTNINKL
TRXB_RICCN      CTGAEAKWLGIASEQKFRCATCDGFFFKNQ---EIVVVGGGNSAVEEALYLTNHANKVTIVHRRDSFR--
NORW_VIBVY      ------------------------------------------------------GKQVTVVEPNARLLAN
NORW_ECO7I      ATGASAFVPPV--PGRELMLTLNSQQEYRACETQLXXXXXXXXXXELAMDFCRAGKAVTLIDNAASILAS
NIRB_KLEOX      ATGSYPFVPPVPGHNLEGCFVYRTLDDLDQXXXXXXXXXXXXXXXXXXXXXKQLGLETHVVEFAPNLMAV
NAOX_LACLM      ATGSRPPNLPGKDLKGIHFLKLGQAIDAEFAKEKIAVIGAGYIGTEIAEAAKRRGKEVLLFDAENTSLAS
TRXB_STRCO      TTGSQHRKLGLPNEDAGRGVSWCATCDGFFFKDQIAVIGGGDTAMEEATFLSRFAKSVTIVHRRDTLRAS
TRXB_SCHPO      ATGASARRLHITGEDTQAGISACAVCD-GAVPKPLAVVGGGDSAAEEAQFLTKYGSKVYVLVRRDK-LRA
FENR_LACCB      ATGGGPRKLAV---DYDPALEGKKLFDLETFDQEVAVAGGGDSAIDWALALEPVAKHVSLIHRRAKFRGL
FENR_LACC3      ATGGGPRKLAV---DYDPALEGKKLFDLETFDQEVAVAGGGDSAIDWALALEPVAKHVSLIHRRAKFRGL
TRXB_BACSU      AAGAEYKKIPGEKELGGRGVSYCAVCDGAFFKGKLVVVGGGDSAVEEGVYLTRFASKVTIVHRRDKLRAQ
TRXB_STAES      STGAEYKKIPGEQELGGRGVSYCAVCDGAFFKNKLFVIGGGDSAVEEGTFLTKFADKVTIVHRRDELR--
TRXB_STAEQ      STGAEYKKIPGEQELGGRGVSYCAVCDGAFFKNKLFVIGGGDSAVEEGTFLTKFADKVTIVHRRDELR--
THCD_RHOER      ATGARNRLLPVPGANLPGVHYLRTAGEAEXXXXXLVVIGAGFIGLEVAAAARKKGLDVTVVEAMDRPM--
TERPA_PSESP     ATGSHPRFMATGQADNLCYLSWRIRQQLGE-ASRIVVLGGGFIGLEIASSACKMGKHVTVIERAPRLLSR
FENR1_BACP2     MGHGIPVQRKLEIEHADRYEVTNLYYTVQELKKRVVISGGGDSAVDWANALVPIAESVTVVHRRDKNVAN
DHNA_BACSU      ------------------------------------VIGGGNSGIEAAIDLAGIVNHVTVLE----FAPE
CDR_STAA8       --------------------------------DKVLVVGAGYVSLEVLENLNERGLHPTLIHRSDKINKL
TRXB_SPIBA      ATGSTAQRLDVI---GEKQF-WQKGVSACAVCDSMVVVGGGDVACEEASYLSNIASKVYLILRRDAFRAS
TRXB_COXBU      ATGASARYLPSEKAYGKGVSACATCDGFFYRGKKVAVVGGGNTAVEEALYLSHIASHVTLIHRRDK-LRA
HCAD_ECOLU      ATGXXXXXXXXXXXXGERCFTLRHADDAARLREVLVIVGAGTIGLELAASATQRGCKVTVIELAATVMRN
CDR_STAS1       -----------------------------------LVVGTGYIGLEILDNLYERGISPTLIHRSTHINKL
CDR_STAAT       --------------------------------DKVLVVGAGYVSLEVLENLYERGLHPTLIHRSDKINKL
CDR_STAAE       --------------------------------DKVLVVGAGYVSLEVLENLYERGLHPTLIHRSDKINKL
CDR_STAAC       --------------------------------DKVLVVGAGYVSLEVLENLYERGLHPTLIHRSDKINKL
CDR_STAA3       --------------------------------DKVLVVGAGYVSLEVLENLYERGLHPTLIHRSDKINKL
TRXB_BORBU      AVGSKPKKLETLKNSG---LFWNKGISVCAICDGHLFKGKRV--AVIGGGNTALSESIYLSKLVDKVVRK
DHNA_BACYN      ------------------------------------VIGGGNSGVEAAIDLAGIVNHVTVLE----FMPE
CAMA_PSEPU      ATGGRPRPLPVASGAVGKANNFRYLRTLEDAENRLVVIGGGYIGLEVAATAIKANMHVTLLDTAARVLER
AIFM3_HUMAN     APGSSPKTLSCKGKEVENVFTIRTPEDXXXXXXXXXXXXXXXXXXXFLG--MEVAAYLTEKAHSVSVVEL
TRXB_RICPR      CTGAESKWLGIASEQGFGVSSCAICDGFFFKNQEIVVVGGGNSALEEALYLTNHANKVTVVHRRNSFR--
NORW_SERP5      ------------------------------------------------------GKQVTLVDRSGSLLSL
HCAD_ECO24      ATGXXXXXXXXXXXXGERCFTLRHAGDAARLREVLVIVGAGTIGLELAASATQRRCKVTVIELAATVMRN
HCAD_ECO7I      ATGXXXXXXXXXXXXGERCFTLRHAGDAARLREVLVIVGAGTIGLELAASATQRGCKATVIELAATVMRN
HCAD_ECOSM      ATGXXXXXXXXXXXXGERCFTLRHAGDAARLREVLVIVGAGTIGLELAASATQRGCKVTVIELAATVMRN
AIFM1_DROME     ATGCAPKNLPMLRDAPEKVMVYRTPDDFDRLRKSITIVGNGFIGSELACSLAHYSRENN--GGKVYQVFQ
AHPF_PSEPU      ATGARWREMNVP---GEQEYRGRGVAYCPHCDKRVAVIGGGNSGVEAAIDLAGIVAQVTLIEFDSQLRA-
AHPF_PSEPK      ATGARWREMNVP---GEQEYRGRGVAYCPHCDKRVAVIGGGNSGVEAAIDLAGIVAQVTLIEFDSQLRA-
TRXB_RICTY      CTGAESKWLGITSEQGFGVSSCAICDGFFFKNQDIVVVGGGNSALEEALYLTNHANKVTVVHRRNSFR--
TRXB_ECOLI      ATGASARYLGLPSEEGRGVSACATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFR-A
TRXB_ECO57      ATGASARYLGLPSEEGRGVSACATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFR-A
TRXB_DICDI      ATGATAKRMPGETEFWSKGVSACAVCD-GALPKHLVVVGGGDTAAEEATFLTHFASKVTLLVRRN-VMRA
NORW_SALPB      ATGATAFVPPITGRELMLTLNSQQEYRACETQQRVXXXXXXXXXSELAMDFCRAGKTVTLMDNAASLLAS
NORW_AERS4      ATGAS-----AARPDSEQLVTLQQEYAAAEGPRRILVLGAGLIGCELAMDMASDGREVTXXXXXXXXXXX
MDAR_SOLLC      ATGTTVLKLSVQGADSKNIFYLREIDDADQLVEXXXXXXXXXXGLELSAVLRLNNIEVNMVYPEPWCMPR
AHPF_XANCH      --------------------------------KRVAVIGGGNSGVEAAIDLAGIVAHVTLVEFDDKLRA-
AHPF_SALTY      ATGAKWRNMNVPGEDQYRTVTYCPHCDGPLFKGKRVVIGGGNSGVEAAIDLAGIVEHVTLLE----FAPE
MDAR4_ARATH     ATGSSVIRLSVPGADAKNIFYLRELEDADYLAYAMETKEKGKAGLELGAALKANNLDVTMVYPEPWCMPR
HCAD_ECOSE      ATGXXXXXXXXXXXXGERCFTLRHAGDAARLREVLVIVGAGTIGLELAASATQRRCKVTVIELAATVMRN
HCAD_ECO5E      ATGXXXXXXXXXXXXGERCFTLRHAGDAARLREVLVIVGAGTIGLELAASATQRRCKVTVIELAATVMRN
HCAD_ECO57      ATGXXXXXXXXXXXXGERCFTLRHAGDAARLREVLVIVGAGTIGLELAASATQRRCKVTVIELAATVMRN
HCAD_ECO55      ATGXXXXXXXXXXXXGERCFTLRHAGDAARLREVLVIVGAGTIGLELAASATQRRCKVTVIELAATVMRN
FENR_FRASC      TGGLGPRPLPTGTAHGRGLVYFVPKLDVHT-GQDVIVVGGGDSAFDWALALEPIARSVTLVHRRDRFMST
HCAD_ECOLI      ATGXXXXXXXXXXXXGERCFTLRHAGDAARLREVLVIIGAGTIGLELAASATQRRCKVTVIELAATVMRN
HCAD_ECOLC      ATGXXXXXXXXXXXXGERCFTLRHAGDAARLREVLVIIGAGTIGLELAASATQRRCKVTVIELAATVMRN
HCAD_ECOHS      ATGXXXXXXXXXXXXGERCFTLRHAGDAARLREVLVIIGAGTIGLELAASATQRRCKVTVIELAATVMRN
HCAD_ECODH      ATGXXXXXXXXXXXXGERCFTLRHAGDAARLREVLVIIGAGTIGLELAASATQRRCKVTVIELAATVMRN
HCAD_ECOBW      ATGXXXXXXXXXXXXGERCFTLRHAGDAARLREVLVIIGAGTIGLELAASATQRRCKVTVIELAATVMRN
TRXB_MYCPU      ASGMKPREILNYDEFENRGVSYCVICDGPMYGHNAIIIGGGNSAVEEGTFLSSIASKVYVIV-RDSDFIA
AHPF_ECOLI      ATGAKWRNMNVPGEDQYRTVTYCPHCDGPLFKGKRVVIGGGNSGVEAAIDLAGIVEHVTLLE----FAPE
TRXB_EUBAC      ATGAAPR---LAGCPGEQELTGKGVSDFFEDME-VFVVGGGDTAVEEAMYLAKFARKVTIVHRRDELRA-
FENR_LACF3      GNGAFPRKL--ALPGAEELEGKQVRYFANHKEDRVAVLGGGDAAIDMALMLEDVAEQVYLVHRRDAFRAL
TRXB_CLOLI      ATGASPK---LAGCPGEKELTGKGVSDFFEDME-VFVIGGGDTAVEEAMFLTKFARKVTIVHRRAELRA-
MDARP_ARATH     ---------------------------------------------EVAAAAVAWNLDTTIVFPEDQLLQR
HCAD_PHOLL      TMGARARRFPLLDQLGENIYTLRTLDDAQRLRQRXXXXXXXXXXXELAATSCELGANVTVIEQADNIM--
FENR_ACHLI      --------------------------DLNQFKDKKIVVGGGDSALDWAIDLSEYTKDVTLVHRRDEFRAL
DLDH_HYMDI      ----------------------------------------------------------------------
YDGE_SCHPO      ATGGEPNKLPIPGLDSKNVYLLRSIADASKLKKNIVIIGSSFIGLELAVVLKDHNVSVIGMESFEKVMGK
FENR_FRAAA      TGGLGPRPLPTGTGHGRGLVYFVPKLDVYA-DQDVIVVGGGDSAFDWALALEPIARSVTLVHRRDRAATI
FENR1_BACSK     --------------------------------KRVLISGGGNAAVDWANELANISKEVVVCHRRDEFKNV
NIRB_ECOLI      ATGSYPWIPPIKGSDTQDCFVYRTIEDLNAIEKRXXXXXXXXXXXXXXXXXKNLGIETHVIEFAPMLMAE
MNMG_PERMH      TTG-------------------------------------------------------------------
TRXB_RICBR      CTGAEARWLPTEQEGVSACATCDGFFFKNQKXXXXXXXNSAVEEALYLTNH---ASKVTIVHRRDNFR--
GGR2_METBU      ADGVESK---------------------------------------------------------------
FENR_SYMTH      TAGIEPNRIPSARQEGKGVF-----YSVTNLPQRVLVIGGGDSAVDYALMVEPIAAEVTLIHRRDGFRAH
FENR_RALPJ      LEGRHLHYADTARFTGKRV----------------VIAGGGDSALDWALALRKVAARVTLVHRREG-FRA
BAIH_EUBSP      ----------------------------------------------------------------------
NIR_EMENI       ATGSDA-VLPTSTPDAKGIFVYRTISDLERLMEXXXXXXXXXEAAKAMTDLEDFGS-VKLIDRNKWVLAR
FENR_LACRJ      GNGAFPRKLAAAEIEGKQ-LSYFVNHKADYADKRVAILGGGDSAIDIALMLEPVAKEVHLVHRRDQFRGT
FENR_LACRD      GNGAFPRKLAAAEIEGKQ-LSYFVNHKADYADKRVAILGGGDSAIDIALMLEPVAKEVHLVHRRDQFRGT
BPHG_BURXL      --------------------------------QSLVIVGGGLIGCEVATTARKLSVHVTILEAGDRVLGH
AHPF_PSEAE      --------------------------------KRVAVIGGGNSGVEAAIDLAGIVAHVTLLEFDSKLRA-
TRXB_NEUCR      ATGASARRLPGEEKYWQNGISACAVCD-GAVPKHLVVIGGGDSAAEEAMYLTKYGSHVTVLVRKDK-LRA
FENR_ACIC1      TAGIGPRRLPVGQEYEGRGLRYFVPNPQELAGKRILVVGGGDSAVDYALMLEKVAASVTLIHRRHEFRAH
TRXB_TREPA      ATGAEHRKMPGESEFLGRGVSYCATCDGPFFRNKVVVIGGGDAACDESLVLSRLTDRVTMIHRRD-TLRA
TODA_PSEPU      ATGSRARTMALPGSQLPGVVTLRTYGDVQVLRDRLLIVGGGLIGCEVATTARKLGLSVTILEAGDELLRV
FENR_STRSY      GGGAFPRPLEIDGADSFDNVHYHVSNIQQYADKDIVVLGGGDSAVDWSLAFEKIAKTTQIIHRRDNFRAL
FENR_STRS2      GGGAFPRPLEIDGADSFDNVHYHVSNIQQYADKDIVVLGGGDSAVDWSLAFEKIAKTTQIIHRRDNFRAL
BNZD_PSEPU      ATGSRARTMALPGSQLPGVVTLRTYGDVQVLRDRLLIVGGGLIGCEVATTARKLGLSVTILEAGDELLRV
THI4_HALWD      STG-------------------------------------------------------------------
FENR_NOCSJ      TAGISPRPLPAGDGWLGRGLEFFVPSFAPYAGKDVVIVGGGDSAFDWALHLEPVARSVTLVHRRDGFQRT
FENR_LACDB      GNGAFKKKFPLATPEAEDHIHYFFKNPDLFAGQKIGIFGGGDTALDWAQELSQI-ADVTLVHRRDQFRGM
FENR_LACDA      GNGAFKKKFPLATPEAEDHIHYFFKNPDLFAGQKIGIFGGGDTALDWAQELSQI-ADVTLVHRRDQFRGM
TRXB_PENCH      ATGANARNLPGEETYWQNGISACAVCD-GAVPKPLYVIGGGDSAAEEAMFLAKYGSSVTVLVRKDKLR--
