[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ56646.1

[Show Plain Result]


## Summary of Sequence Search
    1::169
    1::169     2e-61 100%  169 aa  RS9_THEFY RecName: Full=30S ribosomal protein S9;
   35::166     6e-29  63%  166 aa  RS9_NOCSJ RecName: Full=30S ribosomal protein S9;
   49::175     1e-28  56%  175 aa  RS9_STRGG RecName: Full=30S ribosomal protein S9;
   47::173     1e-28  66%  173 aa  RS9_STRAW RecName: Full=30S ribosomal protein S9;
   37::173     1e-27  60%  173 aa  RS9_PROAC RecName: Full=30S ribosomal protein S9;
   44::170     4e-27  63%  170 aa  RS9_STRCO RecName: Full=30S ribosomal protein S9;
   59::167     4e-27  61%  167 aa  RS9_RENSM RecName: Full=30S ribosomal protein S9;
   39::167     5e-27  64%  167 aa  RS9_KINRD RecName: Full=30S ribosomal protein S9;
   60::168     3e-26  60%  168 aa  RS9_ARTCA RecName: Full=30S ribosomal protein S9;
   33::163     3e-26  42%  163 aa  RS9_BIFA0 RecName: Full=30S ribosomal protein S9;
   60::168     6e-26  59%  168 aa  RS9_ARTAT RecName: Full=30S ribosomal protein S9;
   60::168     2e-25  60%  168 aa  RS9_ARTS2 RecName: Full=30S ribosomal protein S9;
   45::152     4e-25  64%  152 aa  RS9_MYCMM RecName: Full=30S ribosomal protein S9;
   33::167     6e-25  51%  167 aa  RS9_NOCFA RecName: Full=30S ribosomal protein S9;
   43::150     6e-25  60%  150 aa  RS9_MYCS2 RecName: Full=30S ribosomal protein S9;
   46::153     1e-24  52%  153 aa  RS9_SACEN RecName: Full=30S ribosomal protein S9;
   33::163     1e-24  40%  163 aa  RS9_BIFLO RecName: Full=30S ribosomal protein S9;
   33::163     1e-24  40%  163 aa  RS9_BIFLI RecName: Full=30S ribosomal protein S9;
   33::163     1e-24  40%  163 aa  RS9_BIFLD RecName: Full=30S ribosomal protein S9;
   47::153     2e-24  64%  153 aa  RS9_MYCLE RecName: Full=30S ribosomal protein S9;
   47::153     2e-24  64%  153 aa  RS9_MYCLB RecName: Full=30S ribosomal protein S9;
   59::166     2e-24  62%  166 aa  RS9_MYCA1 RecName: Full=30S ribosomal protein S9;
   59::166     3e-24  61%  166 aa  RS9_MYCPA RecName: Full=30S ribosomal protein S9;
   63::170     4e-24  59%  170 aa  RS9_RHOOB RecName: Full=30S ribosomal protein S9;
   63::170     4e-24  59%  170 aa  RS9_RHOE4 RecName: Full=30S ribosomal protein S9;
   45::152     4e-24  63%  152 aa  RS9_MYCUA RecName: Full=30S ribosomal protein S9;
   51::158     4e-24  60%  158 aa  RS9_MYCSS RecName: Full=30S ribosomal protein S9;
   51::158     4e-24  60%  158 aa  RS9_MYCSK RecName: Full=30S ribosomal protein S9;
   51::158     4e-24  60%  158 aa  RS9_MYCSJ RecName: Full=30S ribosomal protein S9;
   60::168     5e-24  69%  168 aa  RS9_LEIXX RecName: Full=30S ribosomal protein S9;
   40::163     2e-23  42%  163 aa  RS9_BIFAA RecName: Full=30S ribosomal protein S9;
   47::154     3e-23  61%  154 aa  RS9_SALTO RecName: Full=30S ribosomal protein S9;
   76::182     3e-23  50%  182 aa  RS9_CORGL RecName: Full=30S ribosomal protein S9;
   76::182     3e-23  50%  182 aa  RS9_CORGB RecName: Full=30S ribosomal protein S9;
   47::154     1e-22  60%  154 aa  RS9_SALAI RecName: Full=30S ribosomal protein S9;
   53::161     2e-21  64%  161 aa  RS9_CLAMS RecName: Full=30S ribosomal protein S9;
   53::161     2e-21  64%  161 aa  RS9_CLAM3 RecName: Full=30S ribosomal protein S9;
   44::151     3e-21  59%  151 aa  RS9_MYCTU RecName: Full=30S ribosomal protein S9;
   44::151     3e-21  59%  151 aa  RS9_MYCTA RecName: Full=30S ribosomal protein S9;
   44::151     3e-21  59%  151 aa  RS9_MYCBT RecName: Full=30S ribosomal protein S9;
   44::151     3e-21  59%  151 aa  RS9_MYCBP RecName: Full=30S ribosomal protein S9;
   44::151     3e-21  59%  151 aa  RS9_MYCBO RecName: Full=30S ribosomal protein S9;
   46::154     1e-20  53%  154 aa  RS9_TROWT RecName: Full=30S ribosomal protein S9;
   46::154     1e-20  53%  154 aa  RS9_TROW8 RecName: Full=30S ribosomal protein S9;
    8::130     2e-20  43%  130 aa  RS9_CARHZ RecName: Full=30S ribosomal protein S9;
   76::182     4e-20  49%  182 aa  RS9_COREF RecName: Full=30S ribosomal protein S9;
    8::130     1e-19  41%  130 aa  RS9_BACHD RecName: Full=30S ribosomal protein S9;
   15::138     9e-19  41%  138 aa  RS9_ANAVT RecName: Full=30S ribosomal protein S9;
   15::138     9e-19  41%  138 aa  RS9_ANASP RecName: Full=30S ribosomal protein S9;
    8::130     2e-18  39%  130 aa  RS9_RUBXD RecName: Full=30S ribosomal protein S9;
   15::138     2e-18  40%  138 aa  RS9_NOSP7 RecName: Full=30S ribosomal protein S9;
    8::130     2e-18  38%  130 aa  RS9_BACSK RecName: Full=30S ribosomal protein S9;
   23::130     6e-18  43%  130 aa  RS9_ANATD RecName: Full=30S ribosomal protein S9;
   13::137     8e-18  38%  137 aa  RS9_THEEB RecName: Full=30S ribosomal protein S9;
    8::130     8e-18  37%  130 aa  RS9_HAHCH RecName: Full=30S ribosomal protein S9;
   13::137     8e-18  40%  137 aa  RS9_CYAP4 RecName: Full=30S ribosomal protein S9;
   14::137     1e-17  40%  137 aa  RS9_MICAN RecName: Full=30S ribosomal protein S9;
   84::208     1e-17  48%  208 aa  RR9_ARATH RecName: Full=30S ribosomal protein S9,
    2::130     2e-17  34%  130 aa  RS9_MARAV RecName: Full=30S ribosomal protein S9;
    8::130     2e-17  37%  130 aa  RS9_LACLS RecName: Full=30S ribosomal protein S9;
    8::130     2e-17  37%  130 aa  RS9_LACLM RecName: Full=30S ribosomal protein S9;
    8::130     2e-17  37%  130 aa  RS9_LACLA RecName: Full=30S ribosomal protein S9;
   14::137     2e-17  40%  137 aa  RS9_CYAP7 RecName: Full=30S ribosomal protein S9;
    8::130     3e-17  36%  130 aa  RS9_OCEIH RecName: Full=30S ribosomal protein S9;
   25::132     3e-17  42%  132 aa  RS9_CALS8 RecName: Full=30S ribosomal protein S9;
    8::130     4e-17  37%  130 aa  RS9_STRS7 RecName: Full=30S ribosomal protein S9;
    7::130     4e-17  38%  130 aa  RS9_HELMI RecName: Full=30S ribosomal protein S9;
    8::130     5e-17  37%  130 aa  RS9_STRMU RecName: Full=30S ribosomal protein S9;
    8::130     5e-17  37%  130 aa  RS9_STREM RecName: Full=30S ribosomal protein S9;
    8::130     5e-17  37%  130 aa  RS9_STRE4 RecName: Full=30S ribosomal protein S9;
    8::130     5e-17  37%  130 aa  RS9_ENTFA RecName: Full=30S ribosomal protein S9;
   73::197     5e-17  39%  197 aa  RR9_SPIOL RecName: Full=30S ribosomal protein S9,
   13::136     6e-17  37%  136 aa  RS9_PROM5 RecName: Full=30S ribosomal protein S9;
   14::137     8e-17  40%  137 aa  RS9_SYNY3 RecName: Full=30S ribosomal protein S9;
    8::130     8e-17  33%  130 aa  RS9_SYNWW RecName: Full=30S ribosomal protein S9;
    8::130     8e-17  37%  130 aa  RS9_STRA5 RecName: Full=30S ribosomal protein S9;
    8::130     8e-17  37%  130 aa  RS9_STRA3 RecName: Full=30S ribosomal protein S9;
    8::130     8e-17  37%  130 aa  RS9_STRA1 RecName: Full=30S ribosomal protein S9;
   23::130     8e-17  43%  130 aa  RS9_DESVV RecName: Full=30S ribosomal protein S9;
   23::130     8e-17  43%  130 aa  RS9_DESVH RecName: Full=30S ribosomal protein S9;
   13::136     1e-16  37%  136 aa  RS9_PROM9 RecName: Full=30S ribosomal protein S9;
    7::130     1e-16  35%  130 aa  RS9_LYSSC RecName: Full=30S ribosomal protein S9;
    8::130     1e-16  39%  130 aa  RS9_THETN RecName: Full=30S ribosomal protein S9;
    8::130     1e-16  37%  130 aa  RS9_STRZT RecName: Full=30S ribosomal protein S9;
    8::130     1e-16  37%  130 aa  RS9_STRZP RecName: Full=30S ribosomal protein S9;
    8::130     1e-16  37%  130 aa  RS9_STRZJ RecName: Full=30S ribosomal protein S9;
    8::130     1e-16  37%  130 aa  RS9_STRTD RecName: Full=30S ribosomal protein S9;
    8::130     1e-16  37%  130 aa  RS9_STRT2 RecName: Full=30S ribosomal protein S9;
    8::130     1e-16  37%  130 aa  RS9_STRT1 RecName: Full=30S ribosomal protein S9;
    8::130     1e-16  37%  130 aa  RS9_STRR6 RecName: Full=30S ribosomal protein S9;
    8::130     1e-16  37%  130 aa  RS9_STRPS RecName: Full=30S ribosomal protein S9;
    8::130     1e-16  37%  130 aa  RS9_STRPN RecName: Full=30S ribosomal protein S9;
    8::130     1e-16  37%  130 aa  RS9_STRPJ RecName: Full=30S ribosomal protein S9;
    8::130     1e-16  37%  130 aa  RS9_STRPI RecName: Full=30S ribosomal protein S9;
    8::130     1e-16  37%  130 aa  RS9_STRP7 RecName: Full=30S ribosomal protein S9;
    8::130     1e-16  37%  130 aa  RS9_STRP4 RecName: Full=30S ribosomal protein S9;
    8::130     1e-16  37%  130 aa  RS9_STRP2 RecName: Full=30S ribosomal protein S9;
    8::130     2e-16  37%  130 aa  RS9_METCA RecName: Full=30S ribosomal protein S9;
    2::130     2e-16  35%  130 aa  RS9_ERWT9 RecName: Full=30S ribosomal protein S9;
    2::131     2e-16  35%  131 aa  RS9_ACTSZ RecName: Full=30S ribosomal protein S9;
    8::130     2e-16  37%  130 aa  RS9_PEDPA RecName: Full=30S ribosomal protein S9;
    8::130     2e-16  36%  130 aa  RS9_MOOTA RecName: Full=30S ribosomal protein S9;
    8::130     2e-16  37%  130 aa  RS9_EXISA RecName: Full=30S ribosomal protein S9;
   14::137     2e-16  40%  137 aa  RS9_CYAA5 RecName: Full=30S ribosomal protein S9;
    8::130     3e-16  34%  130 aa  RS9_IDILO RecName: Full=30S ribosomal protein S9;
   32::160     4e-16  35%  160 aa  RS9_RHOSK RecName: Full=30S ribosomal protein S9;
   32::160     4e-16  35%  160 aa  RS9_RHOS4 RecName: Full=30S ribosomal protein S9;
   32::160     4e-16  35%  160 aa  RS9_RHOS1 RecName: Full=30S ribosomal protein S9;
   13::136     4e-16  37%  136 aa  RS9_PROMS RecName: Full=30S ribosomal protein S9;
    2::131     4e-16  35%  131 aa  RS9_HAEPS RecName: Full=30S ribosomal protein S9;
    8::130     4e-16  37%  130 aa  RS9_BACHK RecName: Full=30S ribosomal protein S9;
    8::130     4e-16  37%  130 aa  RS9_BACCZ RecName: Full=30S ribosomal protein S9;
    8::130     4e-16  37%  130 aa  RS9_BACCR RecName: Full=30S ribosomal protein S9;
    8::130     4e-16  37%  130 aa  RS9_BACCQ RecName: Full=30S ribosomal protein S9;
    8::130     4e-16  37%  130 aa  RS9_BACCN RecName: Full=30S ribosomal protein S9;
    8::130     4e-16  37%  130 aa  RS9_BACC7 RecName: Full=30S ribosomal protein S9;
    8::130     4e-16  37%  130 aa  RS9_BACC4 RecName: Full=30S ribosomal protein S9;
    8::130     4e-16  37%  130 aa  RS9_BACC3 RecName: Full=30S ribosomal protein S9;
    8::130     4e-16  37%  130 aa  RS9_BACC2 RecName: Full=30S ribosomal protein S9;
    8::130     4e-16  37%  130 aa  RS9_BACC1 RecName: Full=30S ribosomal protein S9;
    8::130     4e-16  37%  130 aa  RS9_BACC0 RecName: Full=30S ribosomal protein S9;
    8::130     4e-16  37%  130 aa  RS9_BACAH RecName: Full=30S ribosomal protein S9;
   14::137     5e-16  37%  137 aa  RS9_SYNP2 RecName: Full=30S ribosomal protein S9;
   13::136     5e-16  37%  136 aa  RS9_PROMP RecName: Full=30S ribosomal protein S9;
    8::130     5e-16  35%  130 aa  RS9_ERWCT RecName: Full=30S ribosomal protein S9;
   13::136     7e-16  37%  136 aa  RS9_PROM0 RecName: Full=30S ribosomal protein S9;
    8::130     7e-16  35%  130 aa  RS9_GEOSW RecName: Full=30S ribosomal protein S9;
   24::130     7e-16  41%  130 aa  RS9_DESDA RecName: Full=30S ribosomal protein S9;
    8::130     9e-16  34%  130 aa  RS9_PSEU5 RecName: Full=30S ribosomal protein S9;
    8::130     9e-16  35%  130 aa  RS9_HAMD5 RecName: Full=30S ribosomal protein S9;
    8::130     1e-15  35%  130 aa  RS9_SERP5 RecName: Full=30S ribosomal protein S9;
   32::160     1e-15  34%  160 aa  RS9_RHOS5 RecName: Full=30S ribosomal protein S9;
   23::130     1e-15  41%  130 aa  RS9_LAWIP RecName: Full=30S ribosomal protein S9;
   34::160     2e-15  35%  160 aa  RS9_XANP2 RecName: Full=30S ribosomal protein S9;
    8::130     2e-15  34%  130 aa  RS9_PSEMY RecName: Full=30S ribosomal protein S9;
    2::130     2e-15  32%  130 aa  RS9_AZOSE RecName: Full=30S ribosomal protein S9;
   27::155     3e-15  33%  155 aa  RS9_RHIL3 RecName: Full=30S ribosomal protein S9;
   13::136     3e-15  36%  136 aa  RS9_PROM2 RecName: Full=30S ribosomal protein S9;
   10::132     3e-15  35%  132 aa  RS9_NATTJ RecName: Full=30S ribosomal protein S9;
    8::130     3e-15  34%  130 aa  RS9_ALHEH RecName: Full=30S ribosomal protein S9;
   11::137     4e-15  44%  137 aa  RS9_RHOBA RecName: Full=30S ribosomal protein S9;
    9::139     4e-15  35%  139 aa  RS9_COXBU RecName: Full=30S ribosomal protein S9;
    9::139     4e-15  35%  139 aa  RS9_COXBR RecName: Full=30S ribosomal protein S9;
    9::139     4e-15  35%  139 aa  RS9_COXBN RecName: Full=30S ribosomal protein S9;
    9::139     4e-15  35%  139 aa  RS9_COXB2 RecName: Full=30S ribosomal protein S9;
    8::130     4e-15  36%  130 aa  RS9_BACAN RecName: Full=30S ribosomal protein S9;
    8::130     4e-15  36%  130 aa  RS9_BACAC RecName: Full=30S ribosomal protein S9;
    8::130     4e-15  36%  130 aa  RS9_BACAA RecName: Full=30S ribosomal protein S9;
    8::130     4e-15  33%  130 aa  RS9_ANOFW RecName: Full=30S ribosomal protein S9;
    8::130     4e-15  36%  130 aa  RS9_AERS4 RecName: Full=30S ribosomal protein S9;
    8::130     4e-15  36%  130 aa  RS9_AERHH RecName: Full=30S ribosomal protein S9;
   27::155     5e-15  33%  155 aa  RS9_RHILW RecName: Full=30S ribosomal protein S9;
    2::131     5e-15  32%  131 aa  RS9_MANSM RecName: Full=30S ribosomal protein S9;
    8::130     5e-15  35%  130 aa  RS9_LISMO RecName: Full=30S ribosomal protein S9;
   24::130     5e-15  39%  130 aa  RS9_DESDG RecName: Full=30S ribosomal protein S9;
    7::130     5e-15  35%  130 aa  RS9_CLOPS RecName: Full=30S ribosomal protein S9;
    7::130     5e-15  35%  130 aa  RS9_CLOPE RecName: Full=30S ribosomal protein S9;
    7::130     5e-15  35%  130 aa  RS9_CLOP1 RecName: Full=30S ribosomal protein S9;
    8::130     5e-15  35%  130 aa  RS9_BACSU RecName: Full=30S ribosomal protein S9;AltName:
    8::130     5e-15  35%  130 aa  RS9_BACA2 RecName: Full=30S ribosomal protein S9;
    2::130     5e-15  32%  130 aa  RS9_AZOSB RecName: Full=30S ribosomal protein S9;
    8::130     6e-15  34%  130 aa  RS9_PSEF5 RecName: Full=30S ribosomal protein S9;
    8::130     6e-15  35%  130 aa  RS9_PHOLL RecName: Full=30S ribosomal protein S9;
    8::130     6e-15  35%  130 aa  RS9_LISW6 RecName: Full=30S ribosomal protein S9;
    8::130     6e-15  34%  130 aa  RS9_BACST RecName: Full=30S ribosomal protein S9;AltName:
   14::137     6e-15  38%  137 aa  RS9_ACAM1 RecName: Full=30S ribosomal protein S9;
    8::130     8e-15  37%  130 aa  RS9_THEPX RecName: Full=30S ribosomal protein S9;
    8::130     8e-15  37%  130 aa  RS9_THEP3 RecName: Full=30S ribosomal protein S9;
    8::130     8e-15  34%  130 aa  RS9_PSEU2 RecName: Full=30S ribosomal protein S9;
    8::130     8e-15  34%  130 aa  RS9_PSESM RecName: Full=30S ribosomal protein S9;
    8::130     8e-15  34%  130 aa  RS9_PSEPF RecName: Full=30S ribosomal protein S9;
    8::130     8e-15  34%  130 aa  RS9_PSE14 RecName: Full=30S ribosomal protein S9;
    8::130     8e-15  35%  130 aa  RS9_PROMH RecName: Full=30S ribosomal protein S9;
   23::130     8e-15  38%  130 aa  RS9_MAGSM RecName: Full=30S ribosomal protein S9;
    8::130     8e-15  35%  130 aa  RS9_LISMH RecName: Full=30S ribosomal protein S9;
    8::130     8e-15  35%  130 aa  RS9_LISMF RecName: Full=30S ribosomal protein S9;
    8::130     8e-15  35%  130 aa  RS9_LISMC RecName: Full=30S ribosomal protein S9;
    8::130     8e-15  35%  130 aa  RS9_LISIN RecName: Full=30S ribosomal protein S9;
    2::130     8e-15  33%  130 aa  RS9_HAESO RecName: Full=30S ribosomal protein S9;
    2::130     8e-15  33%  130 aa  RS9_HAES2 RecName: Full=30S ribosomal protein S9;
    2::130     8e-15  33%  130 aa  RS9_HAES1 RecName: Full=30S ribosomal protein S9;
    8::130     8e-15  34%  130 aa  RS9_GEOTN RecName: Full=30S ribosomal protein S9;
    8::130     8e-15  34%  130 aa  RS9_ENT38 RecName: Full=30S ribosomal protein S9;
    8::130     8e-15  35%  130 aa  RS9_BACLD RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  35%  130 aa  RS9_VIBCM RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  35%  130 aa  RS9_VIBCH RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  35%  130 aa  RS9_VIBC3 RecName: Full=30S ribosomal protein S9;
    6::128     1e-14  35%  128 aa  RS9_THET2 RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_SHISS RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_SHIF8 RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_SHIDS RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_SHIBS RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_SHIB3 RecName: Full=30S ribosomal protein S9;
   27::155     1e-14  33%  155 aa  RS9_RHIE6 RecName: Full=30S ribosomal protein S9;
   33::161     1e-14  33%  161 aa  RS9_METPB RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_KLEP7 RecName: Full=30S ribosomal protein S9;
    2::130     1e-14  33%  130 aa  RS9_HAEIN RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_EDWI9 RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_ECOUT RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_ECOSM RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_ECOSE RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_ECOLU RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_ECOLI RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_ECOLC RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_ECOL6 RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_ECOL5 RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_ECOK1 RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_ECOHS RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_ECODH RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_ECOBW RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_ECO8A RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_ECO81 RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_ECO7I RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_ECO5E RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_ECO57 RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_ECO55 RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_ECO45 RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_ECO27 RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_ECO24 RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  36%  130 aa  RS9_CLOD6 RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  35%  130 aa  RS9_CLOCE RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_CITK8 RecName: Full=30S ribosomal protein S9;
    6::128     1e-14  35%  128 aa  RS9_THET8 RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_SALTY RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_SALTI RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_SALSV RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_SALPK RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_SALPC RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_SALPB RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_SALPA RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_SALNS RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_SALHS RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_SALEP RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_SALDC RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_SALCH RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_SALAR RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_SALA4 RecName: Full=30S ribosomal protein S9;
   36::162     1e-14  35%  162 aa  RS9_PARL1 RecName: Full=30S ribosomal protein S9;
    2::130     1e-14  33%  130 aa  RS9_NITEU RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  35%  130 aa  RS9_LACCB RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  35%  130 aa  RS9_LACC3 RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_KLEP3 RecName: Full=30S ribosomal protein S9;
    2::130     1e-14  33%  130 aa  RS9_HAEIG RecName: Full=30S ribosomal protein S9;
    2::130     1e-14  33%  130 aa  RS9_HAEIE RecName: Full=30S ribosomal protein S9;
    2::130     1e-14  33%  130 aa  RS9_HAEI8 RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  34%  130 aa  RS9_ESCF3 RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  35%  130 aa  RS9_CLOTH RecName: Full=30S ribosomal protein S9;
    8::130     1e-14  33%  130 aa  RS9_AZOVD RecName: Full=30S ribosomal protein S9;
   13::137     1e-14  37%  137 aa  RR9_MESVI RecName: Full=30S ribosomal protein S9, chloroplastic;
    8::130     2e-14  34%  130 aa  RS9_YERPY RecName: Full=30S ribosomal protein S9;
    8::130     2e-14  34%  130 aa  RS9_YERPS RecName: Full=30S ribosomal protein S9;
    8::130     2e-14  34%  130 aa  RS9_YERPP RecName: Full=30S ribosomal protein S9;
    8::130     2e-14  34%  130 aa  RS9_YERPN RecName: Full=30S ribosomal protein S9;
    8::130     2e-14  34%  130 aa  RS9_YERPG RecName: Full=30S ribosomal protein S9;
    8::130     2e-14  34%  130 aa  RS9_YERPE RecName: Full=30S ribosomal protein S9;
    8::130     2e-14  34%  130 aa  RS9_YERPB RecName: Full=30S ribosomal protein S9;
    8::130     2e-14  34%  130 aa  RS9_YERPA RecName: Full=30S ribosomal protein S9;
    8::130     2e-14  34%  130 aa  RS9_YERP3 RecName: Full=30S ribosomal protein S9;
    8::130     2e-14  34%  130 aa  RS9_YERE8 RecName: Full=30S ribosomal protein S9;
    8::130     2e-14  34%  130 aa  RS9_VIBHB RecName: Full=30S ribosomal protein S9;
   14::137     2e-14  36%  137 aa  RS9_SYNJA RecName: Full=30S ribosomal protein S9;
   23::130     2e-14  38%  130 aa  RS9_SORC5 RecName: Full=30S ribosomal protein S9;
    8::130     2e-14  33%  130 aa  RS9_SHIFL RecName: Full=30S ribosomal protein S9;
   30::158     2e-14  33%  158 aa  RS9_RHORT RecName: Full=30S ribosomal protein S9;
    8::130     2e-14  33%  130 aa  RS9_PSEFS RecName: Full=30S ribosomal protein S9;
    8::130     2e-14  34%  130 aa  RS9_PECCP RecName: Full=30S ribosomal protein S9;
    8::130     2e-14  34%  130 aa  RS9_GEOSF RecName: Full=30S ribosomal protein S9;
    9::139     2e-14  34%  139 aa  RS9_COXB1 RecName: Full=30S ribosomal protein S9;
    8::130     2e-14  35%  130 aa  RS9_CLOK5 RecName: Full=30S ribosomal protein S9;
    8::130     2e-14  35%  130 aa  RS9_CLOK1 RecName: Full=30S ribosomal protein S9;
    8::130     2e-14  33%  130 aa  RS9_VIBPA RecName: Full=30S ribosomal protein S9;
    8::130     2e-14  33%  130 aa  RS9_SHEWM RecName: Full=30S ribosomal protein S9;
    8::130     2e-14  33%  130 aa  RS9_SHESH RecName: Full=30S ribosomal protein S9;
    2::131     2e-14  33%  131 aa  RS9_HAEDU RecName: Full=30S ribosomal protein S9;
   24::130     2e-14  37%  130 aa  RS9_DESVM RecName: Full=30S ribosomal protein S9;
    8::130     2e-14  34%  130 aa  RS9_CLONN RecName: Full=30S ribosomal protein S9;
   11::134     2e-14  37%  134 aa  RR9_GUITH RecName: Full=30S ribosomal protein S9, chloroplastic;
    8::130     3e-14  36%  130 aa  RS9_STRU0 RecName: Full=30S ribosomal protein S9;
    8::130     3e-14  33%  130 aa  RS9_SODGM RecName: Full=30S ribosomal protein S9;
   34::160     3e-14  34%  160 aa  RS9_RHOPT RecName: Full=30S ribosomal protein S9;
   34::160     3e-14  34%  160 aa  RS9_RHOPA RecName: Full=30S ribosomal protein S9;AltName:
   27::155     3e-14  33%  155 aa  RS9_RHIME RecName: Full=30S ribosomal protein S9;
    9::134     4e-14  37%  134 aa  RS9_THESQ RecName: Full=30S ribosomal protein S9;
    9::134     4e-14  37%  134 aa  RS9_THEMA RecName: Full=30S ribosomal protein S9;
   13::136     4e-14  36%  136 aa  RS9_SYNJB RecName: Full=30S ribosomal protein S9;
   27::155     4e-14  33%  155 aa  RS9_SINMW RecName: Full=30S ribosomal protein S9;
    8::130     4e-14  32%  130 aa  RS9_SHEFN RecName: Full=30S ribosomal protein S9;
    8::130     4e-14  32%  130 aa  RS9_SHEDO RecName: Full=30S ribosomal protein S9;
   32::158     4e-14  34%  158 aa  RS9_OLICO RecName: Full=30S ribosomal protein S9;
   30::158     4e-14  33%  158 aa  RS9_OCHA4 RecName: Full=30S ribosomal protein S9;
   30::158     4e-14  33%  158 aa  RS9_BRUSU RecName: Full=30S ribosomal protein S9;
   30::158     4e-14  33%  158 aa  RS9_BRUSI RecName: Full=30S ribosomal protein S9;
   30::158     4e-14  33%  158 aa  RS9_BRUO2 RecName: Full=30S ribosomal protein S9;
   30::158     4e-14  33%  158 aa  RS9_BRUME RecName: Full=30S ribosomal protein S9;
   30::158     4e-14  33%  158 aa  RS9_BRUMB RecName: Full=30S ribosomal protein S9;
   30::158     4e-14  33%  158 aa  RS9_BRUC2 RecName: Full=30S ribosomal protein S9;
   30::158     4e-14  33%  158 aa  RS9_BRUAB RecName: Full=30S ribosomal protein S9;
   30::158     4e-14  33%  158 aa  RS9_BRUA2 RecName: Full=30S ribosomal protein S9;
   30::158     4e-14  33%  158 aa  RS9_BRUA1 RecName: Full=30S ribosomal protein S9;
   34::160     4e-14  33%  160 aa  RS9_BRASO RecName: Full=30S ribosomal protein S9;
   34::160     4e-14  34%  160 aa  RS9_BRASB RecName: Full=30S ribosomal protein S9;
   27::155     4e-14  33%  155 aa  RS9_AGRVS RecName: Full=30S ribosomal protein S9;
   32::158     5e-14  34%  158 aa  RS9_RHOPS RecName: Full=30S ribosomal protein S9;
   22::128     5e-14  48%  128 aa  RS9_PARD8 RecName: Full=30S ribosomal protein S9;
    8::130     5e-14  35%  130 aa  RS9_CLOTE RecName: Full=30S ribosomal protein S9;
    7::130     5e-14  33%  130 aa  RS9_CLOBA RecName: Full=30S ribosomal protein S9;
   22::128     5e-14  36%  128 aa  RS9_BACFR RecName: Full=30S ribosomal protein S9;
   22::128     5e-14  36%  128 aa  RS9_BACFN RecName: Full=30S ribosomal protein S9;
   22::128     5e-14  47%  128 aa  RS9_AZOPC RecName: Full=30S ribosomal protein S9;
    8::130     7e-14  34%  130 aa  RS9_VIBVY RecName: Full=30S ribosomal protein S9;
    8::130     7e-14  34%  130 aa  RS9_VIBVU RecName: Full=30S ribosomal protein S9;
    9::134     7e-14  37%  134 aa  RS9_THEP1 RecName: Full=30S ribosomal protein S9;
    9::134     7e-14  37%  134 aa  RS9_THENN RecName: Full=30S ribosomal protein S9;
    8::130     7e-14  31%  130 aa  RS9_SHESW RecName: Full=30S ribosomal protein S9;
    8::130     7e-14  31%  130 aa  RS9_SHESR RecName: Full=30S ribosomal protein S9;
    8::130     7e-14  31%  130 aa  RS9_SHESM RecName: Full=30S ribosomal protein S9;
    8::130     7e-14  31%  130 aa  RS9_SHESA RecName: Full=30S ribosomal protein S9;
    8::130     7e-14  31%  130 aa  RS9_SHEPC RecName: Full=30S ribosomal protein S9;
    8::130     7e-14  31%  130 aa  RS9_SHEON RecName: Full=30S ribosomal protein S9;
    8::130     7e-14  32%  130 aa  RS9_SHELP RecName: Full=30S ribosomal protein S9;
    8::130     7e-14  33%  130 aa  RS9_SHEHH RecName: Full=30S ribosomal protein S9;
    8::130     7e-14  31%  130 aa  RS9_SHEB9 RecName: Full=30S ribosomal protein S9;
    8::130     7e-14  31%  130 aa  RS9_SHEB8 RecName: Full=30S ribosomal protein S9;
    8::130     7e-14  31%  130 aa  RS9_SHEB5 RecName: Full=30S ribosomal protein S9;
    8::130     7e-14  31%  130 aa  RS9_SHEB2 RecName: Full=30S ribosomal protein S9;
   33::161     7e-14  34%  161 aa  RS9_METRJ RecName: Full=30S ribosomal protein S9;
    7::130     7e-14  33%  130 aa  RS9_CLOBB RecName: Full=30S ribosomal protein S9;
   35::161     7e-14  32%  161 aa  RS9_BART1 RecName: Full=30S ribosomal protein S9;
   35::161     7e-14  34%  161 aa  RS9_BARBK RecName: Full=30S ribosomal protein S9;
   28::155     7e-14  34%  155 aa  RS9_AGRT5 RecName: Full=30S ribosomal protein S9;
    2::131     7e-14  32%  131 aa  RS9_ACTPJ RecName: Full=30S ribosomal protein S9;
    2::131     7e-14  32%  131 aa  RS9_ACTP7 RecName: Full=30S ribosomal protein S9;
    8::130     9e-14  33%  130 aa  RS9_SHEPA RecName: Full=30S ribosomal protein S9;
   32::158     9e-14  34%  158 aa  RS9_RHOP2 RecName: Full=30S ribosomal protein S9;
   22::128     9e-14  45%  128 aa  RS9_PORGI RecName: Full=30S ribosomal protein S9;
   22::128     9e-14  45%  128 aa  RS9_PORG3 RecName: Full=30S ribosomal protein S9;
   32::158     9e-14  34%  158 aa  RS9_NITHX RecName: Full=30S ribosomal protein S9;
   11::136     9e-14  35%  136 aa  RS9_METI4 RecName: Full=30S ribosomal protein S9;
    8::130     9e-14  34%  130 aa  RS9_EXIS2 RecName: Full=30S ribosomal protein S9;
    7::130     9e-14  34%  130 aa  RS9_CLOAB RecName: Full=30S ribosomal protein S9;
    8::130     9e-14  35%  130 aa  RS9_ALKMQ RecName: Full=30S ribosomal protein S9;
    8::130     1e-13  35%  130 aa  RS9_STRS2 RecName: Full=30S ribosomal protein S9;
    8::130     1e-13  33%  130 aa  RS9_SHEPW RecName: Full=30S ribosomal protein S9;
    8::130     1e-13  34%  130 aa  RS9_LACPL RecName: Full=30S ribosomal protein S9;
    7::130     1e-13  31%  130 aa  RS9_CLOB8 RecName: Full=30S ribosomal protein S9;
   35::161     1e-13  31%  161 aa  RS9_BARQU RecName: Full=30S ribosomal protein S9;
    8::130     1e-13  33%  130 aa  RS9_VARPS RecName: Full=30S ribosomal protein S9;
    8::130     1e-13  32%  130 aa  RS9_SACD2 RecName: Full=30S ribosomal protein S9;
   27::155     1e-13  32%  155 aa  RS9_RHIEC RecName: Full=30S ribosomal protein S9;
    8::130     1e-13  33%  130 aa  RS9_EUBR3 RecName: Full=30S ribosomal protein S9;
    2::133     1e-13  38%  133 aa  RS9_CHLAB RecName: Full=30S ribosomal protein S9;
    8::130     1e-13  33%  130 aa  RS9_BACP2 RecName: Full=30S ribosomal protein S9;
    8::130     1e-13  35%  130 aa  RS9_ALKOO RecName: Full=30S ribosomal protein S9;
    8::130     2e-13  33%  130 aa  RS9_STACT RecName: Full=30S ribosomal protein S9;
   32::158     2e-13  33%  158 aa  RS9_NITWN RecName: Full=30S ribosomal protein S9;
    8::130     2e-13  33%  130 aa  RS9_LACBA RecName: Full=30S ribosomal protein S9;
    8::130     2e-13  33%  130 aa  RS9_CLOPH RecName: Full=30S ribosomal protein S9;
   31::159     2e-13  33%  159 aa  RS9_BEII9 RecName: Full=30S ribosomal protein S9;
   22::128     2e-13  37%  128 aa  RS9_AMOA5 RecName: Full=30S ribosomal protein S9;
   25::134     3e-13  48%  134 aa  RS9_THELT RecName: Full=30S ribosomal protein S9;
    8::130     3e-13  33%  130 aa  RS9_LEPCP RecName: Full=30S ribosomal protein S9;
    8::130     3e-13  33%  130 aa  RS9_HERAR RecName: Full=30S ribosomal protein S9;
   22::129     3e-13  59%  129 aa  RS9_GEMAT RecName: Full=30S ribosomal protein S9;
   52::159     3e-13  36%  159 aa  RS9_BRAJA RecName: Full=30S ribosomal protein S9;
   35::161     3e-13  31%  161 aa  RS9_BARHE RecName: Full=30S ribosomal protein S9;
   22::128     3e-13  47%  128 aa  RS9_BACTN RecName: Full=30S ribosomal protein S9;
    2::131     3e-13  32%  131 aa  RS9_ACTP2 RecName: Full=30S ribosomal protein S9;
   51::158     3e-13  37%  158 aa  RS9_RHOP5 RecName: Full=30S ribosomal protein S9;
   13::136     3e-13  35%  136 aa  RS9_PROMA RecName: Full=30S ribosomal protein S9;
    2::130     3e-13  31%  130 aa  RS9_PASMU RecName: Full=30S ribosomal protein S9;
    8::130     3e-13  33%  130 aa  RS9_DELAS RecName: Full=30S ribosomal protein S9;
    8::130     3e-13  32%  130 aa  RS9_CELJU RecName: Full=30S ribosomal protein S9;
    8::130     3e-13  31%  130 aa  RS9_BORA1 RecName: Full=30S ribosomal protein S9;
   14::137     3e-13  37%  137 aa  RR9_GRATL RecName: Full=30S ribosomal protein S9, chloroplastic;
  217::323     4e-13  36%  323 aa  RT09_DEBHA RecName: Full=40S ribosomal protein S9,
   27::155     4e-13  33%  155 aa  RS9_RHISN RecName: Full=30S ribosomal protein S9;
   14::137     4e-13  34%  137 aa  RS9_PROM4 RecName: Full=30S ribosomal protein S9;
   12::135     4e-13  34%  135 aa  RS9_PROM3 RecName: Full=30S ribosomal protein S9;
    9::135     4e-13  39%  135 aa  RS9_PETMO RecName: Full=30S ribosomal protein S9;
    8::130     4e-13  31%  130 aa  RS9_MARMS RecName: Full=30S ribosomal protein S9;
    8::130     4e-13  33%  130 aa  RS9_GEOUR RecName: Full=30S ribosomal protein S9;
    8::130     4e-13  33%  130 aa  RS9_CLOBM RecName: Full=30S ribosomal protein S9;
    8::130     4e-13  33%  130 aa  RS9_CLOBL RecName: Full=30S ribosomal protein S9;
    8::130     4e-13  33%  130 aa  RS9_CLOBK RecName: Full=30S ribosomal protein S9;
    8::130     4e-13  33%  130 aa  RS9_CLOBJ RecName: Full=30S ribosomal protein S9;
    8::130     4e-13  33%  130 aa  RS9_CLOBH RecName: Full=30S ribosomal protein S9;
    8::130     4e-13  33%  130 aa  RS9_CLOB6 RecName: Full=30S ribosomal protein S9;
    8::130     4e-13  33%  130 aa  RS9_CLOB1 RecName: Full=30S ribosomal protein S9;
   23::130     4e-13  39%  130 aa  RS9_ANASK RecName: Full=30S ribosomal protein S9;
   23::130     4e-13  39%  130 aa  RS9_ANADE RecName: Full=30S ribosomal protein S9;
   23::130     4e-13  39%  130 aa  RS9_ANAD2 RecName: Full=30S ribosomal protein S9;
    8::130     6e-13  36%  130 aa  RS9_STRGC RecName: Full=30S ribosomal protein S9;
   31::159     6e-13  33%  159 aa  RS9_METSB RecName: Full=30S ribosomal protein S9;
   34::162     6e-13  32%  162 aa  RS9_METS4 RecName: Full=30S ribosomal protein S9;
    8::130     6e-13  34%  130 aa  RS9_LACSS RecName: Full=30S ribosomal protein S9;
    8::130     6e-13  29%  130 aa  RS9_BORPD RecName: Full=30S ribosomal protein S9;
   22::128     6e-13  35%  128 aa  RS9_BACV8 RecName: Full=30S ribosomal protein S9;
   33::161     7e-13  32%  161 aa  RS9_METEP RecName: Full=30S ribosomal protein S9;
   33::161     7e-13  32%  161 aa  RS9_METC4 RecName: Full=30S ribosomal protein S9;
    8::130     7e-13  34%  130 aa  RS9_DESMR RecName: Full=30S ribosomal protein S9;
   34::160     1e-12  32%  160 aa  RS9_RHILO RecName: Full=30S ribosomal protein S9;
   24::131     1e-12  34%  131 aa  RS9_MYCGA RecName: Full=30S ribosomal protein S9;
    8::130     1e-12  31%  130 aa  RS9_DIAST RecName: Full=30S ribosomal protein S9;
    8::130     1e-12  29%  130 aa  RS9_BORBR RecName: Full=30S ribosomal protein S9;
    8::130     1e-12  31%  130 aa  RS9_ACISJ RecName: Full=30S ribosomal protein S9;
    8::130     1e-12  35%  130 aa  RS9_STRSV RecName: Full=30S ribosomal protein S9;
    8::130     1e-12  30%  130 aa  RS9_SHEAM RecName: Full=30S ribosomal protein S9;
   12::135     1e-12  33%  135 aa  RS9_PROMM RecName: Full=30S ribosomal protein S9;
    6::130     1e-12  30%  130 aa  RS9_NITMU RecName: Full=30S ribosomal protein S9;
    2::130     1e-12  32%  130 aa  RS9_NITEC RecName: Full=30S ribosomal protein S9;