TRXB1_ARATH     ATGAVAKRLSFVGSGEASGGFWNRGISACAVCDPLAVIGGGDSAMEEANFLTKYGSKVYIIHRRDAFR--
MNMG_SULSY      TTG-------------------------------------------------------------------
FENR2_BACSK     TAGAGPRKLQVEKADFYEDKNIHYIRDLSAFTGKVVVIGGGDSAVDWALMLEPIAKEVTLVHRRDAFRAH
FENR1_OCEIH     ----HPKRLNLEGAEKYEVTNLNKITSLQRYKDKRVIIGGGNSAVDWANELVDIAKSVYLTYRKD-VLSG
TRXB_YARLI      ATGASAKRLSLPGEDQY----WQQGISAGAVPKPLAVVGGGDSAAEEALFLTKYGSKVYVIVRKDKVMAK
NORW_AERHH      ---------------------------------RILVLGAGLIGCELAMDMASDGREVXXXXXXXXXXXX
FENR_SULTO      --------------------TVRRKKDFEG--KRVLIVGGGDSAVDWALTLAPVAKSVTLIHRRDQFRAH
FENR_BURVG      --------------------------DMNGLATNVVVAGGGDSALDWALALRSVARHVTLVHRRSGFSAT
FENR1_EXIS2     AGNGSFAARPLGVADAERFEGSNLHYFVNEMDRQVVLLGGGDSAVDWSLMLEPIAKSVTLVHRRDKFRAH
TRXB_ASHGO      ATGASAKRLPGEETYWQRGISACAVCD-GAVPKPLAVVGGGDSACEEASFLTKYGSKVFMLVRKDHMR--
TRXB2_ARATH     STGAVAKRLSTGSGEGNRGISACAVCD-GAAPKPLVVIGGGDSAMEEANFLTKYGSKVYIIHRRDKIMQQ
NORW_VIBF1      -------------------------------------------GTELAMDLANAGKMVTLVEPNTHLLAN
FENR1_BACA2     ----------------------------------VVISGGGDTAVDWANELEPIAASVTVLHRREEFLES
TRXB_CANGA      ATGASAKRLHIP---GEETY-WQQGISAGAVPKPLAVIGGGDSACEEAQFLTKYGSKVYLIVRKDHLRAS
GGR_UNCMA       ADGVESK---------------------------------------------------------------
FENR_BURP8      --------------------------------KKMVVAGGGDSALDWALALRTVAQHVTLVHRRNGFSAT
FENR1_BACSU     ACGMGTLEVNEFDSEDAARYAGKNLYGVEKLDKRVVISGGGDTAVDWANELEPIAASVTVVHRREEFGGM
THI4_HALSA      ATG-------------------------------------------------------------------
THI4_HALS3      ATG-------------------------------------------------------------------
PYRD1_MOUSE     ----------------------------------------------------------------------
FENR2_OCEIH     -----PRRLNIGNSEAEGKNLHYYVRDMNQYKGKRVVLGGGDSAVDWALMLEKIAAKVTLVHRRDQFRAH
PYRD1_RAT       ----------------------------------------------------------------------
DHNA_ECOLI      ----------------------------------IAIVGGGATGAELHNAVKQLHSNVTLVEAGERILPA
TRXB_BUCAI      ATGANPRYLGLQSESGKGVSTCAVCDGFFYKNKEVAVVGGGNTAIEETLYLSNFVKKVHLI--HRGINFR
CRTI_MYXXA      ----------------------------------------------------------------------
PURT_SYNP6      ----------------------------DRLPRRLMLLGSGELGKEFAIAAQRLGNTVIAVDRYAHAPAM
PURT_SYNE7      ----------------------------DRLPRRLMLLGSGELGKEFAIAAQRLGNTVIAVDRYAHAPAM
MNMG2_FUSNN     ----------------------------------------------------------------------
FENR_PROVI      --------------------------------KRVVIVGGGDSALDWTVGLQGVASGITLVHRMHEFQG-
MNMG_DESAP      ----------------------------------------------------------------------
FENR_IGNH4      ------------------------------------------------------GAQVTIVHRRDQFRAP
FENR_DEIGD      ----------------------------------------------------------------------
DHA_BACSH       ---------------------------------KVTVIGGGIAGTNAAKIAVGMGADVTVID--------
YEIT_ECO57      ----------------------------------------------------------------------
TRXB_MYCPN      ATGMLERKLGVAKEDHGKGISYCAICDGSLYKDQVVVVGGGNSAIQEALYLASMAKTVHLIHRREGFRAD
TRMFO_RHIME     ATG------PLTAPD-------------------------------------------------------
MNMG_MYCPN      TTGTY-----------------------------------------------------------------
MNMG_CAMHC      ----------------------------------------------------------------------
YEIT_SALTY      ----------------------------------------------------------------------
YEIT_SALTI      ----------------------------------------------------------------------
THI4_HALMA      ATG-------------------------------------------------------------------
TETX_BACFR      ----------------------------------------------------------------------
STCD_RHIME      ----------------------------------------------------------------------
MICA2_HUMAN     ----------------------------------------------------------------------
FTHS_ARATH      -------------------ITWRRVMDVNDRFLRKITIGQ---GPEEKGMTRETGFDISVASEIMAVLAL
YPDA_BACSU      ----------------------------------------------------------------------
MNMG_COXBU      ----------------------------------------------------------------------
MNMG_COXBR      ----------------------------------------------------------------------
MNMG_COXBN      ----------------------------------------------------------------------
MNMG_CAMFF      ----------------------------------------------------------------------
PYRD1_PONAB     ----------------------------------------------------------------------
MNMG_UREPA      TTGTYLKSI-------------------------------------------------------------
MNMG_UREP2      TTGTYLKSI-------------------------------------------------------------
MICA2_MOUSE     ----------------------------------------------------------------------
LSDA_DROME      ---------------------------------KVIVIGAGISGLAVAHQLQQFGMDVIVLEARDRV---
HMT2_SCHPO      ----------------------------------------------------------------------
FTHS_SPIOL      -------------------ITWRRVMDVNDRFLRKISVGQ---GPDEKGMVRETGFDISVASEIMAVLAL
YEIT_ECOLI      ----------------------------------------------------------------------
TRMFO_SINMW     ATG------PLTAPD-------------------------------------------------------
PURT_CHLTE      ------------------------------MPKTIMLLGSGELGKEFVIAVKRLGQRVVAVDSYDDAPAQ
MNMG_XANOR      ----------------------------------------------------------------------
MNMG_XANOM      ----------------------------------------------------------------------
MNMG_UREU1      TTGTYLKSI-------------------------------------------------------------
MNMG_BACSK      TTGTYLR---------------------------------------------------------------
LEU1_PROMP      NTEDHTEDTAVAIGTGPVDAVCEALNALTKVPNELI----EFSVKSVTEGIDALGEVTIRIRNKNKIYSG
FENR_RHORT      ---------------------------------KVVIAGGGDSAVDWAISLSDVAERVHVVHRRPKFRCA
AHPF_XANCH      ----------------------------------------------------------------------
AHPF_PSEAE      ----------------------------------------------------------------------
DHA_BACSH       ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           QDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAG
DLDH1_BACSU     FEKQMSSLVTRRLKKKGVEIHTNAMAKGVEERPDGVTVTFEEEKTVDADYVLITVGRRPNTDELGLEQVG
DLDH_CHLPN      NNKEVSQTVTNKFTKQGIRILTKASISAIEESQNQVRITVND-QVEEFDYVLVAIGRQFNTASIGLDNAG
DLDH_ZYMMO      EDAEVSAYVAKAFKKRGIRILTQSALQNLTPDDEGVTAEIADGKVTKESHAIVAIGVVANVENIGLDKLG
DLDH_HALVO      YESDVARVVRKRAEELGIDMHLGEGATGWREEDDGIMVETEDGEENEADKVLVAVGRSPVTDTMDIENAG
DLDH_CHLTR      NNPDISKTMFDKFTRQGLRFVLEASVSNIE--DIGDRVRLTNGNVEEYDYVLVSIGRRLNTENIGLDKAG
DLDH_CHLMU      NNPDISKTMFDKFTRHGIRFMLGASVSSIE--DMGDRVRLTNGNIEEYDYVLVSIGRRLNTENIGLDKAG
DLDH1_BACST     FEKQMAAIIKKRLKKKGVEVVTNALAKGAEEREDGVTVTYEETKTIDADYVLVTVGRRPNTDELGLEQIG
DLDH_STAAW      FEKQMTQPVKKGMKEKGVEIVTEAMAKSAEETDNGVKVTYEEEKTIEADYVLVTVGRRPNTDELGLEELG
DLDH_STAAU      FEKQMTQPVKKGMKEKGVEIVTEAMAKSAEETDNGVKVTYEEEKTIEADYVLVTVGRRPNTDELGLEELG
DLDH_STAAS      FEKQMTQPVKKGMKEKGVEIVTEAMAKSAEETDNGVKVTYEEEKTIEADYVLVTVGRRPNTDELGLEELG
DLDH_STAAR      FEKQMTQPVKKGMKEKGVEIVTEAMAKSAEETDNGVKVTYEEEKTIEADYVLVTVGRRPNTDELGLEELG
DLDH_STAAN      FEKQMTQPVKKGMKEKGVEIVTEAMAKSAEETDNGVKVTYEEEKTIEADYVLVTVGRRPNTDELGLEELG
DLDH_STAAM      FEKQMTQPVKKGMKEKGVEIVTEAMAKSAEETDNGVKVTYEEEKTIEADYVLVTVGRRPNTDELGLEELG
DLDH_STAAC      FEKQMTQPVKKGMKEKGVEIVTEAMAKSAEETDNGVKVTYEEEKTIEADYVLVTVGRRPNTDELGLEELG
DLDH_CHLP8      EEAEVSEALKRSFEKVDITVQCGAKLGNVAISEFGVLAEGKEPQKIEASCMLVAVGVTGVIDGLGLDAAG
DLDH_CHLTE      EEAEVSEALKRSFEKAGITVHCGAKLDNVAVSESGVSAEL----VVEGSSCLLAVGVTGAIDGLGLDAVG
DLDH2_HALMA     YEDDIATVVRDRAEELGIDFNFGEAADNWEETDEGIRVQXXXXXXYNAEKCLVAVGREPVTDTLALDNID
DLDH_THESC      GDRETAALLRKALEKEGLKVRTGTKAVGYEKKQDGVLLEAAQGEEIVVDKILVAVGRRPRTEGLGLEKAG
DLDH3_PSEAE     LDGETARTLQRALTRQGMRFRLGTRVVAARSGEQGVELDLQPAESLQADYVLVAIGRRPYTEGLGLETVG
DLDH3_PSEPU     TDTETAKTLQKALAKQGMVFKLGSKVTQATASADGVSLVLETAESLQADYVLVAIGRRPYTKGLNLESVG
DLDH_PIG        GDMEVSKNFQRILQKQGFKFKLNTKVIGATKKSDGVSIEAASGGKAEVITCLVCIGRRPFTQNLGLEELG
DLDH_CANFA      GDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVSIEGEVITCDVLLVCIGRRPFTQNLGLEELG
DLDH_MOUSE      GDMEISKNFQRILQRQGFKFKLNTKVTGATKKSDGVSVEAASGGKAEVITCLVCIGRRPFTQNLGLEELG
DLDH_CRIGR      GDMEISKNFQRILQKQGFKFKLNTKVTGATKRSDGVSVEAASGGKAEVITCLVCIGRRPFTQNLGLEELG