    8::130     1e-12  41%  130 aa  RS9_FINM2 RecName: Full=30S ribosomal protein S9;
    8::130     2e-12  33%  130 aa  RS9_TERTT RecName: Full=30S ribosomal protein S9;
    8::130     2e-12  31%  130 aa  RS9_RHOFD RecName: Full=30S ribosomal protein S9;
   34::162     2e-12  31%  162 aa  RS9_METNO RecName: Full=30S ribosomal protein S9;
   10::133     2e-12  33%  133 aa  RS9_SYNS9 RecName: Full=30S ribosomal protein S9;
    8::130     2e-12  36%  130 aa  RS9_PHYAS RecName: Full=30S ribosomal protein S9;
    8::130     2e-12  36%  130 aa  RS9_PELTS RecName: Full=30S ribosomal protein S9;
    8::130     2e-12  32%  130 aa  RS9_JANMA RecName: Full=30S ribosomal protein S9;
   23::130     2e-12  38%  130 aa  RS9_DESPS RecName: Full=30S ribosomal protein S9;
    8::130     2e-12  29%  130 aa  RS9_BORPE RecName: Full=30S ribosomal protein S9;
   10::133     3e-12  33%  133 aa  RS9_SYNSC RecName: Full=30S ribosomal protein S9;
   12::135     3e-12  33%  135 aa  RS9_SYNS3 RecName: Full=30S ribosomal protein S9;
    8::130     3e-12  31%  130 aa  RS9_METPP RecName: Full=30S ribosomal protein S9;
    8::130     3e-12  29%  130 aa  RS9_BURPS RecName: Full=30S ribosomal protein S9;
    8::130     3e-12  30%  130 aa  RS9_BUCAT RecName: Full=30S ribosomal protein S9;
    8::130     4e-12  32%  130 aa  RS9_STAAW RecName: Full=30S ribosomal protein S9;
   10::132     4e-12  32%  132 aa  RS9_STAAT RecName: Full=30S ribosomal protein S9;
    8::130     4e-12  32%  130 aa  RS9_STAAS RecName: Full=30S ribosomal protein S9;
    8::130     4e-12  32%  130 aa  RS9_STAAR RecName: Full=30S ribosomal protein S9;
    8::130     4e-12  32%  130 aa  RS9_STAAN RecName: Full=30S ribosomal protein S9;
    8::130     4e-12  32%  130 aa  RS9_STAAM RecName: Full=30S ribosomal protein S9;
    8::130     4e-12  32%  130 aa  RS9_STAAE RecName: Full=30S ribosomal protein S9;
   10::132     4e-12  32%  132 aa  RS9_STAAC RecName: Full=30S ribosomal protein S9;
   10::132     4e-12  32%  132 aa  RS9_STAAB RecName: Full=30S ribosomal protein S9;
    8::130     4e-12  32%  130 aa  RS9_STAA9 RecName: Full=30S ribosomal protein S9;
   10::132     4e-12  32%  132 aa  RS9_STAA8 RecName: Full=30S ribosomal protein S9;
   10::132     4e-12  32%  132 aa  RS9_STAA3 RecName: Full=30S ribosomal protein S9;
    8::130     4e-12  32%  130 aa  RS9_STAA2 RecName: Full=30S ribosomal protein S9;
    8::130     4e-12  32%  130 aa  RS9_STAA1 RecName: Full=30S ribosomal protein S9;
    8::130     4e-12  29%  130 aa  RS9_RALME RecName: Full=30S ribosomal protein S9;
    8::134     4e-12  34%  134 aa  RS9_KOSOT RecName: Full=30S ribosomal protein S9;
    8::130     4e-12  30%  130 aa  RS9_BUCAI RecName: Full=30S ribosomal protein S9;
    8::130     4e-12  30%  130 aa  RS9_BUCA5 RecName: Full=30S ribosomal protein S9;
    8::130     4e-12  29%  130 aa  RS9_BORPA RecName: Full=30S ribosomal protein S9;
   10::133     5e-12  33%  133 aa  RS9_SYNPX RecName: Full=30S ribosomal protein S9;
    8::130     5e-12  41%  130 aa  RS9_PELPD RecName: Full=30S ribosomal protein S9;
    8::130     5e-12  33%  130 aa  RS9_COLP3 RecName: Full=30S ribosomal protein S9;
    4::134     5e-12  39%  134 aa  RS9_CHLPN RecName: Full=30S ribosomal protein S9;
    8::130     6e-12  31%  130 aa  RS9_VEREI RecName: Full=30S ribosomal protein S9;
    8::130     6e-12  32%  130 aa  RS9_STAHJ RecName: Full=30S ribosomal protein S9;
   29::157     6e-12  33%  157 aa  RS9_CAUSK RecName: Full=30S ribosomal protein S9;
   29::157     6e-12  33%  157 aa  RS9_CAUCR RecName: Full=30S ribosomal protein S9;
   29::157     6e-12  33%  157 aa  RS9_CAUCN RecName: Full=30S ribosomal protein S9;
    8::130     6e-12  29%  130 aa  RS9_BURVG RecName: Full=30S ribosomal protein S9;
    8::130     6e-12  29%  130 aa  RS9_BURS3 RecName: Full=30S ribosomal protein S9;
    8::130     6e-12  29%  130 aa  RS9_BURCJ RecName: Full=30S ribosomal protein S9;
    8::130     6e-12  29%  130 aa  RS9_BURCH RecName: Full=30S ribosomal protein S9;
    8::130     6e-12  29%  130 aa  RS9_BURCC RecName: Full=30S ribosomal protein S9;
    8::130     6e-12  29%  130 aa  RS9_BURCA RecName: Full=30S ribosomal protein S9;
   26::132     6e-12  34%  132 aa  RS9_BAUCH RecName: Full=30S ribosomal protein S9;
    8::130     8e-12  29%  130 aa  RS9_THIDA RecName: Full=30S ribosomal protein S9;
    8::130     8e-12  29%  130 aa  RS9_RALPJ RecName: Full=30S ribosomal protein S9;
    8::130     8e-12  29%  130 aa  RS9_BURXL RecName: Full=30S ribosomal protein S9;
    8::130     8e-12  29%  130 aa  RS9_BURPP RecName: Full=30S ribosomal protein S9;
    8::130     1e-11  30%  130 aa  RS9_PSEA7 RecName: Full=30S ribosomal protein S9;
   23::130     1e-11  44%  130 aa  RS9_PELCD RecName: Full=30S ribosomal protein S9;
    8::130     1e-11  28%  130 aa  RS9_NEIMF RecName: Full=30S ribosomal protein S9;
    8::130     1e-11  28%  130 aa  RS9_NEIMB RecName: Full=30S ribosomal protein S9;
    8::130     1e-11  28%  130 aa  RS9_NEIMA RecName: Full=30S ribosomal protein S9;
    8::130     1e-11  28%  130 aa  RS9_NEIM0 RecName: Full=30S ribosomal protein S9;
    9::133     1e-11  40%  133 aa  RS9_CHLMU RecName: Full=30S ribosomal protein S9;
    8::130     1e-11  28%  130 aa  RS9_BURP6 RecName: Full=30S ribosomal protein S9;
    8::130     1e-11  28%  130 aa  RS9_BURP1 RecName: Full=30S ribosomal protein S9;
    8::130     1e-11  28%  130 aa  RS9_BURP0 RecName: Full=30S ribosomal protein S9;
    8::130     1e-11  28%  130 aa  RS9_BURMS RecName: Full=30S ribosomal protein S9;
    8::130     1e-11  28%  130 aa  RS9_BURMA RecName: Full=30S ribosomal protein S9;
    8::130     1e-11  28%  130 aa  RS9_BURM9 RecName: Full=30S ribosomal protein S9;
    8::130     1e-11  28%  130 aa  RS9_BURM7 RecName: Full=30S ribosomal protein S9;
    8::130     1e-11  30%  130 aa  RS9_BUCBP RecName: Full=30S ribosomal protein S9;
    8::130     1e-11  31%  130 aa  RS9_STAES RecName: Full=30S ribosomal protein S9;
    8::130     1e-11  31%  130 aa  RS9_STAEQ RecName: Full=30S ribosomal protein S9;
    5::129     1e-11  40%  129 aa  RS9_CHLTR RecName: Full=30S ribosomal protein S9;
    5::129     1e-11  40%  129 aa  RS9_CHLTA RecName: Full=30S ribosomal protein S9;
    8::130     2e-11  33%  130 aa  RS9_STRPZ RecName: Full=30S ribosomal protein S9;
    8::130     2e-11  33%  130 aa  RS9_STRPM RecName: Full=30S ribosomal protein S9;
    8::130     2e-11  33%  130 aa  RS9_STRPG RecName: Full=30S ribosomal protein S9;
    8::130     2e-11  33%  130 aa  RS9_STRPF RecName: Full=30S ribosomal protein S9;
    8::130     2e-11  33%  130 aa  RS9_STRPD RecName: Full=30S ribosomal protein S9;
    8::130     2e-11  33%  130 aa  RS9_STRPC RecName: Full=30S ribosomal protein S9;
    8::130     2e-11  33%  130 aa  RS9_STRPB RecName: Full=30S ribosomal protein S9;
    8::130     2e-11  33%  130 aa  RS9_STRP8 RecName: Full=30S ribosomal protein S9;
    8::130     2e-11  33%  130 aa  RS9_STRP6 RecName: Full=30S ribosomal protein S9;
    8::130     2e-11  33%  130 aa  RS9_STRP3 RecName: Full=30S ribosomal protein S9;
    8::130     2e-11  33%  130 aa  RS9_STRP1 RecName: Full=30S ribosomal protein S9;
    8::130     2e-11  32%  130 aa  RS9_STAS1 RecName: Full=30S ribosomal protein S9;
   57::164     2e-11  32%  164 aa  RS9_RICBR RecName: Full=30S ribosomal protein S9;
   57::164     2e-11  32%  164 aa  RS9_RICB8 RecName: Full=30S ribosomal protein S9;
    5::129     2e-11  40%  129 aa  RS9_CHLTB RecName: Full=30S ribosomal protein S9;
    5::129     2e-11  40%  129 aa  RS9_CHLT2 RecName: Full=30S ribosomal protein S9;
    8::130     2e-11  28%  130 aa  RS9_BURP8 RecName: Full=30S ribosomal protein S9;
    8::130     2e-11  28%  130 aa  RS9_BURM1 RecName: Full=30S ribosomal protein S9;
    9::136     2e-11  30%  136 aa  RS9_BORBZ RecName: Full=30S ribosomal protein S9;
    9::136     2e-11  30%  136 aa  RS9_BORBU RecName: Full=30S ribosomal protein S9;
    9::136     2e-11  30%  136 aa  RS9_BORAP RecName: Full=30S ribosomal protein S9;
   28::154     2e-11  35%  154 aa  RS9_AZOC5 RecName: Full=30S ribosomal protein S9;
    8::130     2e-11  29%  130 aa  RS9_ACIAC RecName: Full=30S ribosomal protein S9;
    8::130     2e-11  35%  130 aa  RS9_ONYPE RecName: Full=30S ribosomal protein S9;
   32::160     2e-11  33%  160 aa  RS9_HYPNA RecName: Full=30S ribosomal protein S9;
    8::130     2e-11  28%  130 aa  RS9_CUPTR RecName: Full=30S ribosomal protein S9;
    8::130     2e-11  28%  130 aa  RS9_BURTA RecName: Full=30S ribosomal protein S9;
  230::336     3e-11  35%  336 aa  RT09_CANAL RecName: Full=40S ribosomal protein S9,
    8::130     3e-11  28%  130 aa  RS9_RALEH RecName: Full=30S ribosomal protein S9;
    8::130     3e-11  28%  130 aa  RS9_NEIG2 RecName: Full=30S ribosomal protein S9;
    8::130     3e-11  28%  130 aa  RS9_NEIG1 RecName: Full=30S ribosomal protein S9;
   11::133     3e-11  30%  133 aa  RS9_DEIDV RecName: Full=30S ribosomal protein S9;
    8::130     4e-11  28%  130 aa  RS9_RALEJ RecName: Full=30S ribosomal protein S9;
    8::130     4e-11  28%  130 aa  RS9_BURCM RecName: Full=30S ribosomal protein S9;
    8::130     4e-11  28%  130 aa  RS9_BURA4 RecName: Full=30S ribosomal protein S9;
    3::128     4e-11  33%  128 aa  RR9_CYACA RecName: Full=30S ribosomal protein S9, chloroplastic;
   26::133     5e-11  33%  133 aa  RS9_UREU1 RecName: Full=30S ribosomal protein S9;
   26::133     5e-11  32%  133 aa  RS9_UREPA RecName: Full=30S ribosomal protein S9;
   26::133     5e-11  32%  133 aa  RS9_UREP2 RecName: Full=30S ribosomal protein S9;
    8::130     5e-11  34%  130 aa  RS9_DESAP RecName: Full=30S ribosomal protein S9;
    8::130     7e-11  28%  130 aa  RS9_RALSO RecName: Full=30S ribosomal protein S9;
    8::130     7e-11  28%  130 aa  RS9_POLNA RecName: Full=30S ribosomal protein S9;
   14::137     7e-11  35%  137 aa  RR9_PORYE RecName: Full=30S ribosomal protein S9, chloroplastic;
   11::134     7e-11  34%  134 aa  RR9_CYAPA RecName: Full=30S ribosomal protein S9, cyanelle;
  152::278     9e-11  39%  278 aa  RT09_YEAST RecName: Full=37S ribosomal protein S9,
    8::130     9e-11  29%  130 aa  RS9_PSEAE RecName: Full=30S ribosomal protein S9;
    8::130     9e-11  29%  130 aa  RS9_PSEAB RecName: Full=30S ribosomal protein S9;
    8::130     9e-11  29%  130 aa  RS9_PSEA8 RecName: Full=30S ribosomal protein S9;
    8::130     9e-11  33%  130 aa  RS9_GEOKA RecName: Full=30S ribosomal protein S9;
    9::131     9e-11  41%  131 aa  RS9_DESHY RecName: Full=30S ribosomal protein S9;
    9::131     9e-11  41%  131 aa  RS9_DESHD RecName: Full=30S ribosomal protein S9;
   24::130     9e-11  38%  130 aa  RS9_DESAD RecName: Full=30S ribosomal protein S9;
    8::130     9e-11  29%  130 aa  RS9_CHRVO RecName: Full=30S ribosomal protein S9;
    9::136     9e-11  29%  136 aa  RS9_BORGA RecName: Full=30S ribosomal protein S9;
   13::138     9e-11  34%  138 aa  RR9_PHATR RecName: Full=30S ribosomal protein S9, chloroplastic;
   31::138     9e-11  38%  138 aa  RR9_ODOSI RecName: Full=30S ribosomal protein S9, chloroplastic;
    8::130     1e-10  28%  130 aa  RS9_POLSJ RecName: Full=30S ribosomal protein S9;
    9::131     1e-10  31%  131 aa  RS9_MESFL RecName: Full=30S ribosomal protein S9;
    8::130     1e-10  28%  130 aa  RS9_BUCAP RecName: Full=30S ribosomal protein S9;
   14::137     1e-10  34%  137 aa  RR9_PORPU RecName: Full=30S ribosomal protein S9, chloroplastic;
   22::127     1e-10  46%  127 aa  RR9_OSTTA RecName: Full=30S ribosomal protein S9, chloroplastic;
   23::131     1e-10  36%  131 aa  RR9_EMIHU RecName: Full=30S ribosomal protein S9, chloroplastic;
   25::132     2e-10  35%  132 aa  RS9_LEPBL RecName: Full=30S ribosomal protein S9;
   25::132     2e-10  35%  132 aa  RS9_LEPBJ RecName: Full=30S ribosomal protein S9;
    8::130     2e-10  31%  130 aa  RS9_BLOFL RecName: Full=30S ribosomal protein S9;
    8::130     2e-10  33%  130 aa  RS9_AYWBP RecName: Full=30S ribosomal protein S9;
  215::319     2e-10  35%  319 aa  RT09_YARLI RecName: Full=40S ribosomal protein S9,
    8::130     2e-10  33%  130 aa  RS9_OENOB RecName: Full=30S ribosomal protein S9;
   11::133     2e-10  29%  133 aa  RS9_DEIRA RecName: Full=30S ribosomal protein S9;
   10::134     2e-10  35%  134 aa  RR9_THAPS RecName: Full=30S ribosomal protein S9, chloroplastic;
  188::314     3e-10  41%  314 aa  RT09_NEUCR RecName: Full=40S ribosomal protein S9,
  182::288     3e-10  42%  288 aa  RT09_CANGA RecName: Full=40S ribosomal protein S9,
    8::130     4e-10  31%  130 aa  RS9_PSEA6 RecName: Full=30S ribosomal protein S9;
   32::132     6e-10  33%  132 aa  RS9_BLOPB RecName: Full=30S ribosomal protein S9;
    1::125     6e-10  41%  125 aa  RR9_OLTVI RecName: Full=30S ribosomal protein S9, chloroplastic;
  173::279     8e-10  32%  279 aa  RT09_ASHGO RecName: Full=40S ribosomal protein S9,
    6::129     8e-10  29%  129 aa  RS9_TREPS RecName: Full=30S ribosomal protein S9;
    6::129     8e-10  29%  129 aa  RS9_TREPA RecName: Full=30S ribosomal protein S9;
    8::130     8e-10  33%  130 aa  RS9_TOLAT RecName: Full=30S ribosomal protein S9;
    8::130     8e-10  28%  130 aa  RS9_HALHL RecName: Full=30S ribosomal protein S9;
   10::133     1e-09  33%  133 aa  RS9_GLOVI RecName: Full=30S ribosomal protein S9;
   28::137     1e-09  37%  137 aa  RR9_CHLVU RecName: Full=30S ribosomal protein S9, chloroplastic;
    8::130     1e-09  31%  130 aa  RS9_LACS1 RecName: Full=30S ribosomal protein S9;
    8::130     2e-09  33%  130 aa  RS9_ALISL RecName: Full=30S ribosomal protein S9;
    8::130     2e-09  33%  130 aa  RS9_VIBSL RecName: Full=30S ribosomal protein S9;
    8::130     3e-09  30%  130 aa  RS9_PSEPK RecName: Full=30S ribosomal protein S9;
    8::130     3e-09  30%  130 aa  RS9_PSEPG RecName: Full=30S ribosomal protein S9;
    8::130     3e-09  30%  130 aa  RS9_PSEP1 RecName: Full=30S ribosomal protein S9;
    8::130     3e-09  30%  130 aa  RS9_PSEE4 RecName: Full=30S ribosomal protein S9;
    8::130     3e-09  30%  130 aa  RS9_DESRM RecName: Full=30S ribosomal protein S9;
    8::130     4e-09  33%  130 aa  RS9_VIBFM RecName: Full=30S ribosomal protein S9;
    8::130     4e-09  33%  130 aa  RS9_VIBF1 RecName: Full=30S ribosomal protein S9;
   10::132     5e-09  28%  132 aa  RS9_MYCHJ RecName: Full=30S ribosomal protein S9;
   10::132     5e-09  28%  132 aa  RS9_MYCH7 RecName: Full=30S ribosomal protein S9;
   10::132     5e-09  28%  132 aa  RS9_MYCH2 RecName: Full=30S ribosomal protein S9;
    9::136     5e-09  38%  136 aa  RS9_BORDL RecName: Full=30S ribosomal protein S9;
   33::141     5e-09  35%  141 aa  RR9_PSEAK RecName: Full=30S ribosomal protein S9, chloroplastic;
  166::292     6e-09  28%  292 aa  RT09_KLUMA RecName: Full=40S ribosomal protein S9,
    2::130     6e-09  29%  130 aa  RS9_THISH RecName: Full=30S ribosomal protein S9;
   22::129     6e-09  36%  129 aa  RS9_NITSB RecName: Full=30S ribosomal protein S9;
   22::128     6e-09  42%  128 aa  RS9_GRAFK RecName: Full=30S ribosomal protein S9;
    8::130     6e-09  33%  130 aa  RS9_BREBN RecName: Full=30S ribosomal protein S9;
   13::136     6e-09  37%  136 aa  RS9_BORHD RecName: Full=30S ribosomal protein S9;
    8::130     8e-09  29%  130 aa  RS9_PSEPW RecName: Full=30S ribosomal protein S9;
    8::130     8e-09  29%  130 aa  RS9_MACCJ RecName: Full=30S ribosomal protein S9;
  171::297     1e-08  28%  297 aa  RT09_KLULA RecName: Full=40S ribosomal protein S9,
   22::128     1e-08  33%  128 aa  RS9_FLAPJ RecName: Full=30S ribosomal protein S9;
    8::130     1e-08  29%  130 aa  RS9_BACWK RecName: Full=30S ribosomal protein S9;
   24::131     1e-08  30%  131 aa  RS9_MYCS5 RecName: Full=30S ribosomal protein S9;
   13::136     2e-08  36%  136 aa  RS9_BORT9 RecName: Full=30S ribosomal protein S9;
   52::147     2e-08  33%  147 aa  RS9_AQUAE RecName: Full=30S ribosomal protein S9;
   23::130     2e-08  34%  130 aa  RS9_SYNFM RecName: Full=30S ribosomal protein S9;
   22::111     2e-08  38%  129 aa  RS9_CHLPD RecName: Full=30S ribosomal protein S9;
    2::130     3e-08  27%  130 aa  RS9_STRMK RecName: Full=30S ribosomal protein S9;
    2::130     3e-08  27%  130 aa  RS9_STRM5 RecName: Full=30S ribosomal protein S9;
    9::132     3e-08  28%  132 aa  RS9_DEHE1 RecName: Full=30S ribosomal protein S9;
    9::136     4e-08  37%  136 aa  RS9_BORRA RecName: Full=30S ribosomal protein S9;
    8::130     5e-08  28%  130 aa  RS9_XYLFM RecName: Full=30S ribosomal protein S9;
    2::130     5e-08  27%  130 aa  RS9_XANOR RecName: Full=30S ribosomal protein S9;
    2::130     5e-08  27%  130 aa  RS9_XANOP RecName: Full=30S ribosomal protein S9;
    2::130     5e-08  27%  130 aa  RS9_XANOM RecName: Full=30S ribosomal protein S9;
    2::130     5e-08  27%  130 aa  RS9_XANCP RecName: Full=30S ribosomal protein S9;
    2::130     5e-08  27%  130 aa  RS9_XANCB RecName: Full=30S ribosomal protein S9;
    2::130     5e-08  27%  130 aa  RS9_XANC8 RecName: Full=30S ribosomal protein S9;