DLDH_RAT        GDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGVSVEAASGGKAEVITCLVCIGRRPFTQNLGLEELG
DLDH_MACFA      GDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGVSIEAASGGKAEVITCLVCIGRRPFTKNLGLEELG
DLDH_HUMAN      GDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGVSIEAASGGKAEVITCLVCIGRRPFTKNLGLEELG
DLDH_AZOVI      VDEQVAKEAQKILTKQGLKILLGARVTGTEVKNKQVTVKFVDAEGEKSDKLIVAVGRRPVTTDLLAADSG
DLDH_PONAB      GDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGVSIEAASGGKAEVITCLVCIGRRPFTKNLGLEELG
DLDH2_BACSU     EDLEISKEMESLLKKKGIQFITGAKVDTMTKTSDDISIQAEDGETVTYSKMLVSIGRQANIEGIGLENTD
DLDH1_PSEAE     YDEELTKPVAQALRRLGVELLGHSL---LGPSENGVRVRDGAGREIAADQVLVAVGRKPRSEGWNLESLG
DLDH_PSEFL      ADEQIAKEALKVLTKQGLNIRLGARVTASEVKKKQVTVTFTDANGEQKEKLIVAVGRRPVTTDLLAADSG
DLDH2_PSEAE     ADEQIAKEALKVLTKQGLNIRLGARVTASEVKKKQVTVTFTDANGEQKEKLIVAVGRRPVTTDLLAADSG
DLDH2_PSEPU     ADTAVSKEAQKTLTKQGLDILGNGNEVEVTYTNAEGEQKITFDKLI------VAVGRRPVTTDLLAADSG
DLDH_SHIFL      ADKDIVKVFTKRISKK-FNLMLETKVTAVEAKEDGIYVTM-EGKKAPADAVLVAIGRVPNGKNLDAGKAG
DLDH_SCHPO      MDADISKALSRIISKQGIKFKTSTKLLSAKVNGDSVEVEIENMKTYQTDVLLVAIGRVPYTEGLGLDKLG
DLDH_ECOLI      ADKDIVKVFTKRISKK-FNLMLETKVTAVEAKEDGIYVTM-EGKKAPADAVLVAIGRVPNGKNLDAGKAG
DLDH_ECOL6      ADKDIVKVFTKRISKK-FNLMLETKVTAVEAKEDGIYVTM-EGKKAPADAVLVAIGRVPNGKNLDAGKAG
DLDH_ECO57      ADKDIVKVFTKRISKK-FNLMLETKVTAVEAKEDGIYVTM-EGKKAPADAVLVAIGRVPNGKNLDAGKAG
MERA_STAES      YDPEISEAIDESLTEQGLNLITGVTYQKVEQNGKSTSIYIEQEQVIEADQVLVATGRKPNTETLNLESAG
MERA_STAAU      YDPEISEAIDESLTEQGLNLITGVTYQKVEQNGKSTSIYIEQEQVIEADQVLVATGRKPNTETLNLESAG
DLDH_PEA        MDAEIRKQFQRSLEKQGMKFKLKTKVVGVDTSGDGVKLTVEEQTIIEADVVLVSAGRTPFTSGLNLDKIG
DLDH_YEAST      MDGEVAKATQKFLKKQGLDFKLSTKVISAKRNDDKNVVEIVDTKTLEAEVLLVAVGRRPYIAGLGAEKIG
GSHR_ANASP      FDEDIRTEIQEGMTNHGIRIIPKNVVTAIEQVPEGLKISLSDQEPIIADVFLVATGRVPNVDGLGLENAG
DLDH1_PSEPU     YDSELTAPVAESLKKLGIALLGHS----VEGYENGCLLA-NDGKGLEADRVLVAVGRRPRTKGFNLECLD
DLDH_BUCAI      IDEDISSIYKKSINQQFNLMLNTHIDKVEVKKDALIVDMIHENKNILYDAVLVAIGRTPNIDSLGLDRIG
DLDH3_HALMA     YEEDIASIVRKRAERLGVDFHFGYTADSWAASDGKAV--LTAVPADEAAHILVAVGRRPVTDTLSIDDAG
DLDH_MYCPN      FDTEVSDLVAKLLQTKNVKIITNAQVTRANNNEVFYSQNGQEGSVV-GDRILVSIGRIPNTECL--DGLN
DLDH_HALSA      YGDDIARPVRQRAEELGIDFHFGLAADSWTDTDDGIVVXXXXXXXXXXXXXLVAVGRQPVTDTLNLDAVG
DLDH_MANSE      GDMEVSKDYR-ILAKQGMKVLGVKKEGSTVKVE-DVSIEGAKGGNKETMDCLISIGRRPYTKDLGLDKVG
STHA_MYCTU      CDPEVVEALKFHLRDLAVTFRFGEEVTAVDVGSAGTVTTLASGKQIPAETVMYSAGRQGQTDHLDLHNAG
STHA_MYCTA      CDPEVVEALKFHLRDLAVTFRFGEEVTAVDVGSAGTVTTLASGKQIPAETVMYSAGRQGQTDHLDLHNAG
STHA_MYCBT      CDPEVVEALKFHLRDLAVTFRFGEEVTAVDVGSAGTVTTLASGKQIPAETVMYSAGRQGQTDHLDLHNAG
STHA_MYCBP      CDPEVVEALKFHLRDLAVTFRFGEEVTAVDVGSAGTVTTLASGKQIPAETVMYSAGRQGQTDHLDLHNAG
STHA_MYCBO      CDPEVVEALKFHLRDLAVTFRFGEEVTAVDVGSAGTVTTLASGKQIPAETVMYSAGRQGQTDHLDLHNAG
DLDH_BUCBP      LDRDVI----DIFKRHDYNIFFNSNVIKIVQEKNGLLVHIAENRFELYDIILVAIGRVPNTDMLDISKVG
MERA_THIFE      EDPAIGEAITAAFRAEGIEVLEHTQASQVAYAD-GEFVLATGHGELRADKLLVATGRAPNTRRLNLEAAG
DLDH_HAEIN      ADKDVVGIYTKQVEKKFKLML-ETKVTAVEAKDDGIYVSM------EGKACLVAIGRVPNGKLIDAGKAG
DLDH_BUCAP      VDKDITDIYIKSIKKRFKLLL-NTHVKSVEKSDNDLIVKIAEENSDENVCCLVAIGRSPNVDFLGLEKIG
MERA_BACCE      YDPEISEAITKALTEQGINLVTGATYERVEQDGDIKKVHVEINRIIEAEQLLIATGRKPIQTSLNLHAAG
DLDH_SYNY3      FDPEIAKIAERVLIKSRDIETYTGVFATKIKAGSPVEIELTDAKTLEVDACLVATGRIPATKNLGLETVG
DLDH_RHOCA      MDAEVAKGLQRILTRQGLKFVLGAAVQGVDKAKGKNTVRYTSAHAIEAEVVLVATGRKPFTKGLGLEALG
GSHR_BURCE      FDDELREHLGDELKKSGIDLRLGVDVVAVERQRGALSVQLTTGDAMEVDAVMAATGRLPNTWGLGLETVD
DLDH_VIBCH      ADKDMVKVIKDKF-----NLMLETKVTAVEAKEDGIYVSMAPAQAERYDAVLVAIGRVPNGKLLDAEKAG
GSHRP_SPIOL     FDDEMRAAVARNLEGRGVNVHPRTTLTELVKTDGGVVARTDHGEEIEADVVLFATGRSPNTKRLNLEALG
DLDH1_ARATH     MDGEIRKQFQRSLEKQKMKFMLKTKXXXXXXXXXXLTVEPAEGSILEADVVLVSAGRTPFTSGLDLEKIG
MERA_ENTAG      EDPAIGEAVTAAFRAEGIEVLEHTQASQVAHMDGEFVLTTTHGE-LRADKLLVATGRTPNTRSLALEAAG
DLDH_MYCGE      CDSDVSELISKTLKNKGVQIITNAH---VVRAENNQLFYTVNGQSVIGDKILVSIGRIANTECL--DQLD
DLDH_VIBPA      ADKDIVKVYTKRIKDKFKLML-ETKVTAVEAKEDGIYVSMEGKKAPAEAEVLVAIGRVPNGKLIDGEKAG
MERA_PSEAE      EDPAIGEAVTAAFRAEGIEVLEHTQASQVAHMDGEFVLTTTHGE-LRADKLLVATGRTPNTRSLALDAAG
DLDH_MYCTU      EDADVSKEIEKQFKKLGVTILTATKVESIADGGSQVTVTVTKDGVLKAEKVLQAIGFAPNVEGYGLDKAG
DLDH_MYCBO      EDADVSKEIEKQFKKLGVTILTATKVESIADGGSQVTVTVTKDGVLKAEKVLQAIGFAPNVEGYGLDKAG
DLDH_RALEH      ADEGVAKEAQKQLTKQGLKFSLGVNVNEVTTGKNGVTVKYTDAQTLEVDRLIVSVGRVPNTDNLGLDAVG
GSHR_STRTR      FDKDIIDVLVDEMAKSGPTLHMHANAEVVKNADDSLTISFDNEETITVDCLIWAVGRAANTSGFGLEKTG
DLDH3_BACSU     EDEDIARLFQEKLEEDGVEVHTSSRLGRVDQTAKTAIWKSGQREFTKADYVLVAIGRKPRLDGLQLEQAG
DLDH_MYCLE      EDAEVSKEIEKQFKKMGIKILTGTKVESISDNGSHVLVAVSDGQFLKADKVLQAIGFAPNVDGYGLDKVG
GSHRP_TOBAC     FDEEIRDFVGEQMSLRGIEFHTEESPQAIVKSADGSLSLKTSRGTVEGSHIMFATGRRPNTKNLGLETVG
DLDH2_ARATH     MDGEIRKQFQRSLEKQKMKFMLKTKXXXXXXXXXXLIVEPAEGTTLEADVVLVSAGRTPFTSGLDLEKIG
STHA_COLP3      LDTEMSDSLSYHLWNSGVVIRHGEEIERVESSEDAVIVHLKSGKKMRADCLLFANGRTGNTADLNLAAAG
MERA_SHEPU      EDPLLGEKLTGCFEKEGIRVLNSTQATKVTH-DGSQFTLETNAGDLRCDRLLVSTGRHANTCQLNLGAVG
GSHRP_SOYBN     FDEEIRDFVEEQMSVRGIEFHTEESPQAITKSADGSFSLKTNKGTVDGSHIMFATGRRPNTQNLGLESVG
MERA_PSEFL      EDPAIGEAVTAAFRAEGIEVLEHTQASQVAHVN-GEFVLTTGHGELRADKLLVATGRAPNTRSLALDAPG
DLDH_TRYBB      LDSDVTDALVGALKRNGEDEVPMTGIEGVNGTNNGSIALTLEGGQAETLHCLVSVGRRPYTAGLGLEKNN
GSHRC_ARATH     FDDEMRALVARNLEGRGVNLHPQTSLTQLTKTDQGIKVISSHGEEFVADVVLFATGRSPNTKRLNLEAVG
STHA_SERP5      LDQEMSDSLSYHFWNNGVVIRHNEEFEKIEGTDDGVIVHLKSGKKVKADCLLYANGRTGNTDSLGLENVG
STHA_PHOLL      LDQEMSDALSYHFWNSGIVIRHNEEYSKIEGVDDGVIVHLKSGKKVKADCLLYANGRTGNTDTLGLKNVG
GSHRC_BRARP     FDDEMRALVARNLEGRGINLHPQTSLAELIKTDDGIKVISSHGEEFVADVVLFATGRIPNTKRLNLEAVG
STHA_YERE8      LDQEMSDALSYHFWNNGVVIRHNEEFEQIEGTVDGVIVHLKSGKKVKADCLLYANGRTGNTSGLGLEKIG
MERA_STRLI      EEPEISAGIENIFREEGITVHTRTQLRAVRRDGEGILATLTDGQQVRASHLLIATGRRSVTNGLGLERVG
GSHR_PSEAE      FDRSVREHLRDELGKKGLDLQFNSDIARIDKADGSLAATLKDGRVLEADCVFYATGRRPMLDDLGLENTA
GSHRP_PEA       FDEEIRDFVAENMALRGIEFHTEESPVAITKAADGSLSLKTNKGTEEGSHIMFATGRSPNTKDLGLESVG
STHA_CHRSD      LDDEISDALSYHLRQNGVLVRHNEDYESIEGDESGVIVKLKSGKRLRADAFLWANGRTGNTDELGLENIG
GSHRP_ARATH     FDEDVRDFVGEQMSLRGIEFHTEESPEAIIKAGDGSFSLKTSKGTVEGSHVMFATGRKPNTKNLGLENVG
STHA_PSEA7      LDDEISDALSYHLRNNNVLIRHNEEYERVEGLDNGVILHLKSGKKIKADALLWCNGRTGNTDKLGLENVG
STHA_PSEAE      LDDEISDALSYHLRNNNVLIRHNEEYERVEGLDNGVILHLKSGKKIKADALLWCNGRTGNTDKLGLENVG
STHA_PSEAB      LDDEISDALSYHLRNNNVLIRHNEEYERVEGLDNGVILHLKSGKKIKADALLWCNGRTGNTDKLGLENVG
STHA_PSEA8      LDDEISDALSYHLRNNNVLIRHNEEYERVEGLDNGVILHLKSGKKIKADALLWCNGRTGNTDKLGLENVG
GSHR_NEUCR      FDPMIQQVSVKEYERIGVKVHKKSQLTSVQKDAAGKLINFKEGEISDVDHLIWAVGRTPAVEGLGLDKAG
STHA_YERPY      LDQEMSDALSYHFWNNGVVIRHNEEFEQIEGTTDGVIVHLKSGKKVKADCLLYANGRTGNTSGLGLENIG
STHA_YERPS      LDQEMSDALSYHFWNNGVVIRHNEEFEQIEGTTDGVIVHLKSGKKVKADCLLYANGRTGNTSGLGLENIG
STHA_YERPP      LDQEMSDALSYHFWNNGVVIRHNEEFEQIEGTTDGVIVHLKSGKKVKADCLLYANGRTGNTSGLGLENIG
STHA_YERPN      LDQEMSDALSYHFWNNGVVIRHNEEFEQIEGTTDGVIVHLKSGKKVKADCLLYANGRTGNTSGLGLENIG
STHA_YERPG      LDQEMSDALSYHFWNNGVVIRHNEEFEQIEGTTDGVIVHLKSGKKVKADCLLYANGRTGNTSGLGLENIG
STHA_YERPE      LDQEMSDALSYHFWNNGVVIRHNEEFEQIEGTTDGVIVHLKSGKKVKADCLLYANGRTGNTSGLGLENIG
STHA_YERPB      LDQEMSDALSYHFWNNGVVIRHNEEFEQIEGTTDGVIVHLKSGKKVKADCLLYANGRTGNTSGLGLENIG
STHA_YERPA      LDQEMSDALSYHFWNNGVVIRHNEEFEQIEGTTDGVIVHLKSGKKVKADCLLYANGRTGNTSGLGLENIG
STHA_YERP3      LDQEMSDALSYHFWNNGVVIRHNEEFEQIEGTTDGVIVHLKSGKKVKADCLLYANGRTGNTSGLGLENIG
STHA_ERWCT      LDQEMSDALSYHFWNNGVVIRHNEEFDSIEGLSDGVIVNLKSGKKMKADCLLYANGRTGNTETLGLENIG
MERA_ALCSP      EDPAIGEAVTAAFRAEGIKVLEYTQASQVAHVD-GEFVLTTGYGEIRADQLLVATGRAPNTRSXXXXXXX
TYTR_TRYCO      FDYTLRQELTKQLVANGIDIMTNENPSKIENPDGSKHVTFESGKTLDVDVVMMAIGRLPRTGYLQLQTVG
STHA_SODGM      LDQEMSDALSYHFWENGVVIRHNEEYEEIKGLDDGVEVRFRSGKRMKADCLLYANGRTGNTDTLKLDKVE
STHA_VIBSL      LDNETSDALSYHFWNSGVVIRNDETFEKIEGTDDGVIIHLESGKKMRADCLLYANGRTGNTDKLNLGAVG
GSHRC_PEA       FDDEMRAVVARNLEGRGINLHPRTNLAQLIKTEDGIKVITDHGEELIADVVLFATGRSPNSKRLNLEKVG
STHA_ERWT9      LDQEMSDSLSYHFWNNGVVIRHNEEFEKVEGVADGVIMHLKSGKKLKADCLLYANGRTGNTDSLSLENVG
MERA_ACICA      DDPAIGEAVTAAFRAEGIKVLEHTQASQVAHVD-GEFVLTTGYGEIRADQLLVATGRAPNTRSXXXXXXX
STHA_PROMH      LDQEMSDALSYHFWNNGIVIRHNEEYDTIEGVDDGVIVHLKSGKKVKADCLLYANGRTGNTDTLGLENVG
STHA_AZOVI      LDDEISDSLSYHLRNNNVLIRHNEEYERVEGLDNGVILHLKSGKKIKADAFLWSNGRTGNTDKLGLENIG
STHA_AZOVD      LDDEISDSLSYHLRNNNVLIRHNEEYERVEGLDNGVILHLKSGKKIKADAFLWSNGRTGNTDKLGLENIG
STHA_HAHCH      LDGEISDALSYHLRDNGVLVRHNEQYDSVVGDDHGVVLTMKSGKRIRADAFLWCNGRTGNTDNLGLENIG
GSHRC_ORYSJ     FDDEMRTVVASNLEGRGIRLHPGTNLSELSKTADGIKVVTDKGEEIIADVVLFATGRTPNSQRLNLEAAG
STHA_ECO81      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIG
STHA_SHIFL      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIESCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIG
STHA_SALG2      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALENIG
STHA_MARAV      LDDEISDALSYHLRNNGVLVRHNEQYESVKGDDHGVVLSLQSGKKIRADAFLWCNGRSGNTENLGLENVG
STHA_ECOLC      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIG
STHA_ECOHS      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIG
STHA_VIBVY      LDNEVSDALSYHFWNSGVVIRNDETYERIEGTEDGVIVHLQSGKKMKADCLLYANGRTGNTDKLNLPAVG
STHA_VIBVU      LDNEVSDALSYHFWNSGVVIRNDETYERIEGTEDGVIVHLQSGKKMKADCLLYANGRTGNTDKLNLPAVG
STHA_SALTY      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALENIG
STHA_SALTI      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALENIG
STHA_SALPK      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALENIG
STHA_SALPB      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALENIG
STHA_SALPA      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALENIG
STHA_SALEP      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALENIG
STHA_ESCF3      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIG
STHA_ENT38      LDQEMSDSLSYHFWNSGVVIRHNEEYERIEACDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALENIG
STHA_ECOUT      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIG
STHA_ECOSM      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIG
STHA_ECOSE      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIG
STHA_ECOLU      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIG
STHA_ECOLI      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIG
STHA_ECOL6      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIG
STHA_ECOL5      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIG
STHA_ECOK1      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIG
STHA_ECODH      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIG
STHA_ECOBW      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIG
STHA_ECO8A      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIG
STHA_ECO7I      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIG
STHA_ECO5E      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIG
STHA_ECO55      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIG
STHA_ECO45      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIG
STHA_ECO24      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIG
STHA_SALPC      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALENIG
STHA_SALCH      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALENIG
STHA_ECO27      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIG
MERA_SHIFL      EDPAIGEAVTAAFRMEGIEVREHTQASQVAYINGGEFVLTTAHGELRADKLLVATGRAPNTRKLALDATG
DLDH_TRYCR      LDEDVTNALVGALAKNEKMKFMTS-TKVVGGTNNGDSVSLVEGKTVTCEALLVSVGRRPFTGGLGLDKIN
STHA_KLEP7      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGVDDGVIMHLKSGKKLKADCLLYANGRTGNTDTLALENIG
STHA_SHIB3      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIG
STHA_ECO57      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIG
DLDH_DICDI      ADGEVAKKFQKSLEKQHMKFHLETKVTSVVKKSDGK-VTVTVEQVLEADAVLVSVGRRPNTSGLGLESVG
STHA_VIBCM      LDNEVSDALSYHFWNSGVVIRNDETYDKVEGTSDGVIVHLKSGKKMRADCLLYANGRTGNTDKLNLESVG
STHA_VIBCH      LDNEVSDALSYHFWNSGVVIRNDETYDKVEGTSDGVIVHLKSGKKMRADCLLYANGRTGNTDKLNLESVG
STHA_VIBC3      LDNEVSDALSYHFWNSGVVIRNDETYDKVEGTSDGVIVHLKSGKKMRADCLLYANGRTGNTDKLNLESVG
STHA_KLEP3      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGVDDGVIMHLKSGKKLKADCLLYANGRTGNTDTLALENIG
STHA_VIBPA      LDNEVSDALSYHFWNSGVVIRNDETYEKIEGTEDGVIIHLQSGKKMRADCLLYANGRTGNTDKLSLDVVG
STHA_PSEPK      LDSEISQALSYHFSNNNITVRHNEEYERVEGLDNGVILHLKSGKKIKADALLWCNGRTGNTDKLGLENIG
STHA_PSEP1      LDSEISQALSYHFSNNNITVRHNEEYERVEGLDNGVILHLKSGKKIKADALLWCNGRTGNTDKLGLENIG
STHA_HAMD5      LDQEISDALSYHFWNNGVVIRHNEEFDLIEGLDQGVVVHLKSGKKVKADCLFYANGRTGNTKELLLENIG
STHA_PSEU5      LDDEISDALSYHLRNNNVLIRHNEEYERVEGLENGVILHLKSGKKIKADAFLWSNGRTGNTDKLGLENIG
STHA_CITK8      LDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALGNIG
TYTR_TRYBB      FDETIREEVTKQLTANGIEIMTNENPAKVSNTDGSKHVTFESGKTLDVDVVMMAIGRIPRTNDLQLGNVG
GSHR_CALJA      FDSMISTNCTEELENAGVEVLKFSQVKEVKKTSSGLLVTAVPGRLISDVDCLLAIGRDPNSKGLSLNKLG
STHA_PSEPW      LDSEISQALSYHFSNNNITVRHNEDYERVEGLDNGVILHLKSGKKIKADALLWCNGRTGNTDKLGLENIG
STHA_PSEU2      LDSEISQALSYHFSNNNVMVRHNEEYEKVEGLDNGVILHLKSGKKIKADALLWCNGRTGNTDKLGLENIG
STHA_PSESM      LDSEISQALSYHFSNNNVMVRHNEEYERVEGLDNGVVLHLKSGKKIKADALLWCNGRTGNTDKLGLENIG
STHA_PSEPG      LDSEISQALSYHFSNNNITVRHNEEYERVEGLDNGVILHLKSGKKIKADALLWCNGRTGNTDKLGLENIG
STHA_PSEE4      LDSEISQALSYHFSNNNITVRHNEEYERVEGLDNGVVLHLKSGKKIKADALLWCNGRTGNTDRLGLENIG
STHA_PSE14      LDSEISQALSYHFSNNNVMVRHNEEYERVEGLDNGVILHLKSGKKIKADALLWCNGRTGNTDKLGLENIG
GSHR_HUMAN      FDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLMVTAVPGRLIPDVDCLLAIGRVPNTKDLSLNKLG
TYTR_LEIDO      FDTEVRKSLTKQLGANGIRVRTNLNPTKITKNEDGSNVHFNDGTEEDYDQVMLAIG-VPRSQALQLDKAG
STHA_PSEFS      LDSEISQALSYHFSNNNITVRHNEEYERVEGLDNGVILHLKSGKKIKADALLWCNGRTGNTDKLGMENIG
GSHR_MOUSE      FDSLISSNCTEELENAGVEVLKFTQVKEVKKTSSGLVVTSVPGRMIPDVDCLLAIGRDPNSKGLNLNKVG
STHA_VIBF1      LDNEMSDALSYHFWNSGIVTRNDENFEHIEANDDGVIMHLESGKKMKADCILFANGRTGNTDKLNLSAVG
GSHR_HAEIN      QDPLIVETLVEVLAQDGIQLHTNSTPSEIVKNADGSLTVRCDGQSDVTVDCVIAAGRVPTTDKIGLENAG
STHA_PSEFL      LDSEISQALSYHFSNNNITVRHNEEYDRVEGLDNGVILHLKSGKKIKADALLWCNGRTGNTDKLGMENIG
STHA_PSEF5      LDSEISQALSYHFSNNNITVRHNEEYDRVEGVDNGVILHLKSGKKIKADALLWCNGRTGNTDKLGMENIG
GSHR_DICDI      FDEMLHTTLLKQMTDDGVKFVTEASIKSLERDVDGIIATTNAGVKLPPVECVIAIGRVPNTDDLGIDKAG
STHA_PHOPR      LDNEISDSLSYHLWNSGAMIRNGETFEKIEGTDDSIILHLESGKKMRADCLLYANGRTGNTDKLNLNKVG
TYTR_TRYCR      FDHTLREELTKQLTANGIQILTKENPAKVENADGSKSVTFESGKKMDFDLVMMAIGRSPRTKDLQLQNAG
STHA_PSEPF      LDSEISQALSYHFSNNNITVRHNEEYDRVEGVDNGVILHLKSGKKIKADALLWCNGRTGNTDQLGLENIG
TYTR_CRIFA      FDSELRKQLTEQLRANGINVRTHENPAKVTKNADGTRVVFESGAEADYDVVMLAIGRVPRSQTLQLDKAG
STHA_MARMS      LDDEITDALSYHLRDGGVLIRHNETYDSVETTERGVVMHMASGKKLRADALLFCNGRSGNTDNLGLESIN
GSHR_CANGA      FDEIIQNTVTDYYVEEGINVHKETNVDKVEKDEGKLSVHLTNGQVLEDVDELIWTMGRRSLLGIGLENVG
GSHR_ECOLI      FDPMISETLVEVMNAEGPQLHTNAIPKAVVKTDGSLTLELEDGRSETVDCLIWAIGREPANDNINLEAAG
GSHR_ASHGO      FDPSIQEIVTEHYEKEGVNI---HKKESIQRVETGKLTVHLSGKIIEDVDQLVWAIGRKSLLGIAPENVG
TRXR2_BOVIN     FDQQMASLVTEHMAGHGTRILRGCAPEKVEKLPGQQLVDLTSDRKDAGTFVLWAIGRVPETASLNLEKAG
GSHR_RAT        FDSNCTEELENAGGVEVLTVKKFSQVKEVKKTSSGLVVTALPGRTIPDVDCLLAIGRDPNSKGLNLNKLG
GSHR_CAEEL      KDRDCVHFVMEHLKTTGXXXXXXXXXXXXXXXGSKKKVTFTNGGVEEYDTVIWAAGRVPNLKSLNLDNAG
YKGC_ECOLI      EDRDIADNIATILRDQGVDIILNAHVERISHHENQVQVHSEHAQLAVDA-LLIASGRQPATASLHPENAG
TRXR2_RAT       FDQQMASLVTEHMESHGTRFLKGCVPSLIRKLPTNQLEDLASGKEDVGTFVLWAIGRVPETRNLNLEKAG
GSHR_YARLI      FDIMIQDTITDYYVKEGINVLKGSGVKKIVKKDNGELLVTQDGKDITLDSLIWTIGREPLKDTLNLGEFG
DLDH_RHIET      EDAEITAIARKQLEKRGLKIFTSAKVTKVEKGAGSITVETSDGKVITADRMISAVGVQGNIENLGLEALG
IRC15_YEAST     MDNELASATKTLLQCQGIAFLLDTRVQLAEADAAGQLNITLLNKVSKKTHCMVSIGRRPLLK--GLDISS
TRXR2_HUMAN     RGFDSSMVIEHM-ASHGTRFLRGCAPSRVRRLPDGQLQVTTTGKEDTGTFVLWAIGRVPDTRSLNLEKAG
DLDH_ACHLA      MDDDIRVAYAKTLKRDGIEIL--TKAE-VKKVDDHKVTYSLDGKTIEGDLILMSVGTRANSK--GLEHLG
TRXR2_MOUSE     FDQQMSSLVTEHMESHGTQFLKGCVPSHIKKLPTNQLVTWEDGKEDTGTFVLWAIGRVPETRTLNLEKAG
STHA_PSEMY      LDSEISDALSYHLRNNNVLIRHNEEYERIEGVENGVVLHLKSGKKIKADALLWCNGRTGNTDQLGLENIG
GSHR_SCHPO      FDPIISDGIMDHFQHIGINVHTNSEFKKVEKLPSGELIHQQDGSTFNVDTLLWAIGRAPKIQGLRLEKAG
TRXR1_DROME     FDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGKLLNVETGEEAEDVYVLWAIGRKGLVDDLNLPNAG
GSHR_KLULA      FDDCIQETVTDTYIKEGVNIHKSSNVTKVEKDESGKLIQLDTGKNIDNVDSLITIGR-RSLLGLGLENIG
TRXR2_DROME     FDRQMSELLAAMMTERGIPFLGTTIPKAVERADGRLLVRYRNTTTMDGSDVLWAIGRKGLIEDLNLDAAG
GSHR_YEAST      FDECIQNTITDHYVKEGINVHKLSKVEKNVETDK-LKIHMNDSKSIDDDELIWTIGR-KSHLGMGSENVG
TRXR1_BOVIN     FDQDMANKIGEHMQEHGIKFIRQFVPIKVEQIEAGVIAKSTDSQTIEGEYVLLAIGRDACTRKIGLENVG