   63::159     5e-08  30%  159 aa  RS9_RICRS RecName: Full=30S ribosomal protein S9;
   63::159     5e-08  30%  159 aa  RS9_RICRO RecName: Full=30S ribosomal protein S9;
   65::161     5e-08  30%  161 aa  RS9_RICFE RecName: Full=30S ribosomal protein S9;
   65::161     5e-08  30%  161 aa  RS9_RICAH RecName: Full=30S ribosomal protein S9;
    9::132     5e-08  28%  132 aa  RS9_DEHSC RecName: Full=30S ribosomal protein S9;
    9::132     5e-08  28%  132 aa  RS9_DEHSB RecName: Full=30S ribosomal protein S9;
    6::114     7e-08  28%  132 aa  RT09_SCHPO RecName: Full=40S ribosomal protein S9,
    8::130     7e-08  28%  130 aa  RS9_XYLFA RecName: Full=30S ribosomal protein S9;
    2::130     7e-08  27%  130 aa  RS9_XANC5 RecName: Full=30S ribosomal protein S9;
    2::130     7e-08  27%  130 aa  RS9_XANAC RecName: Full=30S ribosomal protein S9;
    8::130     7e-08  30%  130 aa  RS9_THICR RecName: Full=30S ribosomal protein S9;
   22::111     9e-08  36%  129 aa  RS9_CHLL2 RecName: Full=30S ribosomal protein S9;
   41::129     1e-07  33%  129 aa  RS9_WIGBR RecName: Full=30S ribosomal protein S9;
   21::129     1e-07  35%  129 aa  RS9_SULNB RecName: Full=30S ribosomal protein S9;
   21::129     1e-07  31%  129 aa  RS9_SULDN RecName: Full=30S ribosomal protein S9;
   35::161     1e-07  31%  161 aa  RS9_RHOCS RecName: Full=30S ribosomal protein S9;
   63::159     2e-07  29%  159 aa  RS9_RICPU RecName: Full=30S ribosomal protein S9;
   63::159     2e-07  30%  159 aa  RS9_RICM5 RecName: Full=30S ribosomal protein S9;
   63::159     2e-07  29%  159 aa  RS9_RICCN RecName: Full=30S ribosomal protein S9;
   21::129     2e-07  32%  129 aa  RS9_CAMJR RecName: Full=30S ribosomal protein S9;
   21::129     2e-07  32%  129 aa  RS9_CAMJJ RecName: Full=30S ribosomal protein S9;
   21::129     2e-07  32%  129 aa  RS9_CAMJE RecName: Full=30S ribosomal protein S9;
   21::129     2e-07  32%  129 aa  RS9_CAMJD RecName: Full=30S ribosomal protein S9;
   21::129     2e-07  32%  129 aa  RS9_CAMJ8 RecName: Full=30S ribosomal protein S9;
    8::130     2e-07  27%  130 aa  RS9_XYLFT RecName: Full=30S ribosomal protein S9;
    8::130     2e-07  27%  130 aa  RS9_XYLF2 RecName: Full=30S ribosomal protein S9;
   63::159     2e-07  29%  159 aa  RS9_RICAE RecName: Full=30S ribosomal protein S9;
   32::139     2e-07  31%  139 aa  RS9_LEPIN RecName: Full=30S ribosomal protein S9;
   32::139     2e-07  31%  139 aa  RS9_LEPIC RecName: Full=30S ribosomal protein S9;
    9::133     2e-07  28%  133 aa  RS9_FUSNN RecName: Full=30S ribosomal protein S9;
    2::133     3e-07  34%  133 aa  RS9_CHLFF RecName: Full=30S ribosomal protein S9;
   65::161     4e-07  29%  161 aa  RS9_RICCK RecName: Full=30S ribosomal protein S9;
   22::129     4e-07  32%  129 aa  RS9_PELLD RecName: Full=30S ribosomal protein S9;
   21::129     4e-07  32%  129 aa  RS9_HELP2 RecName: Full=30S ribosomal protein S9;
   66::161     5e-07  31%  161 aa  RS9_RICPR RecName: Full=30S ribosomal protein S9;
   23::130     5e-07  29%  130 aa  RS9_MYCMO RecName: Full=30S ribosomal protein S9;
   21::129     5e-07  32%  129 aa  RS9_HELPS RecName: Full=30S ribosomal protein S9;
   22::129     5e-07  32%  129 aa  RS9_HELHP RecName: Full=30S ribosomal protein S9;
   66::161     6e-07  31%  161 aa  RS9_RICTY RecName: Full=30S ribosomal protein S9;
   21::129     6e-07  32%  129 aa  RS9_HELPY RecName: Full=30S ribosomal protein S9;
   21::129     6e-07  32%  129 aa  RS9_HELPJ RecName: Full=30S ribosomal protein S9;
   21::129     6e-07  32%  129 aa  RS9_HELPG RecName: Full=30S ribosomal protein S9;
   21::129     8e-07  32%  129 aa  RS9_HELAH RecName: Full=30S ribosomal protein S9;
   23::130     8e-07  33%  130 aa  RS9_DESOH RecName: Full=30S ribosomal protein S9;
   22::111     1e-06  33%  129 aa  RS9_CHLCH RecName: Full=30S ribosomal protein S9;
   21::129     2e-06  30%  129 aa  RS9_WOLSU RecName: Full=30S ribosomal protein S9;
   22::129     2e-06  32%  129 aa  RS9_CAMLR RecName: Full=30S ribosomal protein S9;
   22::129     2e-06  31%  129 aa  RS9_PROVI RecName: Full=30S ribosomal protein S9;
   27::134     3e-06  30%  134 aa  RR9_EUGGR RecName: Full=30S ribosomal protein S9, chloroplastic;
   21::129     4e-06  31%  129 aa  RS9_HELPH RecName: Full=30S ribosomal protein S9;
   22::129     7e-06  41%  129 aa  RS9_ARCB4 RecName: Full=30S ribosomal protein S9;
   28::132     9e-06  27%  132 aa  RS9_MYCPN RecName: Full=30S ribosomal protein S9;
   22::129     9e-06  36%  129 aa  RS9_CHLP8 RecName: Full=30S ribosomal protein S9;
    2::134     2e-05  35%  134 aa  RS9_CHLCV RecName: Full=30S ribosomal protein S9;
   30::136     4e-05  23%  136 aa  RS9_MYCPU RecName: Full=30S ribosomal protein S9;
  289::375     6e-05  28%  396 aa  RT09_HUMAN RecName: Full=28S ribosomal protein S9, mitochondrial;  
   28::132     7e-05  25%  132 aa  RS9_MYCGE RecName: Full=30S ribosomal protein S9;
   22::128     7e-05  36%  128 aa  RS9_CYTH3 RecName: Full=30S ribosomal protein S9;
   22::74      7e-05  32%  129 aa  RS9_CHLTE RecName: Full=30S ribosomal protein S9;
   27::134     1e-04  27%  134 aa  RR9_NEPOL RecName: Full=30S ribosomal protein S9, chloroplastic;
  289::375     1e-04  29%  396 aa  RT09_BOVIN RecName: Full=28S ribosomal protein S9, mitochondrial;  
   27::142     4e-04  30%  142 aa  RR9_STIHE RecName: Full=30S ribosomal protein S9, chloroplastic;
    1::169

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVEPTGIEDVQEYDENSXXXXXXXXXXXXXXVGETYIPTAVGPSLGTGXXXXXXXXXXXXPGTGEWKING
RS9_THEFY       MVEPTGIEDVQEYDENSXXXXXXXXXXXXXXVGETYIPTAVGPSLGTGXXXXXXXXXXXXPGTGEWKING
RS9_NOCSJ       -------------------------------------PATIAPANATGRRKEAVARVRLVPGTGEWTVNG
RS9_STRGG       ------------------------------------------PAAGLGRRKNAIARVRIVPGTGKWKING
RS9_STRAW       ------------------------------------------PAAGLGRRKNAIARVRIVPGTGKWKING
RS9_PROAC       --------------------------------GDSKRPAMIAPGAATGRRKEAIARVRIIPGSGQWKING
RS9_STRCO       ------------------------------------------PAAGLGRRKNAIARVRIVPGTGKWKVNG
RS9_RENSM       ------------------------------------------------------------PGTGKWIVNG
RS9_KINRD       ----------------------------------------IAPGGATGRRKEAVARVRIVPGTGKWTING
RS9_ARTCA       ------------------------------------------------------------PGSGKWTING
RS9_BIFA0       --------------------------------------STIAPGYGTGRRKEAVARVRLVPGTGEWKING
RS9_ARTAT       ------------------------------------------------------------PGSGKWTING
RS9_ARTS2       ------------------------------------------------------------PGSGKWIING
RS9_MYCMM       ------------------------------------------------------------PGSGKFDLNG
RS9_NOCFA       ----------------------------------TYAPVVIDRPVQTGRRKEAVVRVRLVPGTGQFVLNG
RS9_MYCS2       ------------------------------------------------------------PGTGQFNLDG
RS9_SACEN       ------------------------------------------------------------PGNGGFKLNG
RS9_BIFLO       --------------------------------------SAIEPGYGTGRRKEAVARVRLVPGDGKWTING
RS9_BIFLI       --------------------------------------SAIEPGYGTGRRKEAVARVRLVPGDGKWTING
RS9_BIFLD       --------------------------------------SAIEPGYGTGRRKEAVARVRLVPGDGKWTING
RS9_MYCLE       -------------------------------------------------------------GTGKFDLNG
RS9_MYCLB       -------------------------------------------------------------GTGKFDLNG
RS9_MYCA1       ------------------------------------------------------------PGTGKFNLNG
RS9_MYCPA       ------------------------------------------------------------PGTGKFNLNG
RS9_RHOOB       ------------------------------------------------------------PGSGDFKLNG
RS9_RHOE4       ------------------------------------------------------------PGTGQFKLNG
RS9_MYCUA       ------------------------------------------------------------PGSGKFDLNG
RS9_MYCSS       ------------------------------------------------------------PGTGKFNLDG
RS9_MYCSK       ------------------------------------------------------------PGTGKFNLDG
RS9_MYCSJ       ------------------------------------------------------------PGTGKFNLDG
RS9_LEIXX       ------------------------------------------------------------PGAGAVTVNG
RS9_BIFAA       ---------------------------------------------GTGRRKEAVARVRLVPGTGKWTING
RS9_SALTO       ------------------------------------------------------------PGTGKITCNG
RS9_CORGL       -------------------------------------------------------------GSGEFKCNG
RS9_CORGB       -------------------------------------------------------------GSGEFKCNG
RS9_SALAI       ------------------------------------------------------------PGSGRITCNG
RS9_CLAMS       ------------------------------------------------------------PGSGSITVNG
RS9_CLAM3       ------------------------------------------------------------PGSGSITVNG
RS9_MYCTU       ------------------------------------------------------------PGTGKFDLNG
RS9_MYCTA       ------------------------------------------------------------PGTGKFDLNG
RS9_MYCBT       ------------------------------------------------------------PGTGKFDLNG
RS9_MYCBP       ------------------------------------------------------------PGTGKFDLNG
RS9_MYCBO       ------------------------------------------------------------PGTGKFDLNG
RS9_TROWT       ------------------------------------------------------------PGEGVFVVNG
RS9_TROW8       ------------------------------------------------------------PGEGVFVVNG
RS9_CARHZ       ---------------------------------------------GTGRRKEAVARVFVVPGEGNITING
RS9_COREF       -------------------------------------------------------------GSGEITCNG
RS9_BACHD       ---------------------------------------------GTGRRKHSVARVRLVPGDGNIVING
RS9_ANAVT       ---------------------------------------------GTGRRKSAVARVRLVPGTGQLIVNG
RS9_ANASP       ---------------------------------------------GTGRRKSAVARVRLVPGTGQLIVNG
RS9_RUBXD       ---------------------------------------------GTGRRKTSVARVRVLPGDGRITVNG
RS9_NOSP7       ---------------------------------------------GTGRRKNAVARVRLVPGTGQLTVNG
RS9_BACSK       ---------------------------------------------GTGRRKHSVARVRLIPGEGKIVVNG
RS9_ANATD       ------------------------------------------------------------PGNGKIIVND
RS9_THEEB       --------------------------------------------LGTGRRKSAVARVRLIPGSGQLWING
RS9_HAHCH       ---------------------------------------------GTGRRKTSTARVFLRPGSGKITVNQ
RS9_CYAP4       --------------------------------------------IGTGRRKSSVARVRLVPGTGQLTING
RS9_MICAN       ---------------------------------------------GTGRRKSAVAAVRLVPGTGAITVNG
RR9_ARATH       --------------------------------------------IGTGRRKCAIARVVLQEGTGKVIINY
RS9_MARAV       ---------------------------------------SVAQNYGTGRRKSSTARVFIKPGSGNISING
RS9_LACLS       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNG
RS9_LACLM       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNG
RS9_LACLA       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNG
RS9_CYAP7       ---------------------------------------------GTGRRKTSVARVRLIPGTGQVTVNG
RS9_OCEIH       ---------------------------------------------GTGRRKKSTARVRLVPGTGNVTING
RS9_CALS8       ------------------------------------------------------------PGNGKIIVND
RS9_STRS7       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_HELMI       --------------------------------------------LGTGRRKKSVARVRLVPGDGKFLINN
RS9_STRMU       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STREM       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STRE4       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_ENTFA       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RR9_SPIOL       --------------------------------------------IGTGRRKCAIARVVLQEGTGKFIINY
RS9_PROM5       ---------------------------------------------GTGRRKTSVARVRLIPGNGQIKING
RS9_SYNY3       ---------------------------------------------GTGRRKAAIARVRLVPGQGEVIVNG
RS9_SYNWW       ---------------------------------------------GTGRRKEAVARVRLVPGEGNIIINN
RS9_STRA5       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITINK
RS9_STRA3       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITINK
RS9_STRA1       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITINK
RS9_DESVV       ------------------------------------------------------------PGTGVIEING
RS9_DESVH       ------------------------------------------------------------PGTGVIEING
RS9_PROM9       ---------------------------------------------GTGRRKTSVARVRLIPGNGQIKING
RS9_LYSSC       --------------------------------------------IGTGRRKSSVARVRLVPGTGKIVINK
RS9_THETN       ---------------------------------------------GTGRRKEAVARVRLMPGKGNIIINN
RS9_STRZT       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STRZP       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STRZJ       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STRTD       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STRT2       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STRT1       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STRR6       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STRPS       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STRPN       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STRPJ       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STRPI       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STRP7       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STRP4       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STRP2       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_METCA       ---------------------------------------------GTGRRKSAIARVYTRTGTGQIRIND
RS9_ERWT9       ---------------------------------------AENQNYGTGRRKSSSARVFIKPGSGNIVINQ
RS9_ACTSZ       --------------------------------------TAANQNYGTGRRKSSSARVFIKPGNGKITINQ
RS9_PEDPA       ---------------------------------------------GTGRRKNSVARVRLVPGTGKITVND
RS9_MOOTA       ---------------------------------------------GTGRRKNAIARVRLVPGEGRIIVNN
RS9_EXISA       ---------------------------------------------GTGRRKHSVARVHLVAGDGKVVVNG
RS9_CYAA5       ---------------------------------------------GTGRRKSAVARVRLVPGSGEIIVNK
RS9_IDILO       ---------------------------------------------GTGRRKNSTARVFLRPGSGNIKINN
RS9_RHOSK       ---------------------------------------SLGRSYATGKRKDAVARVWIKPGSGKVTVNG
RS9_RHOS4       ---------------------------------------SLGRSYATGKRKDAVARVWIKPGSGKVTVNG
RS9_RHOS1       ---------------------------------------SLGRSYATGKRKDAVARVWIKPGSGKVTVNG
RS9_PROMS       ---------------------------------------------GTGRRKTSVARVRLIPGNGLIKING
RS9_HAEPS       --------------------------------------TAANQNYGTGRRKSSSARVFIKPGNGNITINQ
RS9_BACHK       ---------------------------------------------GTGRRKSSVARVRLVPGEGRVIING
RS9_BACCZ       ---------------------------------------------GTGRRKSSVARVRLVPGEGRVIING
RS9_BACCR       ---------------------------------------------GTGRRKSSVARVRLVPGEGRVIING
RS9_BACCQ       ---------------------------------------------GTGRRKSSVARVRLVPGEGRVIING
RS9_BACCN       ---------------------------------------------GTGRRKSSVARVRLVPGEGRVIING
RS9_BACC7       ---------------------------------------------GTGRRKSSVARVRLVPGEGRVIING
RS9_BACC4       ---------------------------------------------GTGRRKSSVARVRLVPGEGRVIING
RS9_BACC3       ---------------------------------------------GTGRRKSSVARVRLVPGEGRVIING
RS9_BACC2       ---------------------------------------------GTGRRKSSVARVRLVPGEGRVIING
RS9_BACC1       ---------------------------------------------GTGRRKSSVARVRLVPGEGRVIING
RS9_BACC0       ---------------------------------------------GTGRRKSSVARVRLVPGEGRVIING
RS9_BACAH       ---------------------------------------------GTGRRKSSVARVRLVPGEGRVIING
RS9_SYNP2       ---------------------------------------------GTGRRKASIARVRLVPGSGKVVVNN
RS9_PROMP       ---------------------------------------------GTGRRKTSVARVRLIPGNGQIKING
RS9_ERWCT       ---------------------------------------------GTGRRKSSAARVFIKPGSGNIVINQ
RS9_PROM0       ---------------------------------------------GTGRRKTSVARVRLIPGNGLIKING
RS9_GEOSW       ---------------------------------------------GTGRRKSSVARVRLVPGDGRIVIND
RS9_DESDA       -------------------------------------------------------------GSGGITVNG
RS9_PSEU5       ---------------------------------------------GTGRRKTATARVFLRPGTGKISINN
RS9_HAMD5       ---------------------------------------------GTGRRKSSAARVFIKPGSGNIVVNQ
RS9_SERP5       ---------------------------------------------GTGRRKSSAARVFIKPGSGNIVINQ
RS9_RHOS5       ---------------------------------------SLGRSYATGKRKDAVARVWIKPGSGKVTVNG
RS9_LAWIP       ------------------------------------------------------------PGNGTIKING
RS9_XANP2       -----------------------------------------GRAYATGKRKNAVARVWVRPGTGKVTIND
RS9_PSEMY       ---------------------------------------------GTGRRKTATARVFLRPGTGNISINN
RS9_AZOSE       ---------------------------------------AVSYNYGTGRRKTAVARVFIKPGSGNIVVNG
RS9_RHIL3       ---------------------------------------SLGRSYATGKRKNAVARVWVKPGSGKITVNG
RS9_PROM2       ---------------------------------------------GTGRRKTSVARVRLIPGNGLITING