TRXR_PLAF7      FDQQCAVKVKLYMEEQGVMFKNGILPKKLTKMDDKILVEFSDKTSELYDTVLYAIGRKGDIDGLNLESLN
TRXR_PLAF5      FDQQCAVKVKLYMEEQGVMFKNGILPKKLTKMDDKILVEFSDKTSELYDTVLYAIGRKGDIDGLNLESLN
TRXR1_MOUSE     FDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLNSEETIEGNTVLLAVGRDSCTRTIGLETVG
TRXR1_PIG       FDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLNSEEIIEGEYVMLAIGRDACTRKIGLETVG
TRXR3_HUMAN     FDQEMAEKVGSYMEQHGVKFLRKFIPVMVQQLEKGVLAKSTEGETIEGVYVLLAIGRDSCTRKIGLEKIG
TRXR3_MOUSE     FDQEMAEKVGSYLEQQGVKFQRKFTPILVQQLEKGVVAKSTEGETVEGIYVLLAIGRDSCTRKIGLEKIG
TRXR1_PONAB     FDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLNSEEIIEGEYVLLAIGRDACTRKIGLETVG
TRXR1_HUMAN     FDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLNSEEIIEGEYVMLAIGRDACTRKIGLETVG
GSHR_PLAFK      FDESVINVLENDMKKNNINIVTFADVVEIKKSDKNLSIHLSDGRIYEHDHVIYCVGRSPDTENLKLEKLN
GSHR_DEBHA      FDESIQNSITDYYTKLGVNIIKQSGSVSKVEKIDGDRKKITNGQVLEVDELIWTMGR-KSLINIGLDKVG
GSHR_PLAF7      FDESVINVLENDMKKNNINIVTFADVVEIKKSDKNLSIHLSDGRIYEHDHVIYCVGRSPDTENLNLGKLN
TRXR1_CAEEL     FDQDMAERIRKHMIAYGMKFEAGTRIEQIEKTDTGEMQEVSE----EYNTILMAIGREAVTDDVGLTTIG
TRXR1_RAT       FDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLNSEETIEDNTVLLAVGRDSCTRTIGLETVG
MERA_SERMA      DDPSIGEAVTAAFRAEGIKVLEHTQASQVAHVN-------------------------------------
NAOX_METJA      LDPDMAEIVQKYLEKEGIKVMLSKPLEKIVGKEK-VEAVYVDGKLYDVDMVIMATGVRPNIEL--AKKAG
NORW_ERWCT      MPPEVSARLQFTLTQQGVSLLLNTTVQQLEKTETGVQARFTDGRTVEVDEIISAVGLQANTQ---LAKAA
AIFM3_MOUSE     EETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELVVLKSSKVLRADVCVLGIGAVPATGFL--RQSG
TRXB_LISMO      ----AQQILQDAFKDEKVDFIWNSTVEEIVKVTGAKLVSTVDGSIMPVDGVFIYVGLVPLTKNLGIT---
CDR_PYRFU       FDKEITDIVEEKLRQKTLSIEGRERVEKV----------ITDGGEYKADLVIIATGIKPNVEL--AKQLG
NORW_CITK8      MPPEVSSRLQHRLTDMGVHLLLKSQLQGLEKTATGIRATLDRDRQVEVDAVIAATGLRPETALA--RRAG
NORW_ECOLU      MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGILATLDRQRSIEVDAVIAATGLRPETAL--ARRAG
NORW_ECOL5      MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGILATLDRQRCIEVDAVIAATGLRPETAL--ARRAG
MDAR1_ARATH     FTAEIASFYESYYANKGIKIIKGTVATGFSTNSDGEVVKLEDGRTLEANIVVAGVGARPATSLF----KG
NORW_SHIFL      MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGILATLDHQRSIEVDAVIAATGLRPETAL--ARRAG
NORW_SHIF8      MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGILATLDHQRSIEVDAVIAATGLRPETAL--ARRAG
NORW_ECOL6      MPTEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGILATLDRQRCIEVDAVIAATGLRPETAL--ARRAG
XECC_XANP2      KDNETRAYVLDRMKEQGMEIISGSNVTRIEEDANGVVAMTPNGEMIETDFVFLGLGEQPRSAELA-KILG
NORW_SHISS      MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGILATLDHQRSIEVDAVIAATGLRPETAL--ARRAG
NORW_ECOUT      MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGILATLDRQRCIEVDAVIAATGLRPETAL--ARRAG
NORW_ECOK1      MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGILATLDRQRCIEVDAVIAATGLRPETAL--ARRAG
NORW_ECO45      MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGILATLDRQRCIEVDAVIAATGLRPETAL--ARRAG
NAPE_ENTFA      YDKEFTDVLTEEMEANNITIATGETVERY-EGDGRVQKIVTDKNAYDADLVVVAVGVRPNTAWL---KGT
NORW_ECOSM      MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGILATLECQRCIEVDAVIAATGLRPETAL--ARRAG
NAOX_ENTFA      YDKPFTDVLEKELVDRGVNLLGENVQQFVADEQGKVAKVITPSQEFEADMVIMCVGFRPNTELL---KDK
TRXB_METJA      ESIKEANNVEIIYNAKPLEIVGEERAEGVKISVNG------KEEIIKADGIFISLGHVPNTEFL--KDSG
NORW_KLEP7      MPPEASSRLQHRLTEMGVHLMLKTQLEGLEQTADGIRVSLDRQRAITVDAVVAAAGLRPETSLA--RHAG
TRXB_LISIN      ----AQQILQDAFKDEKVDFIWNNTVEEIIG-DGXXXXXXXXXXXXDGSESIMPVGLVPLTKSLGIT---
NORW_ECO27      MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTNSGILATLDRQRSIEVDTVIAATGLRPETAL--ARRAG
NAOX_STRP6      YDRDLTDLMAKNMEEHGIQVAGNGKVEKI----------ITDKNEYDVDMVILAVGFRPNTT---LGNGK
NORW_SALTI      MPPEVSSRLQHHLTDMGVHXXXXXXXXXXEKTEAGIRATLVSQHSIEVDAVIAATGLRPETALA--RRAG
NORW_KLEP3      MPPEASSRLQHRLTEMGVHLMLKAQLEGLEQTADGIRVSLDRQRAITVDAVVAAAGLRPETSLA--RHAG
CDR_PYRAB       SDKEVTDIIEEKLKQHVLRIEGKDRVEKV----------VTDAGEYRADLVILATGIKPNIEL--ARQLG
NORW_ESCF3      MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTNSGILATLDRQRSTEVDAVIAATGLRPETAL--ARRAG
NORW_ECOHS      MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGILATLDRQRSIEVDAVIAATGLRPETAL--ARRAG
NORW_ECO8A      MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGILATLDRQRSIEVDAVIAATGLRPETAL--ARRAG
NORW_ECO5E      MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGILATLDHQRSIEVDAVIAATGLRPETAL--ARRAG
NORW_ECO57      MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGILATLDHQRSIEVDAVIAATGLRPETAL--ARRAG
NORW_ECO55      MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGILATLDRQRSIEVDAVIAATGLRPETAL--ARRAG
OOXA2_RHIME     FRMSVLRHMPEVSGVRSIAITGSERAEGVRFTTAG------GEQAIPASSVLLHQGVIPST-NL-TNAAG
NORW_SALHS      MPPEVSSRLQHHLTDMGVHXXXXXXXXXXEKTEAGIRATLVSQHSIEVDAVIAATGLRPETALA--RRAG
NORW_SALEP      MPPEVSSRLQHHLTDMGVHXXXXXXXXXXEKTEAGIRATLVSQHSIEVDAVIAATGLRPETALA--RRAG
NORW_SALTY      MPPEVSSRLQHHLTDMGVHXXXXXXXXXXEKTEAGIRATLVSQHSIEVDAVIAATGLRPETALA--RRAG
NORW_SALA4      MPPEVSSRLQHHLTDMGVHXXXXXXXXXXEKIEAGIRATLASQRSIEVDAVIAATGLRPETALA--RRAG
NORW_SALSV      MPPEVSSRLQHHLTDMGVHXXXXXXXXXXEKTEAGIRATLVSQRNIEVDAVIAATGLRPETALA--RRAG
NORW_SHIDS      MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGILATLDRQRSIEVDAVIAATGLRPETAL--ARRAG
NORW_SALG2      MPPEVSSRLQHHLTDMGVHXXXXXXXXXXEKTEAGIRATLVSQHSIEVDAVIAATGLRPETALA--RRAG
NORW_ECOSE      MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGILATLDRQRSIEVDAVIAATGLRPETAL--ARRAG
NORW_ECO24      MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGILATLDRQRSIEVDAVIAATGLRPETAL--ARRAG
NASD_BACSU      QDATAGRLLQNELEKQGMTFLLEKQTEEIVGDDRVEGLRFKDGTSIEADLVVMAVGIRPNT-TLG-AESG
TRXB_CHLPN      KAMEARAQNNEKITFLWNSEIVKISGDSIVRSVDIKNVQTQEITTREAAGVFFAIGHKPNTDFLGGQ---
NORW_ECOLI      MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGIQATLDRQRNIEVDAVIAATGLRPETAL--ARRAG
NORW_ECOLC      MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGIQATLDRQRNIEVDAVIAATGLRPETAL--ARRAG
NORW_ECODH      MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGIQATLDRQRNIEVDAVIAATGLRPETAL--ARRAG
NORW_ECOBW      MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGIQATLDRQRNIEVDAVIAATGLRPETAL--ARRAG
Y636_METJA      ----------------------------------------------------------------------
NORW_SHIBS      MPPEVSSRLQHRLTEMGVYLLLKSQLQGLEKTDSGILATLDHQRSIEVDAVIAATGLRPETAL--ARRAG
NORW_SHIB3      MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGILATLDHQRSIEVDAVIAATGLRPETAL--ARRAG
RURE_ACIAD      HIADA---FQKNLEESGIHFVLSTTVEKVSKINDGYAVTLANGQTLVADIVLSAIGLQPNIDL--AKHAG
NASB_BACSU      QDQTAARLLQTELEQKGLTFLLEKDTVSISGATKADRIHFKDGSSLKADLIVMAAGVKPN-IELAV-SAG
TRXB_CHLTR      KVVNKAQANEKIF------FLWNSE---IVKISGDTLVRSIDTTTMEAAGVFFAIGHQPNTAFLGGQVA-
NORW_VIBFM      MMPDFISLLENACKEKGVTVNLSDCVQAVNKQEQGYRVTTSNCHSYYVDCVISAAGLKPNTQL--ATEAN
CDR_PYRKO       FDKEITDIVEEKLRNH-----LNLRLEEVTLRIEGVERVVTDAGEYPADLVIVATGIKPNTEL--ARGLG
NORW_SALAR      MPPEVSSRLQHRLTDMGVHXXXXXXXXXXXXXXAGIRATLASQRRIEVDAAIAATGLRPETALA--RRAG
CDR_PYRHO       SDKEVTDILEEKLKKHTMKIEGEERVEKVV-TDAGEY---------KAELVILATGIKPNIELA--KQLG
MDAR_PEA        LTSEIAAFYEGYYANKGINIIKGTVAVGFTANSDGEVVKLKDGRVLEADIVIVGVGGRPQ---ISLFKGQ
NORW_SALPC      MPPEVSSRLQHHLTDMGVHXXXXXXXXXXEKTEAGIRATLVSQHSIEVDAVIAATGLRPETXXXXXXXXX
NORW_SALCH      MPPEVSSRLQHHLTDMGVHXXXXXXXXXXEKTEAGIRATLVSQHSIEVDAVIAATGLRPETXXXXXXXXX
CDR_STAHJ       MDQDMNQVIFDELDSRHIPYRLNEEIVSVKDH----LVTFKSG--IQEDFDIIIEGVGTHPHSKFIESSN
TRXB_CHLMU      KKAQANEKIVFLWNSEVVKILGDSLVRSIDIFNNVEKTTVT----MEAAGVFFAIGHQPNTAFLGGQ---
TRXB_STRCL      ----ASKAMQDAFADPKISFAWNSEVATIEQKLTGLTLRDTETRELAATGLFIAVGHDPRTE---LFKGQ
MDAR3_ARATH     LTADIAAFYETYYTNKGVKIIKGTVASGFTAQPNGEVVQLKDGRTLEADIVIVGVGAKPLTSLF----KG
MDARS_CUCSA     LTPEIAAFYEGYYAQKGITIIKGTVAVGFTVDTNGEVVKLKDGRVLEADIVVVGVGARPLTSLF----KG
BEDA_PSEPU      LGRRIGAWLRGLLTEQGVQVELKTGVSGFSGEGQLEKVMVNDGRSFIADNALICVGADP--ADQLARQAG
NORW_SALPK      MPPEVSSRLQHHLTDMGVHXXXXXXXXXXEKIEAGIRATLASQRSIEVDAVIAATGLRPETXXXXXXXXX
NORW_SALPA      MPPEVSSRLQHHLTDMGVHXXXXXXXXXXEKIEAGIRATLASQRSIEVDAVIAATGLRPETXXXXXXXXX
AHPF_STAES      VDIKTSAKTTEV--------IGDDYVTGISYED----MTTGESQVVNLDGIFVQIGLVPNTSWL---QNA