RS9_NATTJ       ---------------------------------------------GTGRRKTSVARVRLVPGNGKIVVNN
RS9_ALHEH       ---------------------------------------------GTGRRKTSSARVFLRPGSGDIKVNG
RS9_RHOBA       -----------------------------------------GDALGTGXXXXXXXXXXXXPGSGKITING
RS9_COXBU       -------------------------------------------NLGTGRRKTSSARVFLRSGTGQIIING
RS9_COXBR       -------------------------------------------NLGTGRRKTSSARVFLRSGTGQIIING
RS9_COXBN       -------------------------------------------NLGTGRRKTSSARVFLRSGTGQIIING
RS9_COXB2       -------------------------------------------NLGTGRRKTSSARVFLRSGTGQIIING
RS9_BACAN       ---------------------------------------------GTGRRKSSVARVRLVSGEGRVIING
RS9_BACAC       ---------------------------------------------GTGRRKSSVARVRLVSGEGRVIING
RS9_BACAA       ---------------------------------------------GTGRRKSSVARVRLVSGEGRVIING
RS9_ANOFW       ---------------------------------------------GTGRRKSSVARVRLVPGEGRIIVNG
RS9_AERS4       ---------------------------------------------GTGRRKSSTARVFIKAGSGKIVINQ
RS9_AERHH       ---------------------------------------------GTGRRKSSTARVFIKAGSGKIVINQ
RS9_RHILW       ---------------------------------------SLGRSYATGKRKNAVARVWVKPGSGKIIVNG
RS9_MANSM       --------------------------------------TAANQNYGTGRRKSSSARVFIKPGSGKITINQ
RS9_LISMO       ---------------------------------------------GTGRRKSSVARVRLVPGDGKIVINN
RS9_DESDG       -------------------------------------------------------------GTGKIVVNG
RS9_CLOPS       --------------------------------------------MGTGRRKKSVARVRLVPGEGRVIVNN
RS9_CLOPE       --------------------------------------------MGTGRRKKSVARVRLVPGEGRVIVNN
RS9_CLOP1       --------------------------------------------MGTGRRKKSVARVRLVPGEGRVIVNN
RS9_BACSU       ---------------------------------------------GTGRRKSSVARVRLVPGEGRIVVNN
RS9_BACA2       ---------------------------------------------GTGRRKSSVARVRLVPGEGRIVVNN
RS9_AZOSB       ---------------------------------------AVTYNYGTGRRKTAVARVFIKPGSGNIVVNG
RS9_PSEF5       ---------------------------------------------GTGRRKTATARVFLRPGTGNISINN
RS9_PHOLL       ---------------------------------------------GTGRRKSSSARVFIKPGSGNIVINK
RS9_LISW6       ---------------------------------------------GTGRRKSSVARVRLVPGDGKIVINN
RS9_BACST       ---------------------------------------------GTGRRKSSVARVRLVPGDGRIIVNK
RS9_ACAM1       ---------------------------------------------GTGRRKSSIVRVRLVPGSGVMTING
RS9_THEPX       ---------------------------------------------GTGRRKEAVARVRLMPGKGNIIINN
RS9_THEP3       ---------------------------------------------GTGRRKEAVARVRLMPGKGNIIINN
RS9_PSEU2       ---------------------------------------------GTGRRKTATARVFLRPGTGNISINN
RS9_PSESM       ---------------------------------------------GTGRRKTATARVFLRPGTGNISINN
RS9_PSEPF       ---------------------------------------------GTGRRKTATARVFLRPGTGNISINN
RS9_PSE14       ---------------------------------------------GTGRRKTATARVFLRPGTGNISINN
RS9_PROMH       ---------------------------------------------GTGRRKSSSARVFIKPGSGNIVINK
RS9_MAGSM       ------------------------------------------------------------PGSGKVTINQ
RS9_LISMH       ---------------------------------------------GTGRRKSSVARVRLVPGDGKIVINN
RS9_LISMF       ---------------------------------------------GTGRRKSSVARVRLVPGDGKIVINN
RS9_LISMC       ---------------------------------------------GTGRRKSSVARVRLVPGDGKIVINN
RS9_LISIN       ---------------------------------------------GTGRRKSSVARVRLVPGDGKIVINN
RS9_HAESO       ---------------------------------------AENQNYGTGRRKSSSARVFIKPGSGKIVINQ
RS9_HAES2       ---------------------------------------AENQNYGTGRRKSSSARVFIKPGSGKIVINQ
RS9_HAES1       ---------------------------------------AENQNYGTGRRKSSSARVFIKPGSGKIVINQ
RS9_GEOTN       ---------------------------------------------GTGRRKSSVARVRLVPGDGRIIVNK
RS9_ENT38       ---------------------------------------------GTGRRKSSAARVFIKPGSGKIVINQ
RS9_BACLD       ---------------------------------------------GTGRRKSSVARVRLVPGEGRIIVNN
RS9_VIBCM       ---------------------------------------------GTGRRKSSAARVFIKPGSGNIVINK
RS9_VIBCH       ---------------------------------------------GTGRRKSSAARVFIKPGSGNIVINK
RS9_VIBC3       ---------------------------------------------GTGRRKSSAARVFIKPGSGNIVINK
RS9_THET2       ---------------------------------------------GTGRRKEAVARVFLRPGNGKVTVNG
RS9_SHISS       ---------------------------------------------GTGRRKNSAARVFIKPGNGKIVINQ
RS9_SHIF8       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_SHIDS       ---------------------------------------------GTGRRKSSTARVFIKPGNGKIVINQ
RS9_SHIBS       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_SHIB3       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_RHIE6       ---------------------------------------SLGRSYATGKRKNAVARVWVKPGSGKIIVNG
RS9_METPB       ---------------------------------------AQGRAYATGKRKDAVARVWIKPGNGTVVVNG
RS9_KLEP7       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_HAEIN       ---------------------------------------AENQNYGTGRRKSSSARVFIKPGSGKITINQ
RS9_EDWI9       ---------------------------------------------GTGRRKSSAARVFIKPGSGKIVINQ
RS9_ECOUT       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_ECOSM       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_ECOSE       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_ECOLU       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_ECOLI       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_ECOLC       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_ECOL6       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_ECOL5       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_ECOK1       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_ECOHS       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_ECODH       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_ECOBW       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_ECO8A       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_ECO81       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_ECO7I       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_ECO5E       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_ECO57       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_ECO55       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_ECO45       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_ECO27       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_ECO24       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_CLOD6       ---------------------------------------------GTGRRKSSVARVRLVAGEGNILVNG
RS9_CLOCE       ---------------------------------------------GTGRRKKSVARVRLVPGEGKFSIND
RS9_CITK8       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_THET8       ---------------------------------------------GTGRRKEAVARVFLRPGNGKVTVNG
RS9_SALTY       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_SALTI       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_SALSV       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_SALPK       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_SALPC       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_SALPB       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_SALPA       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_SALNS       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_SALHS       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_SALEP       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_SALDC       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_SALCH       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_SALAR       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_SALA4       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_PARL1       -----------------------------------------GRAYATGKRKNAVARVWIKPGSGRVKING
RS9_NITEU       ---------------------------------------AIQYNYGTGRRKSAVARVFIKPGTGVITVNH
RS9_LACCB       ---------------------------------------------GTGRRKNSVARVRLVPGTGKITMNG
RS9_LACC3       ---------------------------------------------GTGRRKNSVARVRLVPGTGKITMNG
RS9_KLEP3       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_HAEIG       ---------------------------------------AENQNYGTGRRKSSSARVFIKPGSGKITINQ
RS9_HAEIE       ---------------------------------------AENQNYGTGRRKSSSARVFIKPGSGKITINQ
RS9_HAEI8       ---------------------------------------AENQNYGTGRRKSSSARVFIKPGSGKITINQ
RS9_ESCF3       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_CLOTH       ---------------------------------------------GTGRRKKSVARVRLVPGDGKIIINE
RS9_AZOVD       ---------------------------------------------GTGRRKTATARVFLRPGTGKISINN
RR9_MESVI       --------------------------------------------LGTGRRKSAVARVRLVPGNGEVIING
RS9_YERPY       ---------------------------------------------GTGRRKSSSARVFLKPGSGKIVINQ
RS9_YERPS       ---------------------------------------------GTGRRKSSSARVFLKPGSGKIVINQ
RS9_YERPP       ---------------------------------------------GTGRRKSSSARVFLKPGSGKIVINQ
RS9_YERPN       ---------------------------------------------GTGRRKSSSARVFLKPGSGKIVINQ
RS9_YERPG       ---------------------------------------------GTGRRKSSSARVFLKPGSGKIVINQ
RS9_YERPE       ---------------------------------------------GTGRRKSSSARVFLKPGSGKIVINQ
RS9_YERPB       ---------------------------------------------GTGRRKSSSARVFLKPGSGKIVINQ
RS9_YERPA       ---------------------------------------------GTGRRKSSSARVFLKPGSGKIVINQ
RS9_YERP3       ---------------------------------------------GTGRRKSSSARVFLKPGSGKIVINQ
RS9_YERE8       ---------------------------------------------GTGRRKSSAARVFLKPGSGKIVINQ
RS9_VIBHB       ---------------------------------------------GTGRRKSSAARVFIKPGSGNIVINK
RS9_SYNJA       ---------------------------------------------GTGRRKTAVARVRLVPGTGKLIIND
RS9_SORC5       ------------------------------------------------------------PGTGNIKVNQ
RS9_SHIFL       ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
RS9_RHORT       ---------------------------------------AQGRSYATGRRKDAVARVWIKAGSGRITVNG
RS9_PSEFS       ---------------------------------------------GTGRRKTATARVFLRPGTGNISINN
RS9_PECCP       ---------------------------------------------GTGRRKSSAARVFIKPGNGNIVINQ
RS9_GEOSF       ---------------------------------------------GTGKRKSSIARVWLKPGTGVITVNH
RS9_COXB1       -------------------------------------------NLGMGRRKTSSARVFLRSGTGQIIING
RS9_CLOK5       ---------------------------------------------GTGRRKKSIARVRLVPGEGKITINK
RS9_CLOK1       ---------------------------------------------GTGRRKKSIARVRLVPGEGKITINK
RS9_VIBPA       ---------------------------------------------GTGRRKSSAARVFIKPGSGNIVVNK
RS9_SHEWM       ---------------------------------------------GTGRRKTSTARVFAKVGTGNIVVNQ
RS9_SHESH       ---------------------------------------------GTGRRKTSTARVFAKVGTGNIVVNQ
RS9_HAEDU       --------------------------------------TAANQNYGTGRRKSSSARVFIKPGSGNITINQ
RS9_DESVM       -------------------------------------------------------------GSGQIVVNG
RS9_CLONN       ---------------------------------------------GTGRRKKSVARVILVPGDGKVTINK
RR9_GUITH       ---------------------------------------------GTGHRKQAIARVYLTPGSGLIEVNG
RS9_STRU0       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNS
RS9_SODGM       ---------------------------------------------GTGRRKSSSARVFVKAGSGNIVINQ
RS9_RHOPT       -----------------------------------------GRAYATGKRKDAVARVWIKPGAGKITVNS
RS9_RHOPA       -----------------------------------------GRAYATGKRKDAVARVWIKPGAGKITVNS
RS9_RHIME       ---------------------------------------AQGRSYATGKRKDAVARVWIKAGSGKITING
RS9_THESQ       ---------------------------------------------GTGRRKTAVARVYLRPGEGKVKVNG
RS9_THEMA       ---------------------------------------------GTGRRKTAVARVYLRPGEGKVKVNG
RS9_SYNJB       ---------------------------------------------GTGRRKTAVARVRLVPGTGKIIIND
RS9_SINMW       ---------------------------------------AQGRSYATGKRKDAVARVWIKPGSGKITVNG
RS9_SHEFN       ---------------------------------------------GTGRRKTSTARVFAKAGSGNIVVNQ
RS9_SHEDO       ---------------------------------------------GTGRRKTSTARVFAKAGSGNIVVNQ
RS9_OLICO       -----------------------------------------GRAYATGKRKDAVARVWIKPGSGKIVVNT
RS9_OCHA4       ---------------------------------------AQGRAYATGKRKDAVARVWVKPGTGKITVND
RS9_BRUSU       ---------------------------------------AQGRAYATGKRKDAVARVWVKPGTGKITVND
RS9_BRUSI       ---------------------------------------AQGRAYATGKRKDAVARVWVKPGTGKITVND
RS9_BRUO2       ---------------------------------------AQGRAYATGKRKDAVARVWVKPGTGKITVND
RS9_BRUME       ---------------------------------------AQGRAYATGKRKDAVARVWVKPGTGKITVND
RS9_BRUMB       ---------------------------------------AQGRAYATGKRKDAVARVWVKPGTGKITVND
RS9_BRUC2       ---------------------------------------AQGRAYATGKRKDAVARVWVKPGTGKITVND
RS9_BRUAB       ---------------------------------------AQGRAYATGKRKDAVARVWVKPGTGKITVND
RS9_BRUA2       ---------------------------------------AQGRAYATGKRKDAVARVWVKPGTGKITVND
RS9_BRUA1       ---------------------------------------AQGRAYATGKRKDAVARVWVKPGTGKITVND
RS9_BRASO       -----------------------------------------GRAYATGKRKDAVARVWIKPGSGKVTVNT
RS9_BRASB       -----------------------------------------GRAYATGKRKDAVARVWIKPGSGKVTVNT
RS9_AGRVS       ---------------------------------------AQGRAYATGKRKNAIARVWVKPGTGKITVNG
RS9_RHOPS       -----------------------------------------GRAYATGKRKDAVARVWIKPGAGKVTVNA
RS9_PARD8       -------------------------------------------------------------GTGKITINK
RS9_CLOTE       ---------------------------------------------GTGRRKKSIARVRLVPGEGKVLINK
RS9_CLOBA       --------------------------------------------MGTGRRKKSVARVRLVPGNGKVTINK
RS9_BACFR       -------------------------------------------------------------GTGKITINK
RS9_BACFN       -------------------------------------------------------------GTGKITINK
RS9_AZOPC       -------------------------------------------------------------GSGKILINQ
RS9_VIBVY       ---------------------------------------------GTGRRKSSAARVFIKPGSGNIVINK
RS9_VIBVU       ---------------------------------------------GTGRRKSSAARVFIKPGSGNIVINK
RS9_THEP1       ---------------------------------------------GTGRRKTAVARVYLRPGEGKVKVNG
RS9_THENN       ---------------------------------------------GTGRRKTAVARVYLRPGDGKVKVNG
RS9_SHESW       ---------------------------------------------GTGRRKTSTARVFAKAGSGNIVVNQ
RS9_SHESR       ---------------------------------------------GTGRRKTSTARVFAKAGSGNIVVNQ
RS9_SHESM       ---------------------------------------------GTGRRKTSTARVFAKAGSGNIVVNQ
RS9_SHESA       ---------------------------------------------GTGRRKTSTARVFAKAGSGNIVVNQ
RS9_SHEPC       ---------------------------------------------GTGRRKTSTARVFAKAGSGNIVVNQ
RS9_SHEON       ---------------------------------------------GTGRRKTSTARVFAKAGSGNIVVNQ
RS9_SHELP       ---------------------------------------------GTGRRKTSTARVFAKVGSGNIVVNQ
RS9_SHEHH       ---------------------------------------------GTGRRKTSTARVFAKVGTGNIIVNK
RS9_SHEB9       ---------------------------------------------GTGRRKTSTARVFAKAGSGNIVVNQ
RS9_SHEB8       ---------------------------------------------GTGRRKTSTARVFAKAGSGNIVVNQ
RS9_SHEB5       ---------------------------------------------GTGRRKTSTARVFAKAGSGNIVVNQ
RS9_SHEB2       ---------------------------------------------GTGRRKTSTARVFAKAGSGNIVVNQ
RS9_METRJ       ---------------------------------------AQGRAYATGKRKDAVARVWIKPGNGTVTINK
RS9_CLOBB       --------------------------------------------MGTGRRKKSVARVRLVPGNGKVVINK
RS9_BART1       -----------------------------------------GRAYATGKRKDAVARVWIKPGSGKIIINN
RS9_BARBK       -----------------------------------------GRSYATGKRKDAVARVWIKPGTGKITVNN
RS9_AGRT5       ----------------------------------------LGRSYATGKRKNAVARVWVKAGSGKIIING
RS9_ACTPJ       --------------------------------------TAANQNYGTGRRKSSSARVFIKPGNGNITINQ
RS9_ACTP7       --------------------------------------TAANQNYGTGRRKSSSARVFIKPGNGNITINQ
RS9_SHEPA       ---------------------------------------------GTGRRKTSTARVFAKVGTGNIIVNK
RS9_RHOP2       -----------------------------------------GRAYATGKRKDAVARVWIKPGAGKVIVNS
RS9_PORGI       -------------------------------------------------------------GSGKIVINK
RS9_PORG3       -------------------------------------------------------------GSGKIVINK
RS9_NITHX       -----------------------------------------GRAYATGKRKDAVARVWIKPGAGKILVNA
RS9_METI4       ------------------------------------------PIQATGRRKTATATVILKPGKGEVSING
RS9_EXIS2       ---------------------------------------------GTGRRKHAAARVFLVAGDGKVTVNG
RS9_CLOAB       --------------------------------------------MGTGRRKEAVARVRLVPGEGKVVINK
RS9_ALKMQ       ---------------------------------------------GTGRRKNAIARVRLVPGEGNITINK
RS9_STRS2       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_SHEPW       ---------------------------------------------GTGRRKTSTARVFAKVGTGNITVNK
RS9_LACPL       ---------------------------------------------GTGRRKDSVARVRLVPGTGKIVMND