AHPF_STAEQ      VDIKTSAKTTEV--------IGDDYVTGISYED----MTTGESQVVNLDGIFVQIGLVPNTSWL---QNA
NORW_ENT38      MPAEVSSRLQHRLTDMGVHXXXXXXXXXXXXXDTGIRATLDRNRSVEIDVVVAATGLRPETALARRAGAE
CDR_STAAW       MDADMNQPILDELDKREIPYRLNEEIDAINGNE----ITFKSGKVEHYDMIIEGVGTHPNSKFI--ESSN
CDR_STAAS       MDADMNQPILDELDKREIPYRLNEEIDAINGNE----ITFKSGKVEHYDMIIEGVGTHPNSKFI--ESSN
CDR_STAAN       MDADMNQPILDELDKREIPYRLNEEIDAINGNE----ITFKSGKVEHYDMIIEGVGTHPNSKFI--ESSN
CDR_STAAM       MDADMNQPILDELDKREIPYRLNEEIDAINGNE----ITFKSGKVEHYDMIIEGVGTHPNSKFI--ESSN
CDR_STAAB       MDADMNQPILDELDKREIPYRLNEEIVAINGNE----ITFKSGRVEHYDMIIEGVGTHPNSKFI--ESSN
CDR_STAA9       MDADMNQPILDELDKREIPYRLNEEIDAINGNE----ITFKSGKVEHYDMIIEGVGTHPNSKLI--ESSN
CDR_STAA2       MDADMNQPILDELDKREIPYRLNEEIDAINGNE----ITFKSGKVEHYDMIIEGVGTHPNSKLI--ESSN
CDR_STAA1       MDADMNQPILDELDKREIPYRLNEEIDAINGNE----ITFKSGKVEHYDMIIEGVGTHPNSKFI--ESSN
AHPF_STAAW      SELKADNVLQDLRSLSNVDIKTNAKTTEVVGEDHVTGIRYEDMSTGE-EHLLVQIGLLPNTSWL---KDA
AHPF_STAAN      SELKADNVLQDLRSLSNVDIKTNAKTTEVVGEDHVTGIRYEDMSTGE-EHLLVQIGLLPNTSWL---KDA
AHPF_STAAM      SELKADNVLQDLRSLSNVDIKTNAKTTEVVGEDHVTGIRYEDMSTGE-EHLLVQIGLLPNTSWL---KDA
AHPF_STAAC      SELKADNVLQDLRSLSNVDIKTNAKTTEVVGEDHVTGIRYEDMNTGE-EHLLVQIGLLPNTSWLN---DA
AHPF_STAA8      SELKADNVLQDLRSLSNVDIKTNAKTTEVVGEDHVTGIRYEDMNTGE-EHLLVQIGLLPNTSWLN---DA
TRXB_STAAW      ----AQRILQDAFKNDKIDFIWSHTLKSINEKDGKVLTSTKDGETHEADGVFIYIGMKPLTAPF--KDLG
TRXB_STAAS      ----AQRILQDAFKNDKIDFIWSHTLKSINEKDGKVLTSTKDGETHEADGVFIYIGMKPLTAPF--KDLG
TRXB_STAAR      ----AQRILQDAFKNDKIDFIWSHTLKSINEKDGKVLTSTKDGETHEADGVFIYIGMKPLTAPF--KDLG
TRXB_STAAN      ----AQRILQDAFKNDKIDFIWSHTLKSINEKDGKVLTSTKDGETHEADGVFIYIGMKPLTAPF--KDLG
TRXB_STAAM      ----AQRILQDAFKNDKIDFIWSHTLKSINEKDGKVLTSTKDGETHEADGVFIYIGMKPLTAPF--KDLG
TRXB_STAAC      ----AQRILQDAFKNDKIDFIWSHTLKSINEKDGKVLTSTKDGETHEADGVFIYIGMKPLTAPF--KDLG
NAOX_MYCPN      NDEEFTNELEKAMKKAGINLMMGSAVKGIVDADKNVVKGVTDKGRVDADLVIQSIGFRPNTQFVP-KDRQ
AIFM1_HUMAN     YLSNWT--MEKV-RREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLE
FENR_SALAI      XXXXXXXXXLPV------RIVVNA---EVTRLHGGGTVTGAEITVRGGAAELLPVDTVVATADLGLTEWG
CDR_STAAR       MDADMNQPILDELDKREIPYRLNEEIDAINGNE----ITFKSGKVEHYDMIIEGVGTHPNSKFI--ESSN
NORW_SALNS      MPPEVSSRLQHHLTDMGVHXXXXXXXXXXEKTEAGIRATLVSQHSIEVDAVIAATGLRPETXXXXXXXXX
NORW_SALDC      MPPEVSSRLQHHLTDMGVHXXXXXXXXXXEKTEAGIRATLVSQHSIEVDAVIAATGLRPETXXXXXXXXX
R34K_CLOPA      KYSQ-----DELFKHKNVKIIWDSEIRXXXXXXXXXXXXXXXXXXLKADGVFVYIGYEPKTE---LFKDS
NORW_VIBVU      LLPEIALPLEQQLMKHGIQLALNSRVESVTEQGQTLAIALHDGREFAVDAVLCAAGLKANTA--VAREAG
NORW_ECO81      MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGILATLDRQRCIEVDAVIAATGLRPETAL--ARRAG
FENR_SALTO      XXXXXXXXXLPV------RVVVNA---EVTRLHGGGAVTGAEITVRGGAAELLPVDTVVATADLGLAEWG
AHPF_STAAR      SELKADNVLQDLRSLSNVDIKTNAKTTEVVGENHVTGIRYEDMSTGE-EHLLVQIGLLPNTSWL---KDA
AIFM1_DICDI     LFPDLSKYATEEIIKSGVNVTGTLIKDVVDNSENGRLVTLNNGKTFETDHVVVAAGIIPNT---------
TRXB_RICFE      ----AEKILQDLFKNPKISVIWDHVVDEIVGSDTGVKIQNVHTKEISLVNCFIAIGHAPNT---GLFTGQ
TRXB_MYCSM      K-----IMLERARANEKITFLTNTEITQIEGDPKVTGVRLRDTVTGEESKLDVTIGHDPRSE---LVRGQ
MDAR2_ARATH     LTPKIASLYEDYYRAKGVTVLTSFEFDSNKKVTA---VNLKDGSHLPADLVVVGIGIRPNTS---LFEGQ
YMER_STAAU      ---------------------------------------------------------------MNLEKGN
AIFM1_RAT       YLSNWT--MEKV-KREGVKVMPNAIVQSVGVSGGKLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLE
AIFM1_MOUSE     YLSNWT--MEKV-KREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLE
AHPF_STAAS      SELKADNVLQDLRSLSNVDIKTNAKTTEVVGEDHVTGIRYEDMSTGE-EHLLVQIGLLPNTSWL---KDA
TODA_PSEP1      LGRRIGAWLRGLLTELGVQVELGTGVVGFSGEGQLEQVMASDGRSFVADSALICVGAEP--ADQLARQAG
STHA_PECCC      ----------------------------------------------------------------------
CDR_STAES       MDQDMNQPIIDEIEKRNITYRFNEEISHVN----GHEVTFTSGKVENFDLIIEGVGTHPNSQFI--KSSN
CDR_STAEQ       MDQDMNQPIIDEIEKRNITYRFNEEISHVN----GHEVTFTSGKVENFDLIIEGVGTHPNSQFI--KSSN
TRXB_RICCN      ----AEKILQDLFKNSKISVIGSNKPKSVT----GVKIQNVHTKEISLLNCFIAIGHAPNT---GLFTGQ
NORW_VIBVY      LLPEIALPLEQQLMKHGIQLALNSRVESVTVQGQTLAIALHDGREFAVDAVLCAAGLKANTA--VAREAG
NORW_ECO7I      MLPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGILATLDRQRSIEVDAVIAATGLRPETAL--ARRAG
NIRB_KLEOX      QDNGGAAMLREKISELGVGVHTSKATTEIVRNEQGLQLNFRDGSSLATDMLVFSAGIRPQDALA--RSGG
NAOX_LACLM      YDEEFAKGMDENLAQHGIELHFGELAKEFKANEEGYVSQIVTNKATYDVD--LVINCIGFTANSALASDK
TRXB_STRCO      K-----AMQERAFADPKISFVWDSEVAEVQGDQKLAGLKLRNVKTGELSDLPVTIGHDPRTE---LFKGQ
TRXB_SCHPO      SPIMAKRLL----ANPKVEVLWNTVAEE-AQGDGKLLLRIKNTNTNEVSDLFYAIGHIPATK---LVAEQ
FENR_LACCB      EASVAA------LEKSSVTIQTPYLIESVTPQDDQLAIKLKEVRTLTVDKLLINYGFVTDKHHL----QA
FENR_LACC3      EASVAA------LEKSSVTIQTPYLIESVTPQDDQLAIQLKEVRTLTVDKLLINYGFVTDKHHL----QA
TRXB_BACSU      SILQAR-----AFDNEKVDFLWNKTVKEIHEENGKVNVTLVDTVTGEESEVFIYIGMLP--LSKPFENLG
TRXB_STAES      ----AQNILQEAFKNDKVDFIWSHTLKTINEKDGKVLESTKDGQTYDADGVFIYIGMKPLTANLGI----
TRXB_STAEQ      ----AQNILQEAFKNDKVDFIWSHTLKTINEKDGKVLESTKDGQTYDADGVFIYIGMKPLTANLGI----
THCD_RHOER      -----ARALSSVMSEHGVHMRLSTGVKTINAADGRAAVTTNSGDVIHADAVVVGIGVVPNIELAAL--TG
TERPA_PSESP     VVSEAATFIGDIHLGNGIXXXXXXXXXXXXXCTSGVAVFLSDGQLLECDMLVIGVGSEP---RMELATAA
FENR1_BACP2     MKASCARILTP----HELTDLHGQG----DKIDAVTIQHLETGEIIETDAVIVNHGMKGDLSVLS--EWG
DHNA_BACSU      LKADEV-LQKRLYSLPNVTVVKNAQTKEITGDQSVNGITYVDRETGEEKHVFVQIGLVPNTEWL---EGT
CDR_STAA8       MDADMNQPILDELDKREIPY----RLXXXXXXXXXXXXTFKSGKVEHYDMIIEGVGTHPNSKFI--ESSN
TRXB_SPIBA      -----AAMVQRVKSNPKIEIIYNSAVQEITRVNQILVKNLKSGDILKVEALFWCIGHTPQTRLL---KGQ
TRXB_COXBU      EKMLSAQLIKKVEEGK-VAIVWSHVIEEVLGDDQGVTVHLTQDLTIDG--LFIAIGHDPNTK---IFKEQ
HCAD_ECOLU      APPPVQRYLLQRHQQAGVRILLNNAIEHVVDGEK-VELTLQSGETLQADVVIYGIGISAND-QLARE---
CDR_STAS1       MDQDMNQAILDEMDKRDIHYRFNEEISKVV----GNAVHFESGKVENYDLIIEGVGVKPNSEFI--KNSN
CDR_STAAT       MDADMNQPILDELDKREIPY----RLXXXXXXXXXXXXTFKSGKVEHYDMIIEGVGTHPNSKFI--ESSN
CDR_STAAE       MDADMNQPILDELDKREIPY----RLXXXXXXXXXXXXTFKSGKVEHYDMIIEGVGTHPNSKFI--ESSN
CDR_STAAC       MDADMNQPILDELDKREIPY----RLXXXXXXXXXXXXTFKSGKVEHYDMIIEGVGTHPNSKFI--ESSN
CDR_STAA3       MDADMNQPILDELDKREIPY----RLXXXXXXXXXXXXTFKSGKVEHYDMIIEGVGTHPNSKFI--ESSN
TRXB_BORBU      NNLRAIAMLRDSVAKLNIEILYNSEAIEVDGKSSVSSVKIFNKKELEVSAVFMAVGYKPNTEFL---KGF
DHNA_BACYN      LKADEV-LQERLNSLPNVTVIKNAQTKEITGDDKVNGISYMDRDTEEVHHIFVQIGLVPNTDWL---DGT
CAMA_PSEPU      VTAPPVSAFYEVDIRTGTQVCGFEMSTDQQKVTA---VLCEDGTRLPADLVIAGIGLIPNCEL--ASAAG
AIFM3_HUMAN     EETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSEL-RGQEGXXXRADVCVVGIGAVPATGFL--RQSG
TRXB_RICPR      ----AEKILQDLFKNPKISVIGSNKPKAVT----GVKIQTNEINLVNCSGVFIAIGHAPNTA---LFKGQ
NORW_SERP5      MPVEASCRLQHALQQMGVELLLNQQLGALTQHDEGIQATLSNGRQLWVDAAIASVGLRP---NVGLRQAG
HCAD_ECO24      APLPVQRYLLQRHQQAGVRILLNNAIEHVVDGEK-VELTLQSGETLQADVVIYGIGISAN-EQLARE---
HCAD_ECO7I      APPPVQRYLLQRHQQAGVRILLNNAIEHVVDGE-NVELTLQSGETLRADVVIYGIGISAND-QLARE---
HCAD_ECOSM      APPPVQHYLLQRHQQAGVRILLNNAIEHVVDGE-NVELTLQSGETLRADVVIYGIGISAND-QLARE---
AIFM1_DROME     ENANMSKVLPNYLSRQGVCVIPNASIRSAVRDETNLKLELNNGMTLMSDVVVVCVGCTPNTDLAGPSRLE
AHPF_PSEPU      -DAVLQRKLRSLPNVNVITVLGNGEKVTGLRYKD----RSTDEQALEG--IFVQIGLLPNTDWL---KGT
AHPF_PSEPK      -DAVLQRKLRSLPNVNVITVLGNGEKVTGLRYKD----RSTDEQALEG--IFVQIGLLPNTDWL---KGT
TRXB_RICTY      ----AEKILQDLFKNPKISVIWDHVIDEIVKTVTGVKIKTNEINLVNCSGVFIAIGHTPNTT---LFNGQ
TRXB_ECOLI      EKILIKRLMDKV--ENGNIILHTNRTEEVTGDQMGVTVRLRDTQNSDNIESLDVAGLIGHSPNTAIFEGQ
TRXB_ECO57      EKILIKRLMDKV--ENGNIILHTNRTEEVTGDQMGVTVRLRDTQNSDNIESLDVAGLIGHSPNTAIFEGQ
TRXB_DICDI      SKA----MQQKVFSNPKIEVLWDTTLVEIKGEKSVTSVGIYNSETLDAQGLFYAIGHTPNSAFL---NGQ
NORW_SALPB      MPPEVSSRLQHHLTDMGVHXXXXXXXXXXEKTEAGIRATLVSQHSIEVDAVIAATGLRPETALA--RRAG
NORW_AERS4      XXXXXXXXXXXXXXRQGVSLLGIARIDA--QPGDGWRVTLTDGRTSEQDLVIAAIGLKP---NLVLAQAA
MDAR_SOLLC      LFTEGAAFYEGYYKNKGVNIIKGTVAVGFDTHPNGEVVKLKDGRVLEADIVVVGVGARPLTTLF----KG
AHPF_XANCH      -DEVLQRKLRSLHNVRIITSAQTTEVLGDGQKVTGLVYKDRTGQHIELEGVFVQIGLLPNTEFL---RGT
AHPF_SALTY      MKAD--QVLQDVRSLKNVDIILNAQTTEVKGDGSKVVGLEYRDRVSGDIHSVVQIGLLPNTHWL---EGA
MDAR4_ARATH     LTAGIASFYEGYYANKGINIVKGTVASGFTTNSNGEVVKLKDGRTLEADXXXXXXXXXXXXSLFKDQVE-
HCAD_ECOSE      APPPVQRYLLQRHQQAGVRILLNNAIEHVVDGEK-VELTLQSGETLQADVVIYGIGISAN-EQLARE---
HCAD_ECO5E      APPPVQRYLLQRHQQAGVRILLNNAIEHVVDGEK-VELTLQSGETLQADVVIYGIGISAND-QLARE---