RS9_CLOB8       --------------------------------------------MGTGRRKKSVARVRLVPGSGKVLVNK
RS9_BARQU       -----------------------------------------GRAYATGKRKGAVARVWLKPGFGKITINN
RS9_VARPS       ---------------------------------------------GTGRRKSSVARVFLKKGTGKITVNG
RS9_SACD2       ---------------------------------------------GTGRRKTSTARVFLTLGGGKITVNG
RS9_RHIEC       ---------------------------------------SLGRSYATGKRKDAVARVWVKAGSGKIIVNG
RS9_EUBR3       ---------------------------------------------GTGRRKSSVARVYLVPGTGKITINK
RS9_CHLAB       ------------------------------------VKNTIEESVATGRRKQAVSSVRLRPGTGKIDVNG
RS9_BACP2       ---------------------------------------------GTGRRKSSVARVRLVPGEGRIVVNN
RS9_ALKOO       ---------------------------------------------GTGRRKQSIARVRLVPGEGNIKINN
RS9_STACT       ---------------------------------------------GTGRRKNSVARVRLVPGEGNITVNG
RS9_NITWN       -----------------------------------------GRAYATGKRKDAVARVWIKPGAGKILVNA
RS9_LACBA       ---------------------------------------------GTGRRKNSSARVRLVPGSGKIVMNN
RS9_CLOPH       ---------------------------------------------GTGRRKSSIARVYLVPGTGKVTINK
RS9_BEII9       ---------------------------------------AFGRAYATGKRKDAVARVWIKPGSGKVTVNG
RS9_AMOA5       -------------------------------------------------------------GKGDISINK
RS9_THELT       -------------------------------------------------------------GNGKLTIND
RS9_LEPCP       ---------------------------------------------GTGRRKSSVARVFIKKGTGKIIVNG
RS9_HERAR       ---------------------------------------------GTGRRKSAVARVFIKSGSGQIVVNG
RS9_GEMAT       ------------------------------------------------------------PGSGKWLVNG
RS9_BRAJA       ------------------------------------------------------------PGAGKVTVNS
RS9_BARHE       -----------------------------------------GRAYATGKRKDAVARVWIKPGSGKITINN
RS9_BACTN       -------------------------------------------------------------GTGKITINK
RS9_ACTP2       --------------------------------------TAANQNYGTGRRKSSSARVFIKPGNGNITIDQ
RS9_RHOP5       ------------------------------------------------------------PGAGKVIVNT
RS9_PROMA       ---------------------------------------------GTGRRKTSVARVRLIPGTGKITING
RS9_PASMU       ---------------------------------------AENQNYGTGRRKSSSARVFIKPGSGKITINQ
RS9_DELAS       ---------------------------------------------GTGRRKSSVARVFLKKGSGKITVNG
RS9_CELJU       ---------------------------------------------GTGRRKTSTARVFIKAGSGVITVND
RS9_BORA1       ---------------------------------------------GTGRRKTSVARVFIKKGTGKIVVNG
RR9_GRATL       ---------------------------------------------GTGRRKTSIARVKLVPGSGKLIING
RT09_DEBHA      -------------------------------------------------------------GDGQVMVNG
RS9_RHISN       ---------------------------------------AQGRSYATGKRKDAVARVWVKAGSGKITVNG
RS9_PROM4       ---------------------------------------------GTGRRKTSVARVRLIPGTGKITING
RS9_PROM3       ---------------------------------------------GTGRRKTSVARVRLVPGTGTITING
RS9_PETMO       ---------------------------------------------GTGRRKTAVARVHLRPGNGKIKING
RS9_MARMS       ---------------------------------------------GTGRRKTSTARVFLKAGSGNLVINN
RS9_GEOUR       ---------------------------------------------GTGKRKSSIARVWLKPGTGVITVNH
RS9_CLOBM       ---------------------------------------------GTGRRKKSVARVRLVAGDGKVIINN
RS9_CLOBL       ---------------------------------------------GTGRRKKSVARVRLVAGDGKVIINN
RS9_CLOBK       ---------------------------------------------GTGRRKKSVARVRLVAGDGKVIINN
RS9_CLOBJ       ---------------------------------------------GTGRRKKSVARVRLVAGDGKVIINN
RS9_CLOBH       ---------------------------------------------GTGRRKKSVARVRLVAGDGKVIINN
RS9_CLOB6       ---------------------------------------------GTGRRKKSVARVRLVAGDGKVIINN
RS9_CLOB1       ---------------------------------------------GTGRRKKSVARVRLVAGDGKVIINN
RS9_ANASK       ------------------------------------------------------------PGTGNITING
RS9_ANADE       ------------------------------------------------------------PGTGNITING
RS9_ANAD2       ------------------------------------------------------------PGTGNITING
RS9_STRGC       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_METSB       ---------------------------------------AQGRAYATGKRKDAVARVWIKPGSGKVVVNG
RS9_METS4       ---------------------------------------AHGRAYATGKRKDAVARVWIKPGSGVITVND
RS9_LACSS       ---------------------------------------------GTGRRKNSVARVRLVPGTGKITINN
RS9_BORPD       ---------------------------------------------GTGRRKTSVARVFIKKGSGKIIVNG
RS9_BACV8       -------------------------------------------------------------GTGKITINK
RS9_METEP       ---------------------------------------AQGRAYATGKRKDAVARVWIKPGNGTVVVNG
RS9_METC4       ---------------------------------------AQGRAYATGKRKDAVARVWIKPGNGTVVVNG
RS9_DESMR       ---------------------------------------------GTGRRKSAVARTRLYKGNGRILVND
RS9_RHILO       -----------------------------------------GRAYATGKRKNAIARVWVKPGSGKIVVND
RS9_MYCGA       ------------------------------------------------------------PGSGKLVINN
RS9_DIAST       ---------------------------------------------GTGRRKSSVARVFLKKGSGKITVNG
RS9_BORBR       ---------------------------------------------GTGRRKTSVARVFIKKGSGKIVVNG
RS9_ACISJ       ---------------------------------------------GTGRRKSSVARVFLKKGSGKITVNG
RS9_STRSV       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_SHEAM       ---------------------------------------------GTGRRKTSTARVFAKVGSGNIIVNK
RS9_PROMM       ---------------------------------------------GTGRRKTSVARVRLVPGSGTITING
RS9_NITMU       -------------------------------------------SYGTGRRKSAVARVFIKPGSGVITVNN
RS9_NITEC       ---------------------------------------AIQYNYGTGRRKSAVARVFIKSGTGVITVNH
RS9_FINM2       ---------------------------------------------GTGRRKTSVARVTLVPGSGKFTINK
RS9_TERTT       ---------------------------------------------GTGRRKTATARVFISVGTGKVTIND
RS9_RHOFD       ---------------------------------------------GTGRRKSSVARVFLKKGSGQIVVNG
RS9_METNO       ---------------------------------------AQGRAYATGKRKDAVARVWIKPGAGTITVND
RS9_SYNS9       ---------------------------------------------GTGRRKTSVARVRLVPGNGTITING
RS9_PHYAS       ---------------------------------------------GTGRRKTAVARVILTNGTGKITINT
RS9_PELTS       ---------------------------------------------GTGRRKNAIARVFAMPGEGRIIINN
RS9_JANMA       ---------------------------------------------GTGRRKSAVARVFIKSGSGQIVVNG
RS9_DESPS       ------------------------------------------------------------PGTGKVIVNK
RS9_BORPE       ---------------------------------------------GTGRRKTSVARVFIKKGSGKIVVNG
RS9_SYNSC       ---------------------------------------------GTGRRKTSVARVRLVPGNGTITING
RS9_SYNS3       ---------------------------------------------GTGRRKTSVARVRLVPGNGTITING
RS9_METPP       ---------------------------------------------GTGRRKSSVARVFIKKGSGQITVNG
RS9_BURPS       ---------------------------------------------GTGRRKSAVARVFIKAGKGDIVVNG
RS9_BUCAT       ---------------------------------------------GTGRRKSSSARVFLRSGNGEIVVNK
RS9_STAAW       ---------------------------------------------GTGRRKNSVARVRLVPGEGNITVNN
RS9_STAAT       ---------------------------------------------GTGRRKNSVARVRLVPGEGNITVNN
RS9_STAAS       ---------------------------------------------GTGRRKNSVARVRLVPGEGNITVNN
RS9_STAAR       ---------------------------------------------GTGRRKNSVARVRLVPGEGNITVNN
RS9_STAAN       ---------------------------------------------GTGRRKNSVARVRLVPGEGNITVNN
RS9_STAAM       ---------------------------------------------GTGRRKNSVARVRLVPGEGNITVNN
RS9_STAAE       ---------------------------------------------GTGRRKNSVARVRLVPGEGNITVNN
RS9_STAAC       ---------------------------------------------GTGRRKNSVARVRLVPGEGNITVNN
RS9_STAAB       ---------------------------------------------GTGRRKNSVARVRLVPGEGNITVNN
RS9_STAA9       ---------------------------------------------GTGRRKNSVARVRLVPGEGNITVNN
RS9_STAA8       ---------------------------------------------GTGRRKNSVARVRLVPGEGNITVNN
RS9_STAA3       ---------------------------------------------GTGRRKNSVARVRLVPGEGNITVNN
RS9_STAA2       ---------------------------------------------GTGRRKNSVARVRLVPGEGNITVNN
RS9_STAA1       ---------------------------------------------GTGRRKNSVARVRLVPGEGNITVNN
RS9_RALME       ---------------------------------------------GTGRRKSAVARVFIKSGKGDIIVNG
RS9_KOSOT       --------------------------------------------IGTGRRKTSVARVRLRPGEGKFIVNG
RS9_BUCAI       ---------------------------------------------GTGRRKSSSARVFLRSGNGEIVVNK
RS9_BUCA5       ---------------------------------------------GTGRRKSSSARVFLRSGNGEIVVNK
RS9_BORPA       ---------------------------------------------GTGRRKTSVARVFIKKGSGKIVVNG
RS9_SYNPX       ---------------------------------------------GTGRRKTSVARVRLVPGNGTITING
RS9_PELPD       ---------------------------------------------GTGKRKSSVARVWLKPGSGAITVNK
RS9_COLP3       ---------------------------------------------GTGRRKSSTARVFMKAGNGAITINK
RS9_CHLPN       --------------------------------------STIQESVATGRRKQAVSSVRLRPGSGKIDVNG
RS9_VEREI       ---------------------------------------------GTGRRKSSVARVFLKKGSGKITING
RS9_STAHJ       ---------------------------------------------GTGRRKNSVARVRLVPGEGNITVNE
RS9_CAUSK       ---------------------------------------AQGRAYATGKRKNAIARVWIKPGKGSITING
RS9_CAUCR       ---------------------------------------AQGRAYATGKRKNAIARVWIKPGKGSITING
RS9_CAUCN       ---------------------------------------AQGRAYATGKRKNAIARVWIKPGKGSITING
RS9_BURVG       ---------------------------------------------GTGRRKSAVARVFIKAGKGDIIVNG
RS9_BURS3       ---------------------------------------------GTGRRKSAVARVFIKAGKGDIIVNG
RS9_BURCJ       ---------------------------------------------GTGRRKSAVARVFIKAGKGDIIVNG
RS9_BURCH       ---------------------------------------------GTGRRKSAVARVFIKAGKGDIIVNG
RS9_BURCC       ---------------------------------------------GTGRRKSAVARVFIKAGKGDIIVNG
RS9_BURCA       ---------------------------------------------GTGRRKSAVARVFIKAGKGDIIVNG
RS9_BAUCH       -------------------------------------------------------------GSGNIIINK
RS9_THIDA       ---------------------------------------------GTGRRKSSVARVFIKAGSGKIVVND
RS9_RALPJ       ---------------------------------------------GTGRRKSAVARVFIKSGKGDIIVNG
RS9_BURXL       ---------------------------------------------GTGRRKSAVARVFIKAGKGDIVVNG
RS9_BURPP       ---------------------------------------------GTGRRKSAVARVFIKAGKGDIVVNG
RS9_PSEA7       ---------------------------------------------GTGRRKTATARVFLRPGTGKISINN
RS9_PELCD       ------------------------------------------------------------PGEGNITVNR
RS9_NEIMF       ---------------------------------------------GTGRRKSSVARVFLIKGTGQIIVNG
RS9_NEIMB       ---------------------------------------------GTGRRKSSVARVFLIKGTGQIIVNG
RS9_NEIMA       ---------------------------------------------GTGRRKSSVARVFLIKGTGQIIVNG
RS9_NEIM0       ---------------------------------------------GTGRRKSSVARVFLIKGTGQIIVNG
RS9_CHLMU       -------------------------------------------SVATGRRKQAVSSVRLRSGNGKIDVNG
RS9_BURP6       ---------------------------------------------GTGRRKSAVARVFIKAGKGDIVVNG
RS9_BURP1       ---------------------------------------------GTGRRKSAVARVFIKAGKGDIVVNG
RS9_BURP0       ---------------------------------------------GTGRRKSAVARVFIKAGKGDIVVNG
RS9_BURMS       ---------------------------------------------GTGRRKSAVARVFIKAGKGDIVVNG
RS9_BURMA       ---------------------------------------------GTGRRKSAVARVFIKAGKGDIVVNG
RS9_BURM9       ---------------------------------------------GTGRRKSAVARVFIKAGKGDIVVNG
RS9_BURM7       ---------------------------------------------GTGRRKSAVARVFIKAGKGDIVVNG
RS9_BUCBP       ---------------------------------------------GTGRRKSSSARVFLKTGTGNITINN
RS9_STAES       ---------------------------------------------GTGRRKNSVARVRLVPGEGNITVNE
RS9_STAEQ       ---------------------------------------------GTGRRKNSVARVRLVPGEGNITVNE
RS9_CHLTR       -------------------------------------------SVATGRRKQAVSSVRLRSGNGKIDVNG
RS9_CHLTA       -------------------------------------------SVATGRRKQAVSSVRLRSGNGKIDVNG
RS9_STRPZ       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STRPM       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STRPG       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STRPF       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STRPD       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STRPC       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STRPB       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STRP8       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STRP6       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STRP3       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STRP1       ---------------------------------------------GTGRRKNAVARVRLVPGTGKITVNK
RS9_STAS1       ---------------------------------------------GTGRRKNSVARVRLVPGEGNITVNG
RS9_RICBR       ------------------------------------------------------------PGKGQVIVNK
RS9_RICB8       ------------------------------------------------------------PGKGQVIVNK
RS9_CHLTB       -------------------------------------------SVATGRRKQAVSSVRLRSGNGKIDVNG
RS9_CHLT2       -------------------------------------------SVATGRRKQAVSSVRLRSGNGKIDVNG
RS9_BURP8       ---------------------------------------------GTGRRKSAVARVFIKAGKGDIVVNG
RS9_BURM1       ---------------------------------------------GTGRRKSAVARVFIKAGKGDIIVNG
RS9_BORBZ       ----------------------------------------VNLSMGTGRRKSSVARVYIREGSGNIKVNN
RS9_BORBU       ----------------------------------------VNLSMGTGRRKSSVARVYIREGSGNIKVNN
RS9_BORAP       ----------------------------------------VNLSMGTGRRKSSVARVYIREGSGNIKVNN
RS9_AZOC5       -----------------------------------------GRAYATGKRKDAVARVWVRPGTGKIIVND
RS9_ACIAC       ---------------------------------------------GTGRRKSSVARVFLKKGSGKITVNG
RS9_ONYPE       ---------------------------------------------GTGRRKSAVARVILTNGTGKITINT
RS9_HYPNA       ---------------------------------------AQGRAYGTGRRKEAVARVWIKPGSGKIIING
RS9_CUPTR       ---------------------------------------------GTGRRKSAVARVFIKSGKGDIVVNG
RS9_BURTA       ---------------------------------------------GTGRRKSAVARVFIKAGKGDIIVNG
RT09_CANAL      -------------------------------------------------------------GEGEVLVNG
RS9_RALEH       ---------------------------------------------GTGRRKSAVARVFIKSGKGDIIVNG
RS9_NEIG2       ---------------------------------------------GTGRRKSSVARVFLTKGTGQIIVNG
RS9_NEIG1       ---------------------------------------------GTGRRKSSVARVFLTKGTGQIIVNG
RS9_DEIDV       ---------------------------------------------GTGRRKSAVARVFLRPGEGKIIVNG
RS9_RALEJ       ---------------------------------------------GTGRRKSAVARVFIKSGKGDIVVNG
RS9_BURCM       ---------------------------------------------GTGRRKSAVARVFIKAGKGDIIVNG
RS9_BURA4       ---------------------------------------------GTGRRKSAVARVFIKAGKGDIIVNG
RR9_CYACA       -------------------------------------------SYSTGRRKCAVAQLRFFSGNGKIVVNG
RS9_UREU1       ------------------------------------------------------------PGSGKVFIND
RS9_UREPA       ------------------------------------------------------------PGSGKVLVND
RS9_UREP2       ------------------------------------------------------------PGSGKVLVND
RS9_DESAP       ---------------------------------------------GTGRRKNAIARVFLSPGSGTVQVND
RS9_RALSO       ---------------------------------------------GTGRRKSAVARVFIKSGKGDIIVNG
RS9_POLNA       ---------------------------------------------GTGRRKSSVARVFIKKGTGKITVND
RR9_PORYE       ---------------------------------------------GTGRRKCSVAQVRLVPGSGNLIING
RR9_CYAPA       ---------------------------------------------GTGRRKTSVAKVRLIPGKGEILINS
RT09_YEAST      -----------------------------------------GRSIAVGKRKSSTAKVFVVRGTGEILVNG
RS9_PSEAE       ---------------------------------------------GTGRRKTATARVFLRPGTGKISINN
RS9_PSEAB       ---------------------------------------------GTGRRKTATARVFLRPGTGKISINN
RS9_PSEA8       ---------------------------------------------GTGRRKTATARVFLRPGTGKISINN
RS9_GEOKA       ---------------------------------------------GTGRRKSSVARVRLVPGDGRIIVNK
RS9_DESHY       ---------------------------------------------GTGRRKNAVARVRLIPGEGKVTINK
RS9_DESHD       ---------------------------------------------GTGRRKNAVARVRLIPGEGKVTINK
RS9_DESAD       -------------------------------------------------------------GTGAITVNG
RS9_CHRVO       ---------------------------------------------GTGRRKSSVARVFMQKGSGQIIVNG
RS9_BORGA       ----------------------------------------VNLSMGTGRRKSSVARVYIREGSGNIRVNN
RR9_PHATR       -------------------------------------------NIGLGKRKQSIARVFLLPGDGKIIINK
RR9_ODOSI       -------------------------------------------------------------GEGNIVINK
RS9_POLSJ       ---------------------------------------------GTGRRKSSVARVFIKKGTGKITIND
RS9_MESFL       ---------------------------------------------GTGRRKTSVAQVILTPGKGNIIVNG
RS9_BUCAP       ---------------------------------------------GTGRRKSSSARVFLRSGDGEITVNK
RR9_PORPU       ---------------------------------------------GTGRRKCSVAQVRLVPGSGNLVING
RR9_OSTTA       ------------------------------------------------------------PGTGTIKVNQ
RR9_EMIHU       ------------------------------------------------------------PGTGIITVNK
RS9_LEPBL       -------------------------------------------------------------GSGKITVNH
RS9_LEPBJ       -------------------------------------------------------------GSGKITVNH
RS9_BLOFL       ---------------------------------------------GTGRRKSASARVFLRFGNGDIVINN
RS9_AYWBP       ---------------------------------------------GTGRRKSSVARVILTNGTGKITINT
RT09_YARLI      ---------------------------------------------------------------GEVRVNG
RS9_OENOB       ---------------------------------------------GTGRRKVSVARVRLTPGSGKITINN
RS9_DEIRA       ---------------------------------------------GTGRRKAAVARVFLRPGEGKIVVNG
RR9_THAPS       --------------------------------------------IGIGKRKRAVARVFLVPGTGTITINK
RT09_NEUCR      -----------------------------------------GRACGVGKRKASSARAFVVEGTGEVLVNG
RT09_CANGA      -------------------------------------------------------------GEGKILVNG
RS9_PSEA6       ---------------------------------------------GTGRRKSSTARVFLRAGSGNIVVNK
RS9_BLOPB       -------------------------------------------------------------------INK
RR9_OLTVI       --------------------------------------------MGTGRRKRAVAQVKLVAGEGKLIING
RT09_ASHGO      -------------------------------------------------------------GSGEVLVNG
RS9_TREPS       --------------------------------------------IGTGRRKTAVARVCIRMGNGNVTVNR
RS9_TREPA       --------------------------------------------IGTGRRKTAVARVCIRMGNGNVTVNR
RS9_TOLAT       ---------------------------------------------GTGRRKSATARVFAKVGSGDIVINK
RS9_HALHL       ---------------------------------------------GTGRRKTSAARVFMTPGNGNITVNG
RS9_GLOVI       ---------------------------------------------GTGRRKCAIARVRLVPGSGELVING
RR9_CHLVU       ------------------------------------------------------------PGTGKVMVNG
RS9_LACS1       ---------------------------------------------GTGRRKNSVARVRLVPGTGKITMNG
RS9_ALISL       ---------------------------------------------GTGRRKSSAARVFIKPGTGNIVINK
RS9_VIBSL       ---------------------------------------------GTGRRKSSAARVFIKPGSGEIVINK
RS9_PSEPK       ---------------------------------------------GTGRRKTATARVFLRPGTGNISINN
RS9_PSEPG       ---------------------------------------------GTGRRKTATARVFLRPGTGNISINN
RS9_PSEP1       ---------------------------------------------GTGRRKTATARVFLRPGTGNISINN
RS9_PSEE4       ---------------------------------------------GTGRRKTATARVFLRPGTGNISINN
RS9_DESRM       ---------------------------------------------GTGRRKNAVARVYLVPGEGKVVVNN
RS9_VIBFM       ---------------------------------------------GTGRRKSSAARVFIKPGTGNIVINK
RS9_VIBF1       ---------------------------------------------GTGRRKSSAARVFIKPGTGNIVINK
RS9_MYCHJ       ---------------------------------------------GTGRRKSSVARVTLKHGNGQFKINN
RS9_MYCH7       ---------------------------------------------GTGRRKSSVARVTLKHGNGQFKINN
RS9_MYCH2       ---------------------------------------------GTGRRKSSVARVTLKHGNGQFKINN
RS9_BORDL       ----------------------------------------VNLGMGTGRRKSSVARVYIREGKGDIKINH
RR9_PSEAK       ------------------------------------------------------------PGNGEFTING
RT09_KLUMA      -----------------------------------------GRSLAIGRRKTATAKVYVVRGEGQILVND
RS9_THISH       ---------------------------------------ATTQNYGTGRRKTASARVFLRPGKGDIVVNG
RS9_NITSB       -------------------------------------------------------------GSGKITVNG
RS9_GRAFK       -------------------------------------------------------------GKGNITVNK
RS9_BREBN       ---------------------------------------------GTGRRKHSVARVRLVPGEGRIVINK
RS9_BORHD       --------------------------------------------MGTGRRKSSVARVYIREGKGDIKINS
RS9_PSEPW       ---------------------------------------------GTGRRKTATARVFLRPGTGNISINN
RS9_MACCJ       ---------------------------------------------GTGRRKHSVARVRLIPGEGNITING
RT09_KLULA      -----------------------------------------GRSLAIGRRKTSTAKVYVVRGEGKILVND
RS9_FLAPJ       -------------------------------------------------------------GTGVITVNK
RS9_BACWK       ---------------------------------------------GTGRRKSSVARVRLVPGEGRVIING
RS9_MYCS5       ------------------------------------------------------------PGKGEFHINK
RS9_BORT9       --------------------------------------------MGTGRRKSSVARVYIREGKGDIKINN
RS9_AQUAE       ----------------------------------------------------------------------
RS9_SYNFM       ------------------------------------------------------------PGSGSVTINK
RS9_CHLPD       ------------------------------------------------------------PGKGRVIINK
RS9_STRMK       ---------------------------------------AITQNYGTGRRKSSTARVFLRKGSGNITVNG
RS9_STRM5       ---------------------------------------AITQNYGTGRRKSSTARVFLRKGSGNITVNG
RS9_DEHE1       --------------------------------------------IGVGRRKTAVATVKLTSGNGVIVIDG
RS9_BORRA       ----------------------------------------VNLGMGTGRRKSSVARVYIREGKGDIKINH
RS9_XYLFM       ---------------------------------------------GTGRRKSSTARVFLRKGSGNISVNG
RS9_XANOR       ---------------------------------------AITQNYGTGRRKSSTARVFLRKGTGKITVND
RS9_XANOP       ---------------------------------------AITQNYGTGRRKSSTARVFLRKGTGKITVND
RS9_XANOM       ---------------------------------------AITQNYGTGRRKSSTARVFLRKGTGKITVND
RS9_XANCP       ---------------------------------------AITQNYGTGRRKSSTARVFLRKGTGNITVNN
RS9_XANCB       ---------------------------------------AITQNYGTGRRKSSTARVFLRKGTGNITVNN
RS9_XANC8       ---------------------------------------AITQNYGTGRRKSSTARVFLRKGTGNITVNN
RS9_RICRS       ----------------------------------------------------------------------
RS9_RICRO       ----------------------------------------------------------------------
RS9_RICFE       ----------------------------------------------------------------------
RS9_RICAH       ----------------------------------------------------------------------
RS9_DEHSC       --------------------------------------------IGVGRRKTAVATVKLMSGNGVIVIDG
RS9_DEHSB       --------------------------------------------IGVGRRKTAVATVKLMSGNGVIVIDG
RT09_SCHPO      -----------------------------------------GMSITKGKRKSSKATVKMLPGTGKFYVNG
RS9_XYLFA       ---------------------------------------------GTGRRKSSKARIFLRKGSGNITVNG
RS9_XANC5       ---------------------------------------AITQNYGTGRRKSSTARVFLRKGTGNITVND
RS9_XANAC       ---------------------------------------AITQNYGTGRRKSSTARVFLRKGTGNITVND
RS9_THICR       ---------------------------------------------GTGRRKNSVARVFLRAGSGKMTVNG
RS9_CHLL2       ------------------------------------------------------------PGKGRVIINK
RS9_WIGBR       ----------------------------------------------------------------------
RS9_SULNB       ------------------------------------------------------------PGNGEMLING
RS9_SULDN       ------------------------------------------------------------PGAGTMTING
RS9_RHOCS       -----------------------------------------GRAYATGKRKDAVARVWIKPGSGKIIVNG
RS9_RICPU       ----------------------------------------------------------------------
RS9_RICM5       ----------------------------------------------------------------------
RS9_RICCN       ----------------------------------------------------------------------
RS9_CAMJR       ------------------------------------------------------------PGSGKISVNG
RS9_CAMJJ       ------------------------------------------------------------PGSGKISVNG
RS9_CAMJE       ------------------------------------------------------------PGSGKISVNG
RS9_CAMJD       ------------------------------------------------------------PGSGKISVNG
RS9_CAMJ8       ------------------------------------------------------------PGSGKISVNG
RS9_XYLFT       ---------------------------------------------GTGRRKSSTARVFLRKGSGNISVNG
RS9_XYLF2       ---------------------------------------------GTGRRKSSTARVFLRKGSGNISVNG
RS9_RICAE       ----------------------------------------------------------------------
RS9_LEPIN       -------------------------------------------------------------GSGKITVNH
RS9_LEPIC       -------------------------------------------------------------GSGKITVNH
RS9_FUSNN       --------------------------------------------LGTGRRKTSVARVRLIPGGQGVEING
RS9_CHLFF       ------------------------------------VKSTIEESVATGRRKQAVSSVRLRPGTGKIDVNG
RS9_RICCK       ----------------------------------------------------------------------
RS9_PELLD       ------------------------------------------------------------PGKGRVIINK
RS9_HELP2       ------------------------------------------------------------PGKGELSINE
RS9_RICPR       ----------------------------------------------------------------------
RS9_MYCMO       ------------------------------------------------------------PGKGEFLINK
RS9_HELPS       ------------------------------------------------------------PGKGELSINE
RS9_HELHP       -------------------------------------------------------------GSGKLNING
RS9_RICTY       ----------------------------------------------------------------------
RS9_HELPY       ------------------------------------------------------------PGKGELSINE
RS9_HELPJ       ------------------------------------------------------------PGKGELSINE
RS9_HELPG       ------------------------------------------------------------PGKGELSINE
RS9_HELAH       ------------------------------------------------------------PGKGELSINE
RS9_DESOH       ------------------------------------------------------------PGSGKITVNG
RS9_CHLCH       ------------------------------------------------------------PGKGTVTVNK
RS9_WOLSU       ------------------------------------------------------------PGSGKLTVNG
RS9_CAMLR       -------------------------------------------------------------GSGKIIVNG
RS9_PROVI       ------------------------------------------------------------PGKGRVIINK
RR9_EUGGR       -------------------------------------------------------------GGGEILING
RS9_HELPH       ------------------------------------------------------------PGKGGLSINE
RS9_ARCB4       -------------------------------------------------------------GNGQLTING
RS9_MYCPN       ---------------------------------------------------------------GKITVNR
RS9_CHLP8       ------------------------------------------------------------PGKGKIVVNK
RS9_CHLCV       ------------------------------------VKNTIEESVATGRRKQAVSSVRLRPGTGKIDVNG
RS9_MYCPU       -------------------------------------------------------------GSGKFTINK
RT09_HUMAN      -------------------------------------------------------------GSGRIKVNG
RS9_MYCGE       ---------------------------------------------------------------GKITINH
RS9_CYTH3       -------------------------------------------------------------GKGSIVVNG
RS9_CHLTE       ------------------------------------------------------------PGKGKIVVNK
RR9_NEPOL       -------------------------------------------------------------GTGQLTINQ
RT09_BOVIN      -------------------------------------------------------------GSGKIEING
RR9_STIHE       -------------------------------------------------------------GSGQFIING


                         .         .         *         .         .         .         .:140
query           KSLEEYFPNKVHQQLIKEPLATLGFEGAYDVFARLNGGGTSGQXXXXXXXXXXXXXXMDPEHNRPPLKKA
RS9_THEFY       KSLEEYFPNKVHQQLIKEPLATLGFEGAYDVFARLNGGGTSGQXXXXXXXXXXXXXXMDPEHNRPPLKKA
RS9_NOCSJ       RTLDSYFPNKLHQQVVNEPFVTTQLEGRFDVIARIHGGGITGQXXXXXXXXXXXXXXXDVEANRPSLKKA
RS9_STRGG       RTLEDYFPNKVHQQEVNEPFKVLELDGRYDVIARISGGGVSGQAGALRLGVARSLNEADVDNNRATLKKA
RS9_STRAW       RTLEDYFPNKVHQQEVNEPFKVLELEGRYDVIARISGGGVSGQXXXXXXXXXXXXNEADVDNNRGALKKA
RS9_PROAC       RTLEDYFPNKVHQQIVTEPFATAGVEGAYDVIARIXXXXXXXXXXXXXXXXXXXXNNVDPEASRPALKKA
RS9_STRCO       RTLEDYFPNKVHQQEVNEPFKVLELDNRYDVIARISGGGVSGQXXXXXXXXXXXXNEADVDNNRGALKKA
RS9_RENSM       RELADYFPNKLHQQEVNEPFKILDLDGAYDVAARISGGGPSGQAGALRLGVARSLNEIDVDNNRATLKKA
RS9_KINRD       RELDNYFPNKVHQQLVNEPFRVTALEGSFDVIARIHGGGSSXXXXXXXXXXXXXXXXIDLEANRPQLKKA
RS9_ARTCA       RALDNYFPNKLHQQDVNEPFKILDLEGAYDVIARIHGGGISGQAGALRLGIARSLNEIDVENNRATLKKA
RS9_BIFA0       RTLEEYFPSKLLQREVNSPIVLLKLEGKFDAIVLVDGGGTTGQAGAIRLGVARALNAIDRDANRAALKKA
RS9_ARTAT       RTLDNYFPNKLHQQDVNEPFKILDLEGAYDVIARIHGGGISGQAGALRLGVARSLNEIDVDNNRATLKKA
RS9_ARTS2       RELANYFPNKLHQQDVNEPFKILDLDGAYDVIARIHGGGPSGQAGALRLGIARSLNEIDIENNRAILKKA
RS9_MYCMM       RSLEAYFPNKVHQQLIKAPLVTVDRLESYDIFALLHGGGPSGQXXXXXXXXXXXXXVANPE-DRPALKKA
RS9_NOCFA       RSIEDYFPNKVHQQLVKSPLVTVERTESFDIHARLVGGGPSGQAGXXXXXXXXXXXEVTPE-DRPALKRA
RS9_MYCS2       RTLENYFPNKVHQQLIKAPLVTVDRVDQFDIYAHLDGGGPSGQAGXXXXXXXXXXXXVQPE-DRPALKKA
RS9_SACEN       KSLEQYFPNKVHQQLIKEPLVTVERVESFDVAATLRGGGPSGQAGALRMAIARALVELDAD-DRPALKKA
RS9_BIFLO       RTLEEYFPSKLLQREVNSPIVLLKLEGKFDAIVLVDGGGTTGQAGAIRLGVARALNAIDRDANRAALKKA
RS9_BIFLI       RTLEEYFPSKLLQREVNSPIVLLKLEGKFDAIVLVDGGGTTGQAGAIRLGVARALNAIDRDANRAALKKA
RS9_BIFLD       RTLEEYFPSKLLQREVNSPIVLLKLEGKFDAIVLVDGGGTTGQAGAIRLGVARALNAIDRDANRAALKKA
RS9_MYCLE       RSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQXXXXXXXXXXXXXXXSPE-DRPALKKA
RS9_MYCLB       RSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQXXXXXXXXXXXXXXXSPE-DRPALKKA
RS9_MYCA1       RTLEGYFPNKVHQQLIKAPLVTVDRVDSFDIYAHLHGGGPSGQXXXXXXXXXXXXXXXSPD-DRPALKKA
RS9_MYCPA       RTLEGYFPNKVHQQLVKAPLVTVDRVDGFDIYAHLHGGGPSGQXXXXXXXXXXXXXXXSPD-DRPALKKA
RS9_RHOOB       RTIEDYFPNKVHQQLIKAPLVTVERAESFDIVALLHGGGPSGQAGXXXXXXXXXXXEVTPE-DRPALKSA
RS9_RHOE4       RTLEDYFPNKVHQQLIKAPLVLVERPESFDIIALLHGGGPSGQAGXXXXXXXXXXXEVTPD-DRPALKRA
RS9_MYCUA       RSLEAYFPNKVHQQLIKAPLVTVDRLESYDIFALLHGGGPSGQXXXXXXXXXXXXXVANPE-DRPALKKA
RS9_MYCSS       RTLEAYFPNKVHQQLIKAPLVLVDRLESFDVYAHLDGGGPSGQAGXXXXXXXXXXXXVQPE-DRPALKKA
RS9_MYCSK       RTLEAYFPNKVHQQLIKAPLVLVDRLESFDVYAHLDGGGPSGQAGXXXXXXXXXXXXVQPE-DRPALKKA
RS9_MYCSJ       RTLEAYFPNKVHQQLIKAPLVLVDRLESFDVYAHLDGGGPSGQAGXXXXXXXXXXXXVQPE-DRPALKKA
RS9_LEIXX       RAFADYFPNKLHQQLITDPFKVLDLVGSYDVIARITGGGPSGQXXXXXXXXXXXXNEIDRENNRPTLKKA
RS9_BIFAA       RTLEEYFPAKLLQREVNSPIVLLKLEGKFDAIVLVDGGGTTGQAGAIRLGVARALNAIDRDANRAALKKA
RS9_SALTO       RDLEAYFPSKVHQQLIKDPLVTTEKAEEFDVIANLRGGGTTGQAGXXXXXXXXXXXXSEPD-DRPALKKA
RS9_CORGL       RTLEEYFPNKLHQQLIKAPLVLLDRENQFDIVATLKGGGPTGQAGAFRLAIARALNAYNPA-ERGELKKA
RS9_CORGB       RTLEEYFPNKLHQQLIKAPLVLLDRENQFDIVATLKGGGPTGQAGAFRLAIARALNAYNPA-ERGELKKA
RS9_SALAI       RELEAYFPSKVHQQLIKDPLVTTEKAETFDVIANLRGGGTTGQAGXXXXXXXXXXXXSEPD-DRPALKKA
RS9_CLAMS       REFADYFPNKLHQQLVNDPFKVLDLLGSYDVVARISGGGPSGQXXXXXXXXXXXXNEIDEENNRAVLKKN
RS9_CLAM3       REFADYFPNKLHQQLVNDPFKVLDLLGSYDVVARISGGGPSGQXXXXXXXXXXXXNEIDEENNRAVLKKN
RS9_MYCTU       RSLEDYFPNKVHQQLIKAPLVTVDRVESFDIFAHLXXXXXXXXXXXXXXXXXXXXXXVSPE-DRPALKKA
RS9_MYCTA       RSLEDYFPNKVHQQLIKAPLVTVDRVESFDIFAHLXXXXXXXXXXXXXXXXXXXXXXVSPE-DRPALKKA
RS9_MYCBT       RSLEDYFPNKVHQQLIKAPLVTVDRVESFDIFAHLXXXXXXXXXXXXXXXXXXXXXXVSPE-DRPALKKA
RS9_MYCBP       RSLEDYFPNKVHQQLIKAPLVTVDRVESFDIFAHLXXXXXXXXXXXXXXXXXXXXXXVSPE-DRPALKKA
RS9_MYCBO       RSLEDYFPNKVHQQLIKAPLVTVDRVESFDIFAHLXXXXXXXXXXXXXXXXXXXXXXVSPE-DRPALKKA
RS9_TROWT       RDINEYFTSKLHRQFACQPLKILDLLGSYDVKVTLHGGGASGQAGAVRLGIARALNTIDPENNRKPLKSA
RS9_TROW8       RDINEYFTSKLHRQFACQPLKILDLLGSYDVKVTLHGGGASGQAGAVRLGIARALNTIDPENNRKPLKSA
RS9_CARHZ       KSLEEYFPRKTLQIIVKQPLELTNTVGKFDVKAKVHGGGISGQAGAVRLGIARALVQADPS-LRPVLKKA
RS9_COREF       RTLEDYFPNKLHQQLIKAPLVLLGREGQFDIHANLXXXXXXXXXXAFRLAIARALNAYNPA-ERPTLKKA
RS9_BACHD       RSLDEYFGLETLKLIVKQPLVETGTEGQYDVRVNVDGGGFTGQAGAIRHGIARALLQVDPEY-RPSLKSA
RS9_ANAVT       KPGDLYFQNANYLGVIKAPLETLGLENEYDILVKAEGGGLTGQADSVRLGVARALCQLDPE-NRPPLKTE
RS9_ANASP       KPGDLYFQNANYLGVIKAPLETLGLENEYDILVKAEGGGLTGQADSVRLGVARALCQLDPE-NRPPLKTE
RS9_RUBXD       RPVEEYFPRVTHQRAVRAPLELLDAAGRYDVVAKIEGGGPTGQAEALRHGIARALAEESPE-ARGELKAA
RS9_NOSP7       KDGNLYFQNPNYLGVIKAPLETLGLENEYDILVKAEGGGLTGQADSVRLGVARALCQLDPD-NRPPLKTE
RS9_BACSK       RDLDEYFGLETLKLIVKQPLVETGVTGQYDVHVNVNGGGFTGQAGAIRHGIARALLQVDPD-NRATLKAA
RS9_ANATD       KNMEEYFPLETLRIIVKQPLTLTETLGKYDVIAKVKGGGLSGQAGAVRHGIARALVLADPT-LRPVLKKA
RS9_THEEB       RNGADYLQNNIYLNLVKAPLETLGLENSYDIYVNATGGGLTGQADAIRLGIARALCQLDIE-NRKPLKTE
RS9_HAHCH       TDLDSYFGRETARMVVRQPLELLGSIGNFDVFVTVKGGGPSGQAGAIRHGITRALIQYD-EANRSPLRKA
RS9_CYAP4       KSGELYLQNPTYLAIAKAPLESLGLENDYDILVNTSGGGLTGQADSIRLGVARALCQLDPE-NRKPLKVE
RS9_MICAN       RDGETHF-NRIYIQTIKAPLETLGLENEYDIIVKAEGGGLTGQADAVKLGVARALCQLAPE-NRPPLKSE
RR9_ARATH       RDAKEYLQNPLWLQYVKVPLVTLGYENSYDIFVKAHGGGLSGQAQAITLGVARALLKVSADH-RSPLKKE
RS9_MARAV       RTIEDFFGRETLRMIVRQPLVVAESEDRFDIAITVKGGGISGQAGAIRHGLTRALMDYD-ETLRPALRKA
RS9_LACLS       REVESYIPHADMRLVINQPFAATQTEGSYDTLVNVNGGGVSGQAGAIRHGIARALLQVDPDF-RSALKRA
RS9_LACLM       REVESYIPHADMRLVINQPFAATQTEGSYDTLVNVNGGGVSGQAGAIRHGIARALLQVDPDF-RSALKRA
RS9_LACLA       REVESYIPHADMRLVINQPFAATQTEGSYDTLVNVNGGGVSGQAGAIRHGIARALLQVDPDF-RSALKRA
RS9_CYAP7       KPGDTYF-NRIADYLIKAPLETLGLENEYDILVKAHGGGLTGQADAVKLGVARALCELAPE-NRQPLKSE
RS9_OCEIH       RDAQDYFPYETQLLILNQPLAATETQGTYDVLVNVDGGGFTGQAGAIRHGIARALLQADPEY-RSTLKSE
RS9_CALS8       KNMEEYFPLETLRIIVKQPLTLTETLNKYDVIAKVKGGGLSGQAGALRHGIARALVLADPT-LRPVLKKA