HCAD_ECO57      APPPVQRYLLQRHQQAGVRILLNNAIEHVVDGEK-VELTLQSGETLQADVVIYGIGISAND-QLARE---
HCAD_ECO55      APPPVQRYLLQRHQQAGVRILLNNAIEHVVDGEK-VELTLQSGETLQADVVIYGIGISAN-EQLARE---
FENR_FRASC      VERVEASSVEILTFTEVAMVHGEEWIEKVEL----VQTRTGDRHVRPAQAVVAALGF---TADLGLTRWN
HCAD_ECOLI      APPPVQRYLLQRHQQAGVRILLNNAIEHVVDGEK-VELTLQSGETLQADVVIYGIGISAN-EQLARE---
HCAD_ECOLC      APPPVQRYLLQRHQQAGVRILLNNAIEHVVDGEK-VELTLQSGETLQADVVIYGIGISAN-EQLARE---
HCAD_ECOHS      APPPVQRYLLQRHQQAGVRILLNNAIEHVVDGEK-VELTLQSGETLQADVVIYGIGISAN-EQLARE---
HCAD_ECODH      APPPVQRYLLQRHQQAGVRILLNNAIEHVVDGEK-VELTLQSGETLQADVVIYGIGISAN-EQLARE---
HCAD_ECOBW      APPPVQRYLLQRHQQAGVRILLNNAIEHVVDGEK-VELTLQSGETLQADVVIYGIGISAN-EQLARE---
TRXB_MYCPU      EKA----LVNDLKSRKNIEVLFNASVKELHGKDAYAIVNHNGKEVLEVASLFPYIGFLPSAEYA--KNAG
AHPF_ECOLI      MKAD--QVLQDKLSLKNVDIILNAQTTEV-KGDGSKVVGLEDIHNIELAGIFVQIGLLPNTNWL---EGA
TRXB_EUBAC      ----AKSIQEKAFKNPKLDFMWNSAIEEIKGVESAVFKNLVTGETTEGTFGIFVIGYIPKS---DVFKGK
FENR_LACF3      EHTVAASTIEKLYLPKDLTVNAD---QSVTLNLKKM--RADEERPLEVDKVLVNYGFTSN--NAALKDWS
TRXB_CLOLI      ----AKSIQEKAFKNEKLNFMWNTVIEEIKGVESAVFKNRETGEVTEGTFGIFVIGYDPKSA---LVEGK
MDARP_ARATH     LFTPSAQKYEELYRQNGVKFV---KGASINNLEAGSAVKLADGSTIEADTVVIGIGAKPA---IGPFETL
HCAD_PHOLL      -GRCAPPLLQDYLLNRGVQFFLDTNIVSAQKQGSELVLILNTGEKVIGD--IIIYGIGAEFRDQLAADAG
FENR_ACHLI      QSS------VDHFREKGTTVEGNDKVHTLVLKHAKTHERLN----LDADYIVVNYGFVLTKSRL--DEWG
DLDH_HYMDI      ----------------------------------------------------------------------
YDGE_SCHPO      EVGTALKALHE---QNGIAYLENSIKEVKTSSNKAEHIVLKDGQSIPADVVILAAGVKPNLRYLG---NA
FENR_FRAAA      ERVEASRV-EILTFSEVAAIHGEDRIEKVEL----VQTRTGDRHVRPAQAVVAALGF---TADLGLTRWG
FENR1_BACSK     EQMKSVTKIHTPYQIKELHGVGSAEAVTLAHCDTG------EQRQIEVDAVIVNHGM--KLDGCFLIEAG
NIRB_ECOLI      QDQMGGEQLRRKIESMGVRVHTSKNTLEIVQVEARKTMRFADGSELEVDFIVFSTGIRPRDKLA--TQCG
MNMG_PERMH      ----------------------------------------------------------------------
TRXB_RICBR      ----AEKILQELFKNPKISVIGNNNPKSVTGVKI-QNVHTKETSLVNCSGVFVAIGHKPNTA---LFAEQ
GGR2_METBU      ----------------------------------------------------------------------
FENR_SYMTH      EESAASRVHVKVFYELRRVEGDGNWVKKATIFDN----RTGEETTIDVDCVIIGTGF---KASLGMLEWG
FENR_RALPJ      ADASVAEMRAAVVAGEMDFVLGMSRLDSTDGTLIGAAIRGRDGEVLPCDELIALYGLVSEIVNWGVEM--
BAIH_EUBSP      ----------------------------------------------------------------------
NIR_EMENI       QDGDAGSLVTKKIRDLGLEVLHEKRVAKIHTDDTGILFE--DGQELDCCCICFAIGIRPRDELGG--STG
FENR_LACRJ      QLKQSSVQLDTPFLPRALTV-----EDDETVTLDLKKMRSDDEAQLNVDKIVVNYGFTSNNAALNQWSLD
FENR_LACRD      QLKQSSVQLDTPFLPRALTV-----EDDETVTLDLKKMRSDDEAQLNVDKIVVNYGFTSNNAALNQWSLD
BPHG_BURXL      RTGAWCRA---ELERMGVRVERNAQAARFEGQGQVRAVICADGRRVPADVVLVSIGAEP--ADELARAAG
AHPF_PSEAE      -DAVLQRKLYSLPNVEVITSALTSEVKGDGQKVTGLVYKDRNSKSIELEGIFVQIGLLPNTEWL---KGS
TRXB_NEUCR      SSIMAHRLLN----HEKVTVRFNTVGVEVKGDDKGLMSHLTTGKTLEANGLFYAIGHDPATA---LVKGQ
FENR_ACIC1      EAASSVRILTPY---QVSAVYGDDRVTAVDVTDH-------DTKHVERLDVDEIVAALGFVAELGLAEWG
TRXB_TREPA      QKAIAERTLKNPIAVQWNTTLEAVRGETKVSSVLLKDVKTGETRELACDAVFFFIGMVPITGLLPDAEK-
TODA_PSEPU      LGRRIGAWLRGLLTELGVQVELGTGVVGFSGEGQLEQVMASDGRSFVADSALICVGAEP--ADQLARQAG
FENR_STRSY      EHSQSSVTIHTPFIPKGLSG-ENGRASAIDFDK----VKSEDKLTLSFDHLFVNYGFKSSVGTL--KEWG
FENR_STRS2      EHSQSSVTIHTPFIPKGLSG-ENGRASAIDFDK----VKSEDKLTLSFDHLFVNYGFKSSVGTL--KEWG
BNZD_PSEPU      LGRRIGAWLRGLLTELGVQVELGTGVVGFSGEGQLEQVMASDGRSFVADSALICVGAEP--ADQLARQAG
THI4_HALWD      ----------------------------------------------------------------------
FENR_NOCSJ      VEAVQASSVQIVTRAEVSAIRGNGVVESIEIT--------VDGESTEAQAIVAALGFV---ADLGLQQWG
FENR_LACDB      ESS-----VENLKADQKVTLKTPYLPKSVEKGQLEISLKMVGGEVTQETFDQILVAYGFRADNRFVSKWG
FENR_LACDA      ESS-----VENLKADQKVTLKTPYLPKSVEKGQLEISLKMVGGEVTQETFDQILVAYGFRADNRFVSKWG
TRXB_PENCH      ----ASNIMADLLAHPKCKVRFNTVATEVIGENKGLMTHLNAEEVVEANGLFYAVGHDPAS---GLVKGQ
TRXB1_ARATH     ----ASKIMQQALSNPKIDVIWNSSVEAYGDGERDVLGGLKVKNVVTGSGLFFAIGHEPATKFL---DGG
MNMG_SULSY      ----------------------------------------------------------------------
FENR2_BACSK     EHS------VDLLKKSSVRILTPYETAELHGDENGVTVKGDQTETIAVDDVIVNFGFV---STLGIKEWG
FENR1_OCEIH     HEAQVTKLMKECYFNCSITKLISENNQSITNHESGDILALPIDEVIINHGYDRDIDLLDNSPSLGVE---
TRXB_YARLI      RLASHPKV-EILFNHVSIEAKGDGKALEIENTLTG------EKRDLEVNGLFYAIGHIPATS---IVKGQ
NORW_AERHH      XXXXXXXXXXXXXXRQGVSLFGTGLARIDGQPGDGWRVTLTDGRTSEQDLVIAAIGLRPNLAL--ARGAG
FENR_SULTO      E--RSVKQLYQVATVYTWHELKEVRGDGNRVTQAVIFNRTKDEKILDVDAVIISIGFKGDLGN--MPKWG
FENR_BURVG      -DSSVARLRQAVAAGEMDFVVGTARLNSPVGPLESIEVRQIGGSVLDADQLLVLYGLV---ADLGIVNWG
FENR1_EXIS2     EHT------VELLHNSSVNVMTPYTLESVTGEDSIETLTFKHAETDE----VIVVGADDVVCNFGLKEWE
TRXB_ASHGO      ----ASTIMQRRVERNEKIEVLYNTAPVEAKGDGSLLLRVRDTRTGEESDLFYAIGHTPATQ---LVAGQ
TRXB2_ARATH     RALSNPKIVVEAYGDENGRVLGGLKVKNVVTGDVSDL---------KVSGLFFAIGHEPATKFL---DGQ
NORW_VIBF1      MVPDFISLLEKACKEKGITVNLSDCVQAVNKQEQGYRVTTSNGHSYYVDCVISAAGLKPNTKLA--TEAN
FENR1_BACA2     SVAKMKRSSVRVLAPYRLKHLNGTRIESVTQTESGL------SEVIKLDELVINHGF---KIDLGMKDWG
TRXB_CANGA      EQNDKIEILYNTVAQGDGKLLNNLRIKNVKTNEE------TDLPV---NGLFYAIGHTPATK---IVEGQ
GGR_UNCMA       ----------------------------------------------------------------------
FENR_BURP8      -DSSVANMRRAVEAGEMNFAVGTIASLNAPGGQESIELRQAEGSVLATDHLLVLFGLV---ADLGIQQWG
FENR1_BACSU     ESSVTK------MKQSSVRVLTPYRLEQLNGDEEGVTVCHTESKDIEIDELIINHGF---KIDLGMMEWG
THI4_HALSA      ----------------------------------------------------------------------
THI4_HALS3      ----------------------------------------------------------------------
PYRD1_MOUSE     -----------------------------------VYVELTNGTIYGCDFLVSATGVTPNVHPF-LHRNN
FENR2_OCEIH     EHS------VNQLKESSVEILTPYAPINVEASDKIEKIQLQEGEKXXXXXXXXXXCNYGFISSLGIKDWG
PYRD1_RAT       -----------------------------------VYVELTNGSIYGCDFLVSATGVTPNVQPF-LHGND
DHNA_ECOLI      LPPRISAAAHNELTKLGVRVLTQTM---VTSADEGGL-HTKDGEYIEADLMVWAAGI----------KAP
TRXB_BUCAI      AEKILLDRLEKKIKSQKIIIYLNSIVKNILGNSSGVTALLIEQKKIQVSGLFVAIGYTPNT-NIFVNKLK
CRTI_MYXXA      ----------------------------------------------------------------------
PURT_SYNP6      QVADASAVI-------------------------------------------------------------
PURT_SYNE7      QVADASAVI-------------------------------------------------------------
MNMG2_FUSNN     ----------------------------------------------------------------------
FENR_PROVI      -HGKTAREVDEARDAGTVDVHLNTEVASIERRGEGIALRRKNASVVEADRLLLLIGFKSNLANWGLELVD
MNMG_DESAP      ----------------------------------------------------------------------
FENR_IGNH4      M-----RSIERM-VRAGVKMVLNSVPKEIIAKDGALVVTHKEGTVLPLDHLVISIGFEPPDLEW-VKSLG
FENR_DEIGD      ----------------------------------------------------------------------
DHA_BACSH       LSPERLRQLEDMFGRDVQTLMSNNIAESVKHSDGAVLIPGAKAPKLVSEEMIQSMQPGSVVVDIAIDQGG
YEIT_ECO57      ----------------------------------------------------------------------
TRXB_MYCPN      ETANKLRNLPNVVFHLNYTVLGNNTLNGI------VLQNTLDHKQIDLNCVFPYIGFESITKPV--EHLN
TRMFO_RHIME     ----------------------------------------------------------------------
MNMG_MYCPN      ----------------------------------------------------------------------
MNMG_CAMHC      ----------------------------------------------------------------------
YEIT_SALTY      ----------------------------------------------------------------------
YEIT_SALTI      ----------------------------------------------------------------------
THI4_HALMA      ----------------------------------------------------------------------
TETX_BACFR      ----------------------------------------------------------------------
STCD_RHIME      ----------------------------------------------------------------------
MICA2_HUMAN     ----------------------------------------------------------------------
FTHS_ARATH      TTS-----LGDMRERLGKMVIGNSKADPITADDLGVAINPTLMQTLEGTPVLVHAGPFANIAH-------
YPDA_BACSU      ----------------------------------------------------------------------
MNMG_COXBU      ----------------------------------------------------------------------
MNMG_COXBR      ----------------------------------------------------------------------
MNMG_COXBN      ----------------------------------------------------------------------
MNMG_CAMFF      ----------------------------------------------------------------------
PYRD1_PONAB     -----------------------------------VYVELTNEKIYGCDFIVSATGVTPNVEPF-LHGNS
MNMG_UREPA      ----------------------------------------------------------------------
MNMG_UREP2      ----------------------------------------------------------------------
MICA2_MOUSE     ----------------------------------------------------------------------
LSDA_DROME      ----------------------------------------------------------------------
HMT2_SCHPO      -----------------------------------VFKNLNDGSLFERPFDLLHA--VPSMRSHEFIAKS
FTHS_SPIOL      TTS-----LADMRERLGKMVIGNSKAEPITADDLGLAINPTLMQTLEGTPVLVHAGPFANIAH-------
YEIT_ECOLI      ----------------------------------------------------------------------
TRMFO_SINMW     ----------------------------------------------------------------------
PURT_CHLTE      QVADRREVIDMLDGRALDAIVAKHRPDII-----------------------------------------
MNMG_XANOR      ----------------------------------------------------------------------
MNMG_XANOM      ----------------------------------------------------------------------
MNMG_UREU1      ----------------------------------------------------------------------
MNMG_BACSK      ----------------------------------------------------------------------
LEU1_PROMP      HSAD------------------------------------------------------------------
FENR_RHORT      PES-AARL--DQLAAEGLKALGGTRLESVTVADLDGAERQLDADVL-----LPFFGLA---ANLGIAEWG
AHPF_XANCH      ----------------------------------------------------------------------
AHPF_PSEAE      ----------------------------------------------------------------------
DHA_BACSH       ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHP
DLDH1_BACSU     IEMTDRGIVKTDKQCRTNVPNIYAIGDIIEGPPLAHKASYEGKXXXXXXXXXXXXXDYLG-IPAVVFSEP
DLDH_CHLPN      VIRDDRGVIPVDETMRTNVPNIYAIGDITGKWLLAHVASHQGVIAAKNISGHH-EVMDYSAIPSVIFTHP
DLDH_ZYMMO      IKLD-RGFIAVDGFGRTNVDHVWAIGDVAGAPCLAHKASHQGVIAAEAIAGCHVHPLNTQNIPGCTYARP
DLDH_HALVO      LEADDRGFLSVDDRRRTDVEHIYAVGDVVDTPMLAHVASKEGIVAAEHVAGEPVA-FDSQAVPAAVFTDP
DLDH_CHLTR      VICDERGVIPTDATMRTNVPNIYAIGDITGKWQLAHVASHQGIIAARNIAGHK-EEIDYSAVPSVIFTFP
DLDH_CHLMU      VICDERGVIPTDSTMRTNVPNIYAIGDITGKWQLAHVASHQGIVAARNIAGHK-DEIDYSAVPSVIFTFP
DLDH1_BACST     IKMTNRGLIEVDQQCRTSVPNIFAIGDIVPGPALAHKASYEGKVAA-EAIAGHPSAVDYVAIPAVVFSDP
DLDH_STAAW      VKFADRGLLEVDKQSRTSISNIYAIGDIVPGLPLAHKASYEAKVAA-EAIDGQAAEVDYIGMPAVCFTEP
DLDH_STAAU      VKFADRGLLEVDKQSRTSISNIYAIGDIVPGLPLAHKASYEAKVAA-EAIDGQAAEVDYIGMPAVCFTEP
DLDH_STAAS      VKFADRGLLEVDKQSRTSISNIYAIGDIVPGLPLAHKASYEAKVAA-EAIDGQAAEVDYIGMPAVCFTEP
DLDH_STAAR      VKFADRGLLEVDKQSRTSISNIYAIGDIVPGLPLAHKASYEAKVAA-EAIDGQAAEVDYIGMPAVCFTEP
DLDH_STAAN      VKFADRGLLEVDKQSRTSISNIYAIGDIVPGLPLAHKASYEAKVAA-EAIDGQAAEVDYIGMPAVCFTEP
DLDH_STAAM      VKFADRGLLEVDKQSRTSISNIYAIGDIVPGLPLAHKASYEAKVAA-EAIDGQAAEVDYIGMPAVCFTEP
DLDH_STAAC      VKFADRGLLEVDKQSRTSISNIYAIGDIVPGLPLAHKASYEAKVAA-EAIDGQAAEVDYIGMPAVCFTEP
DLDH_CHLP8      IE-TERGFIRTDELCRTSASGIYAIGDVRGGMLLXXXXXXXXXXXXXXXXGKLPEPLSEPLIPRCVYAQP
DLDH_CHLTE      VE-TERGFIRTDGQCRTSAPGIYAIGDVRGGMLLXXXXXXXXXXXXXXXXXXXPEPLSEPLIPRCVYAQP
DLDH2_HALMA     LQTDENGVIPTDDQCRTAFESVFAVGDVAGEPMLAH-KXXXXXXXXXXXXXXXXXXFDHQAIPAAVFTDP
DLDH_THESC      VKVDERGFIQVNARMETSAPGVYAIGDVARPPLLAHKAMKEGLVAAENAAGK--NALFDFQVPSVVYTGP
DLDH3_PSEAE     LASDRRGMLE-NQGQRSAAPGVWVIGDVTSGPMLAHKAEEEAIVCIERIAGHA-AEMNAEVIPSVIYTQP
DLDH3_PSEPU     LETDKRGML-AQRTPPTSVPGVWVIGDVTSGPMLAHKAEDEA-VACIERIAGKPHEVNYNLIPGVIYTRP
DLDH_PIG        IELDPRGRIPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVH-IDYNCVPSVIYTHP
DLDH_CANFA      IELDPRGRIPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAV-PIDYNCVPSVIYTHP
DLDH_MOUSE      IELDPKGRIPVNNRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVH-IDYNCVPSVIYTHP
DLDH_CRIGR      IELDPRGRIPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVH-IDYNCVPSVIYTHP
DLDH_RAT        IELDPKGRIPVNTRFQTKIPNIFAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVH-IDYNCVPSVIYTHP
DLDH_MACFA      IELDPRGRIPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVH-IDYNCVPSVIYTHP
DLDH_HUMAN      IELDPRGRIPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVH-IDYNCVPSVIYTHP
DLDH_AZOVI      VTLDERGFIYVDDYCATSVPGVYAIGDVVRGAMLAHKASEEG-VVVAERIAGHKAQMNYDLIPAVIYTHP
DLDH_PONAB      IELDPRGRIPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVH-IDYNCVPSVIYTHP
DLDH2_BACSU     I-VTENGMISVNESCQTKESHIYAIGDVIGGLQLAHVASHEGIIAVEHFAGLNPHPLDPTLVPKCIYSSP
DLDH1_PSEAE     LDMNGRA-VKVDDQCRTSMRNVWAIGDLAGEPMLAHRAMAQGEMVAELIAGKRFAPVAIPAVC---FTDP
DLDH_PSEFL      VTLDERGFIYVDDHCKTSVPGVFAIGDVVRGAMLAHKASEEG-VMVAERIAGHKAQMNYDLIPSVIYTHP
DLDH2_PSEAE     VTLDERGFIYVDDHCKTSVPGVFAIGDVVRGAMLAHKASEEG-VMVAERIAGHKAQMNYDLIPSVIYTHP
DLDH2_PSEPU     VTIDERGYIFVDDYCATSVPGVYAIGDVVRGMMLAHKASEEGIMVVERIKGHKAQ-MNYDLIPSVIYTHP
DLDH_SHIFL      VEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAA-EVIAGKKHYFDPKVIPSIAYTEP
DLDH_SCHPO      ISMDKSNRVIMDSEYRTNIPHIRVIGDATLGPMLAHKAEDEG-IAAVEYIAKGQGHVNYNCIPAVMYTHP
DLDH_ECOLI      VEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAA-EVIAGKKHYFDPKVIPSIAYTEP
DLDH_ECOL6      VEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAA-EVIAGKKHYFDPKVIPSIAYTEP
DLDH_ECO57      VEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAA-EVIAGKKHYFDPKVIPSIAYTEP
MERA_STAES      VKTGKKGEVLTNEYLQTSNNRIYAAGDVTLGPQFVYVAAYEGGIVANNALGLAKRKIDLRFVPGVTFTNP
MERA_STAAU      VKTGKKGEVLTNEYLQTSNNRIYAAGDVTLGPQFVYVAAYEGGIVANNALGLAKRKIDLRFVPGVTFTNP
DLDH_PEA        VETDKLGRILVNERFSTNVSGVYAIGDVIPGPMLAHKAEEDG-VACVEYLAGKVGHVDYDKVPGVVYTNP
DLDH_YEAST      LEVDKRGRLVIDDQFNSKFPHIKVVGDVTFGPMLAHKAEEEG-IAAVEMLKTGHGHVNYNNIPSVMYSHP
GSHR_ANASP      VDVVDSSIIAVNEYSQTSQPNIYAVGDVTDRLNLTPVAIGEGRAFADSEFGNNRREFSHETIATAVFSNP
DLDH1_PSEPU     LKMNGAA-IAIDERCQTSMHNVWAIGDVAGEPMLAHRAMAQGEMVAEIIAGKA-RRFEPAAIAAVCFTDP
DLDH_BUCAI      LKINNFGFIQVNNQLKTNIPHIYAIGDVAGTPMLAHKGVHEGHIAA-EVISGKNHYFEPKVIPSIAYTDP
DLDH3_HALMA     VETNAQGFIPTDSTCRTNKEHIFAVGDVAGEPMLAHKGS-KXXXXXXXXXXXXXXXXDYQALPAAVFTDP
DLDH_MYCPN      LQRDERNRIVLNQDLQTSIPNIYIVGDANAQLMLAHFAYQQGRYAVNHILNKKVKPAQKLTCPSCIYTNP
DLDH_HALSA      LEPNDDGRLETDHEARTDVENVFAIGDVAPGPMLAHKAS-KXXXXXXXXXXXXXXXLDYQAVPAAVFTDP
DLDH_MANSE      IALDDRGRVPVNNKFQTTVPGIYAIGDVIHGPMLAHKAEDEGIVCVEGIKGMPVH-FNYDAIPSVIYTSP
STHA_MYCTU      LEVQGRGRIFVDDRFQTKVDHIYAVGDVIGFPALAATSMEQGRLAAYHAFGEPTDGIELQPIG--IYSIP
STHA_MYCTA      LEVQGRGRIFVDDRFQTKVDHIYAVGDVIGFPALAATSMEQGRLAAYHAFGEPTDGIELQPIG--IYSIP
STHA_MYCBT      LEVQGRGRIFVDDRFQTKVDHIYAVGDVIGFPALAATSMEQGRLAAYHAFGEPTDGIELQPIG--IYSIP
STHA_MYCBP      LEVQGRGRIFVDDRFQTKVDHIYAVGDVIGFPALAATSMEQGRLAAYHAFGEPTDGIELQPIG--IYSIP
STHA_MYCBO      LEVQGRGRIFVDDRFQTKVDHIYAVGDVIGFPALAATSMEQGRLAAYHAFGEPTDGIELQPIG--IYSIP
DLDH_BUCBP      LKTDNNGFIKVNEQFCTNIPNIYAIGDVIGQPMLAHKGTHEGHIVAEVISGKKFNPFVIPCVS---YTEP
MERA_THIFE      VAINAQGAIVIDQGMRTNSPNIYAAGDCTDQPQFVYVXXXXXXXXXINMMGGSAA-LDLTAMPAVVFTDP
DLDH_HAEIN      VEVDDRGFIHVDKQMRTNVPHIYAIGDIVGQPMLAHKGVHEGHVAA-EVIAGQKHYFDPKVIPSIAYTEP
DLDH_BUCAP      LKLNESGFIEINQQLKTNISHIYAIGDVTGFPMLAHKAVQQAHIAA-EVISGKKHYFEPKVIPSVAYTDP
MERA_BACCE      VEVGSRGEIVIDDYLKTTNSRIYSAGDVTPGPQFVYVAAYEGGLAARNAIGGLNQKVNLEVVPGVTFTSP
DLDH_SYNY3      VETDRRGFIEVNDQMQVPVPHLWAVGDATGKMMLAHAASGQGVVAVENICGRK-TEVDYRAIPAAAFTHP
DLDH_RHOCA      VEMLPRGQVKADSHWATNVPGLYAIGDAIVGPMLAHKAEDEG-MAVAEVIAGKHGHVNYDVIPGVIYTTP
GSHR_BURCE      VGLDQNGAIKVDEYSRTSSPGIYAVGDVTNRLNLTPVAIHEGHAFADTVFGGKALPTEHENVPFAVFSQP
DLDH_VIBCH      LEVDERGFIRVDKQMRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAA-EVISGKKHYFDPKVIPSIAYTEP
GSHRP_SPIOL     VELDRTGAVKVDEYSRTSVPSIWAIGDVTNRMNLTPVALMEGTCFAKTVFGGQNSKPDYSNIACAVFSIP
DLDH1_ARATH     VETDKAGRILVNDRFLSNVPGVYAIGDVIPGPMLAHKAEEDG-VACVEFIAGKHGHVDYDKVPGVVYTHP
MERA_ENTAG      VAVNAQGAIVIDKGMRTSSPNIYAAGDCTDQPQFVYVXXXXXXXXXINMTGGDAA-LDLTAMPAVVFTDP
DLDH_MYCGE      LKRDHNNKIVLNEKLQTSTTNIYLIGDVNTQMMLAHYAYQQGRYAVDQILNQQVKPAEKNKCPACIYTNP
DLDH_VIBPA      LEIDERGFINVDKQMRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAA-EVISGKKHYFDPKVIPSIAYTEP
MERA_PSEAE      VTVNAQGAIVIDQGMRTSNPNIYAAGDCTDQPQFVYVXXXXXXXXXINMTGGDAA-LDLTAMPAVVFTDP
DLDH_MYCTU      VALTDRKAIGVDDYMRTNVGHIYAIGDVNGLLQLAHVAEAQGVVAAETIAGAETLTLDHRMLPRATFCQP
DLDH_MYCBO      VALTDRKAIGVDDYMRTNVGHIYAIGDVNGLLQLAHVAEAQ<