RS9_STRS7       KDVEEYIPHADLRLIINQPFAVTSTEGSYDVFVNVVGGGYAGQSGAIRHGIARALLQVDPDF-RDSLKRA
RS9_HELMI       RSLMEYFGKKTLEMIVRQPLELTKSEGRFDVLCNVHGGGTSGQAGAIRLGIARALLKAD-IGLRPVLKRA
RS9_STRMU       KDVEEYIPHADLRLVINQPFAVTSTEGSYDVFVNVVGGGYAGQSGAIRHGIARALLEVDPDF-RDALKRA
RS9_STREM       KDVEEYIPHADLRLVINQPFAVTSTEGSYDVFVNVVGGGYAGQSGAIRHGIARALLQVDPDF-RDSLKRA
RS9_STRE4       KDVEEYIPHADLRLVINQPFAVTSTEGSYDVFVNVVGGGYAGQSGAIRHGIARALLQVDPDF-RDSLKRA
RS9_ENTFA       KDVEEYIPHADLREVINQPFGVTETKGAYDVIVNVNGGGYAGQSGAIRHGIARALLQVDPDF-RSALKRA
RR9_SPIOL       RDAKEYLQNPLWLQYVKTPLATLGYETNYDVFVKAHGGGLSGQAQAISLGVARALLKVSASH-RAPLKQE
RS9_PROM5       RSGDDYLNNPSHLNSVKAPLQTLGLENSYDIFVNVFGGGLTGQADAIKQGAARALCDLSPD-NRKPLKTE
RS9_SYNY3       KPGEIYF-NRIYIQSLKAPLETLGLEGEYNILVNAHGGGLTGQADAVKLGVARALCQLSPE-NRQPLKAE
RS9_SYNWW       RSFEDFFPNQTSRLIVQQPLVLTAMQGRFDIICRVNGGGVSGQAGAIQLGIARALLKANPD-IKAMLRRS
RS9_STRA5       KDVEEYIPHADLRLVINQPFAVTSTQGSYDVFVNVVGGGYAGQSGAIRHGISRALLEVDPDF-RDSLKRA
RS9_STRA3       KDVEEYIPHADLRLVINQPFAVTSTQGSYDVFVNVVGGGYAGQSGAIRHGISRALLEVDPDF-RDSLKRA
RS9_STRA1       KDVEEYIPHADLRLVINQPFAVTSTQGSYDVFVNVVGGGYAGQSGAIRHGISRALLEVDPDF-RDSLKRA
RS9_DESVV       RPYEEFFPRKTLQMIIRQPLVLTKMLEKFDVKVNVAGGGISGQAEAVRHGISRALLELDAE-LRPVLKRA
RS9_DESVH       RPYEEFFPRKTLQMIIRQPLVLTKMLEKFDVKVNVAGGGISGQAEAVRHGISRALLELDAE-LRPVLKRA
RS9_PROM9       RSGDDYLNNPLHLNSIKAPLQTLGLENSYDILVNVFGGGLTGQADAIKQGAARALCELSPD-NRKPLKTE
RS9_LYSSC       REIEEYVPFAALREVIKQPLVATETTGSYDIHVNVNGGGYTGQAGAVRHGIARALLQVDPDF-RAALKSA
RS9_THETN       KSLEEYFPLETLRYTVKQPLILTETIDKFDVYVKVSGGGLSGQAGAIRHGIARALVKADAE-LRPILKKA
RS9_STRZT       KDVEEYIPHADLRLVINQPFAVTSTVGSYDVFVNVIGGGYAGQSGAIRHGIARALLQVDPDF-RDSLKRA
RS9_STRZP       KDVEEYIPHADLRLVINQPFAVTSTVGSYDVFVNVIGGGYAGQSGAIRHGIARALLQVDPDF-RDSLKRA
RS9_STRZJ       KDVEEYIPHADLRLVINQPFAVTSTVGSYDVFVNVVGGGYAGQSGAIRHGIARALLQVDPDF-RDSLKRA
RS9_STRTD       KDLEEYIPHADLRLVINQPFAVTSTEGSYDVHVNVVGGGYAGQSGAIRHGIARALLQVDPDF-RDSLKRA
RS9_STRT2       KDLEEYIPHADLRLVINQPFAVTSTEGSYDVHVNVVGGGYAGQSGAIRHGIARALLQVDPDF-RDSLKRA
RS9_STRT1       KDLEEYIPHADLRLVINQPFAVTSTEGSYDVHVNVVGGGYAGQSGAIRHGIARALLQVDPDF-RDSLKRA
RS9_STRR6       KDVEEYIPHADLRLVINQPFAVTSTVGSYDVFVNVVGGGYAGQSGAIRHGIARALLQVDPDF-RDSLKRA
RS9_STRPS       KDVEEYIPHADLRLVINQPFAVTSTVGSYDVFVNVVGGGYAGQSGAIRHGIARALLQVDPDF-RDSLKRA
RS9_STRPN       KDVEEYIPHADLRLVINQPFAVTSTVGSYDVFVNVIGGGYAGQSGAIRHGIARALLQVDPDF-RDSLKRA
RS9_STRPJ       KDVEEYIPHADLRLVINQPFAVTSTVGSYDVFVNVIGGGYAGQSGAIRHGIARALLQVDPDF-RDSLKRA
RS9_STRPI       KDVEEYIPHADLRLVINQPFAVTSTVGSYDVFVNVVGGGYAGQSGAIRHGIARALLQVDPDF-RDSLKRA
RS9_STRP7       KDVEEYIPHADLRLVINQPFAVTSTVGSYDVFVNVVGGGYAGQSGAIRHGIARALLQVDPDF-RDSLKRA
RS9_STRP4       KDVEEYIPHADLRLVINQPFAVTSTVGSYDVFVNVVGGGYAGQSGAIRHGIARALLQVDPDF-RDSLKRA
RS9_STRP2       KDVEEYIPHADLRLVINQPFAVTSTVGSYDVFVNVVGGGYAGQSGAIRHGIARALLQVDPDF-RDSLKRA
RS9_METCA       KSLEEYFGRKTDRMIVMQALEAVEMTDKLDVNVKVIGGGPSGQAGAIRHGLARALIELD-EAMRPVLRKA
RS9_ERWT9       RSLEQYFGRETARMVVRQPLELLDMVGKFDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_ACTSZ       RSLEVYFGRETSRMIVRQPLELVELTDKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRPALRAA
RS9_PEDPA       RPIEEYIPFANLRQVVVQPFGVTETNGNYDVIANVNGGGFSGQSGAIRHGIARALLDVDPDF-RAPLKKA
RS9_MOOTA       RPLNEYFGQKILEMLVRQPLEVTDMAGRFDVLARVEGGGTTGQAGAIRLGIARALLQADGD-LRPVLKRN
RS9_EXISA       RDISEYFGHETLIMMAKSPLVLTETEGKYDVIVNVNGGGYTGQAGAIRHGVSRALLQADPEF-RPSLKEK
RS9_CYAA5       KPGNIYF-NRIYLQAIKGPLETLGLENDYDILVNAHGGGLTGQADAVKLGVARALCELAPE-NRPPLKAE
RS9_IDILO       RELNEYFGRETAQMVVRQPLELVEMTEKFDMYITVSGGGTTGQAGAIRHGITRALMQYD-EALRGPLRKE
RS9_RHOSK       KPMDEYFARPVLQMILRQPFKVANVEGQFDVMATVAGGGLSGQAGAVKHGISKALQLYEPA-LRAALKAA
RS9_RHOS4       KPMDEYFARPVLQMILRQPFKVANVEGQFDVMATVAGGGLSGQAGAVKHGISKALQLYEPA-LRAALKAA
RS9_RHOS1       KPMDEYFARPVLQMILRQPFKVANVEGQFDVMATVAGGGLSGQAGAVKHGISKALQLYEPA-LRAALKAA
RS9_PROMS       RSGDDYLNNPLHLNSIKAPLQTLGLENSYDILVNVFGGGLTGQADAIKQGAARALCELSPD-NRKPLKTE
RS9_HAEPS       RSLEVYFGRETARMIVRQPLELVELTDKLDLYITVKGGGISGQAGAIRHGITRALIEYD-ETLRPALRAA
RS9_BACHK       RDFENYIPFAALREVVKQPLVATETLGNYDVLVNVNGGGYTGQAGAIRHGISRALLKADPEY-RLTLKRA
RS9_BACCZ       RDFENYIPFAALREVVKQPLVATETLGNYDVLVNVNGGGYTGQAGAIRHGISRALLKADPEY-RLTLKRA
RS9_BACCR       RDFENYIPFAALREVVKQPLVATETLGNYDVLVNVNGGGYTGQAGAIRHGISRALLKADPEY-RLTLKRA
RS9_BACCQ       RDFENYIPFAALREVVKQPLVATETLGNYDVLVNVNGGGYTGQAGAIRHGISRALLKADPEY-RLTLKRA
RS9_BACCN       RDFENYIPFAALREVVKQPLVATETLGNYDVLVNVNGGGYTGQAGAIRHGIARALLKADPEY-RLTLKRA
RS9_BACC7       RDFENYIPFAALREVVKQPLVATETLGNYDVLVNVNGGGYTGQAGAIRHGISRALLKADPEY-RLTLKRA
RS9_BACC4       RDFENYIPFAALREVVKQPLVATETLGNYDVLVNVNGGGYTGQAGAIRHGISRALLKADPEY-RLTLKRA
RS9_BACC3       RDFENYIPFAALREVVKQPLVATETLGNYDVLVNVNGGGYTGQAGAIRHGISRALLKADPEY-RLTLKRA
RS9_BACC2       RDFENYIPFAALREVVKQPLVATETLGNYDVLVNVNGGGYTGQAGAIRHGISRALLKADPEY-RLTLKRA
RS9_BACC1       RDFENYIPFAALREVVKQPLVATETLGNYDVLVNVNGGGYTGQAGAIRHGISRALLKADPEY-RLTLKRA
RS9_BACC0       RDFENYIPFAALREVVKQPLVATETLGNYDVLVNVNGGGYTGQAGAIRHGISRALLKADPEY-RLTLKRA
RS9_BACAH       RDFENYIPFAALREVVKQPLVATETLGNYDVLVNVNGGGYTGQAGAIRHGISRALLKADPEY-RLTLKRA
RS9_SYNP2       RSGEDYF-NRIYLAVLKSPLETLGLESEYDILVNAHGGGLTGQADAVKLGVARALCELDPD-NRQPLKIE
RS9_PROMP       RSGDDYLNNPSHLNSVKAPLLTLGLENSYDIFVNVFGGGLTGQADAIKQGAARALCGLSPD-NRKPLKTE
RS9_ERWCT       RSLEQYFGRETARMVVRQPLELVDMVGKFDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_PROM0       RAGDDYLNNPLHLNSIKAPLQTLGLENSYDMYVNVFGGGLTGQADAIKQGAARALCELSPD-NRKPLKTE
RS9_GEOSW       RDIRDYIPSEALIEVVKQPLVLTETLGNYDVLVNVKGGGFSGQAGAIRHGIARALLQVDPDY-RPVLKRA
RS9_DESDA       RSFENYFPRKTLQMIIRQPLVLAKLADKLDVRVNVAGGGVTGQAEAVRHGISRALLLVDPA-LRPVLKKA
RS9_PSEU5       RELDNFFGRETARMVVRQPLELTETAEKFDIYVTVLGGGVSGQAGAIRHGITRALISYD-ESLRSPLRKA
RS9_HAMD5       RSLEVYFGRETARMVVYQPLELLNMMNKFDLYITVKGGGISGQAGAIRHGITRALMAYD-ESLRPELRKA
RS9_SERP5       RSLEQYFGRETARMVVRQPLELTDMVGKFDLYITVKGGGISGQAGAIRHGITRALMEYD-ETLRGELRKA
RS9_RHOS5       KPMDEYFARPVLQMILRQPFTVANVTGQFDVMATVAGGGLSGQAGAVKHGISKALQLYEPS-LRAALKAA
RS9_LAWIP       RPLENYFPRKSLQMIIRQPLVHTKLLDKYDIKINVSGGGVSGQAEAVRHGISRALLEVNPE-LRSLLKPV
RS9_XANP2       RDIEVYFARPVLRLMINQPFQAAAREGQYDVVCTVSGGGLSGQAGAVRHGISKALTYYEPE-LRSPLKKG
RS9_PSEMY       RSLDTFFGRETARMVVRQPLELTETTEKFDIYVTVIGGGVSGQAGAIRHGITRALIEYD-ETLRSPLRKA
RS9_AZOSE       KPVDEFFSRETGRMIVRQPLVLTENDSRFDIMVNVTGGGESGQAGAVRHGITRALIEYDAE-LKPVLRKA
RS9_RHIL3       KEFAEYFARPVLQMILRQPIVAAARDGQFDIVATVAGGGLSGQAGAVRHGVSKALTYFEP-GLRAVLKKG
RS9_PROM2       RSGDDYLNNPLHLNSVKAPLQTLGLENSYDILVNVFGGGLTGQADAIKQGAARALCELSPD-NRKPLKTE
RS9_NATTJ       KAMDDYFGLETLKAIIKQPLQTVEMEDKFDVLVNVRGGGHSGQAEAIRHGIARALVKADGE-LRPVLKKE
RS9_ALHEH       RSLDEYFGRETARMIVRQPLELVDATEQFDVQVTVAGGGPSGQAGAIRHGITRALVQYD-EALKQPLSKA
RS9_RHOBA       KSIEEYFVNDQHRYAITETLEAAGLTESVDLLIRVSGGGMTGQAGAVRMGLARALCSHD-EALHDPMREG
RS9_COXBU       LPLDEYFGRETARMVVRQPLVKLDVQSRFDVYATVQGGGDSGQAGAIRHGITRALIQYDEEGGRSTLRKA
RS9_COXBR       LPLDEYFGRETARMVVRQPLVKLDVQSRFDVYATVQGGGDSGQAGAIRHGITRALIQYDEEGGRSTLRKA
RS9_COXBN       LPLDEYFGRETARMVVRQPLVKLDVQSRFDVYATVQGGGDSGQAGAIRHGITRALIQYDEEGGRSTLRKA
RS9_COXB2       LPLDEYFGRETARMVVRQPLVKLDVQSRFDVYATVQGGGDSGQAGAIRHGITRALIQYDEEGGRSTLRKA
RS9_BACAN       RDFENYIPFAALREVVKQPLVATETLGNYDVLVNVNGGGYTGQAGAIRHGISRALLKADPEY-RLTLKRA
RS9_BACAC       RDFENYIPFAALREVVKQPLVATETLGNYDVLVNVNGGGYTGQAGAIRHGISRALLKADPEY-RLTLKRA
RS9_BACAA       RDFENYIPFAALREVVKQPLVATETLGNYDVLVNVNGGGYTGQAGAIRHGISRALLKADPEY-RLTLKRA
RS9_ANOFW       RDIRDYVPYESLVEVVKQPLVLTETFGSYDVLVNVSGGGFTGQAGAIRHGIARALLQVDPEY-RQTLKRA
RS9_AERS4       RSLEQYFGRPTARMVVRQPLELVEMTEKLDLYITVNGGGISGQAGAIRHGITRALMQYD-ETLRAELRKA
RS9_AERHH       RSLEQYFGRPTARMVVRQPLELVEMTEKLDLYITVNGGGISGQAGAIRHGITRALMQYD-ETLRSELRKA
RS9_RHILW       KEFAEYFARPVLQMILRQPIVAAARDGQFDIVATVAGGGLSGQAGAVRHGLSKALTYFEP-GLRSVLKKG
RS9_MANSM       RELDVYFGRETSRMIVRQPLELVEMTEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRPVLRAA
RS9_LISMO       RDWEDYIPFAALREVIKQPLVATETLGNYDVLVNVHGGGYTGQAGAIRHGVARALLQVAPEY-RPALKSA
RS9_DESDG       RPYDEYFPRKSLQMIIRQPLALTKNVESFDIHVNVQGGGVRGQAEAVRHGISRALLEVDVE-MRSSLKRA
RS9_CLOPS       REIETYFGLETLRVVVNQPLVLTETKDKYDVLVNVHGGGLSGQAGAIRHGISRALLKAD-ENLRPELKKA
RS9_CLOPE       REIETYFGLETLRVVVNQPLVLTETKDKYDVLVNVHGGGLSGQAGAIRHGISRALLKAD-ENLRPELKKA
RS9_CLOP1       REIETYFGLETLRVVVNQPLVLTETKDKYDVLVNVHGGGLSGQAGAIRHGISRALLKAD-ENLRPELKKA
RS9_BACSU       REISEHIPSAALIEDIKQPLTLTETAGTYDVLVNVHGGGLSGQAGAIRHGIARALLEADPEY-RTTLKRA
RS9_BACA2       REISEHIPSPALIEDIKQPLTLTETAGTYDVLVNVHGGGLSGQAGAIRHGIARALLEADPEY-RATLKRA
RS9_AZOSB       KPVDEFFSRETGRMIVRQPLVLTGNEGRFDIMVNVTGGGESGQAGAVRHGITRALIDYSAE-LKSELRAA
RS9_PSEF5       RSLDNFFGRETARMVVRQPLELTETVEKFDIYVTVIGGGVSGQAGAIRHGITRALMDYD-ETLRSALRKA
RS9_PHOLL       RSLEVYFGRETARMVVRQPLELVDMLGKLDLYITVKGGGISGQAGAIRHGITRALMAYD-ETLRSDLRKA
RS9_LISW6       RDWEDYIPFAALREVIKQPLVATETLGNYDVLVNVRGGGYTGQAGAIRHGVARALLQVAPEY-RPALKSA
RS9_BACST       QDIREYIPTEALIEMVKQPLVLTETLGSYDVLVNVHGGGFAGQAGAIRHGIARALLQVDPEF-RTVLKRA
RS9_ACAM1       KPGDLYLQNPSYIANAKAPLESLGLENDYDVLVNARGGGLTGQADAIKLGVARALCELDPE-NRKPLKLE
RS9_THEPX       RPLEEYFTLDTLKYTVKQPLILTETIDKFDVYAKVSGGGLTGQAGAVRLGIARALVKVDSE-LRPILKKA
RS9_THEP3       RPLEEYFTLDTLKYTVKQPLILTETIDKFDVYAKVSGGGLTGQAGAVRLGIARALVKVDSE-LRPILKKA
RS9_PSEU2       RSLDNFFGRETARMVVRQPLELTETVEKFDIYVTVIGGGVSGQAGAIRHGITRALMQYD-ETLRGALRKA
RS9_PSESM       RSLDNFFGRETARMVVRQPLELTETVEKFDIYVTVIGGGVSGQAGAIRHGITRALMQYD-ETLRGALRKA
RS9_PSEPF       RSLDTFFGRETARMVVRQPLELTETVEKFDIYVTVIGGGVSGQAGAIRHGITRALMDYD-ETLRSALRKA
RS9_PSE14       RSLDNFFGRETARMVVRQPLELTETVEKFDIYVTVIGGGVSGQAGAIRHGITRALMQYD-ETLRGALRKA
RS9_PROMH       RSLEVYFGRETARMVVRQPLELVDMLGKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ETLRSDLRKA
RS9_MAGSM       KPMDVYFGRPVLRMVVNQPFSVTEMENKFDVLVNVHGGGVSGQAGAIKHGISKALVDYD-EALRPALKKA
RS9_LISMH       RDWEDYIPFAALREVIKQPLVATETLGNYDVLVNVHGGGYTGQAGAIRHGVARALLQVAPEY-RPALKSA
RS9_LISMF       RDWEDYIPFAALREVIKQPLVATETLGNYDVLVNVHGGGYTGQAGAIRHGVARALLQVAPEY-RPALKSA
RS9_LISMC       RDWEDYIPFAALREVIKQPLVATETLGNYDVLVNVHGGGYTGQAGAIRHGVARALLQVAPEY-RPALKSA
RS9_LISIN       RDWEDYIPFAALREVIKQPLVATETLGNYDVLVNVHGGGYTGQAGAIRHGVARALLQVAPEY-RPALKSA
RS9_HAESO       RELDVYFGRETSRMIVRQPLELVELTDKLDLYVTVKGGGISGQAGAIRHGITRALIEYD-ETLRPALRAA
RS9_HAES2       RELDVYFGRETSRMIVRQPLELVELTDKLDLYVTVKGGGISGQAGAIRHGITRALIEYD-ETLRPALRAA
RS9_HAES1       RELDVYFGRETSRMIVRQPLELVELTDKLDLYVTVKGGGISGQAGAIRHGITRALIEYD-ETLRPALRAA
RS9_GEOTN       HDIREYIPSEALIEMVKQPLVLTETLGSYDVLVNVHGGGFAGQAGAIRHGIARALLEVDPEF-RAVLKRA
RS9_ENT38       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_BACLD       REISEHIPSAALIEDIKQPLTLTETAGTYDVLVNVHGGGFSGQAGAIRHGIARALLEADPEY-RSTLKRA
RS9_VIBCM       RSLEEYFGRPTSCMVVKQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRPVLRAA
RS9_VIBCH       RSLEEYFGRPTSCMVVKQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRPVLRAA
RS9_VIBC3       RSLEEYFGRPTSCMVVKQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRPVLRAA
RS9_THET2       QDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDY-RAKLKPL
RS9_SHISS       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_SHIF8       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_SHIDS       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_SHIBS       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_SHIB3       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_RHIE6       KEFADYFARPVLQMILRQPIVAAARDGQFDIVATVAGGGLSGQAGAVRHGLSKALTYFEP-GLRSVLKKG
RS9_METPB       RAVETYFARPVLRMILRQPLEIVGRVDQYDITVTVKGGGLSGQAGAVRHGLSKALTYYEPE-LRSPLKRE
RS9_KLEP7       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_HAEIN       RELDVYFGRETARMVVRQPLELVXLTDKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ETLRPALRAA
RS9_EDWI9       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ETLRSELRKA
RS9_ECOUT       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_ECOSM       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_ECOSE       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_ECOLU       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_ECOLI       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_ECOLC       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_ECOL6       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_ECOL5       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_ECOK1       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_ECOHS       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_ECODH       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_ECOBW       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_ECO8A       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_ECO81       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_ECO7I       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_ECO5E       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_ECO57       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_ECO55       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_ECO45       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_ECO27       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_ECO24       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_CLOD6       RALENYFNYETLIRDVKQPLVLTGNENKYDVIVKVEGGGFTGQAGAIRHGISRALLKADLD-LRPALKKE
RS9_CLOCE       RSLDDYFGLETLKVIVKQPLTLTDTLTKFDVICKVIGGGFTGQAGAIRHGISRALLKAD-EELRPALKKA
RS9_CITK8       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_THET8       QDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDY-RAKLKPL
RS9_SALTY       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_SALTI       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_SALSV       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_SALPK       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_SALPC       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALIEYD-ESLRGELRKA
RS9_SALPB       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_SALPA       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_SALNS       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_SALHS       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_SALEP       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_SALDC       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_SALCH       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_SALAR       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_SALA4       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_PARL1       RDLEVYFARPVLRMILNQPLVVAAREKQYDITATVVGGGLSGQAGAIRHGISRALTYFEPS-LRGVLKKE
RS9_NITEU       KPADEYFSRETGRMIIRQPLELTGNTSNLDIMVNIHGGGESGQAGAVRHGITRALIGYD-ETLKPILSKA
RS9_LACCB       KDVRDYLPYENLITDLSQPFGITETTGSYDVLVNVNGGGFSGQAGATRHGIARALLTVDPDF-RGPLKKA
RS9_LACC3       KDVRDYLPYENLITDLSQPFGITETTGSYDVLVNVNGGGFSGQAGATRHGIARALLTVDPDF-RGPLKKA
RS9_KLEP3       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_HAEIG       RELDVYFGRETARMVVRQPLELVELTDKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ETLRPALRAA
RS9_HAEIE       RELDVYFGRETARMVVRQPLELVELTDKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ETLRPALRAA
RS9_HAEI8       RELDVYFGRETARMVVRQPLELVELTDKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ETLRPALRAA
RS9_ESCF3       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_CLOTH       RELDDYFGLETLKTIVKQPLVLTDTLGKFDVLCKVAGGGYTGQAGAIRHGISRALLKFD-EELRPALKKA
RS9_AZOVD       RSLEQFFGRETARMVVRQPLELTETVEKFDIYVTVIGGGVSGQAGAIRHGITRALIEYD-ETFRSSLRHA
RR9_MESVI       LPGTNYLQNGSYLSAVRSPLETLGLEDNYDIIVKAVGGGLTGQAEAIRLGVARALCTIDTS-NRHPLKKE
RS9_YERPY       RSLEVYFGRETARMVVNQPLELVDMVTKFDMYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_YERPS       RSLEVYFGRETARMVVNQPLELVDMVTKFDMYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_YERPP       RSLEVYFGRETARMVVNQPLELVDMVTKFDMYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_YERPN       RSLEVYFGRETARMVVNQPLELVDMVTKFDMYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_YERPG       RSLEVYFGRETARMVVNQPLELVDMVTKFDMYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_YERPE       RSLEVYFGRETARMVVNQPLELVDMVTKFDMYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_YERPB       RSLEVYFGRETARMVVNQPLELVDMVTKFDMYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_YERPA       RSLEVYFGRETARMVVNQPLELVDMVTKFDMYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_YERP3       RSLEVYFGRETARMVVNQPLELVDMVTKFDMYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_YERE8       RSLEVYFGRETARMVVNQPLELVDMVTKFDMYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_VIBHB       RSLDEYFGRPTSRMVVKQPLELVELTEKLDLYVTVKGGGISGQAGAIRHGITRALMEYD-ESLRPTLRAA
RS9_SYNJA       RPGDQYLQQEALLASVKAPLELLGLENSYDILVRAHGGGVHGQADAIKLGVARALCEVDPA-NRGPLKTE
RS9_SORC5       RPADDYFVRETSRMVMRQSLELLELLDQFDVSATVVGGGHSAQAEAMRHGIARALCELDPE-RRPSLKRA
RS9_SHIFL       RSLEQYFGRETARMVVRQPMELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
RS9_RHORT       RELENYFPRPVLRMVINQPFVVTNTTNQFDVVCTVTGGGLSGQAGALRHGISRALTYFDPD-MRPALKAE
RS9_PSEFS       RTLDNFFGRETARMVVRQPLELTETVEKFDIYVTVIGGGVSGQAGAIRHGITRALMQYD-ETLRGALRKA
RS9_PECCP       RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRGELRKA
RS9_GEOSF       KTLDEYFGRETSKMVVKQPLELTENLGKFDIYVTVSGGGDSGQAGAIKHGITKALLEVDAA-LRTPLKKA
RS9_COXB1       LPLDEYFGRETARMVVRQPLVKLDVQSRFDVYATVQGGGDSGQAGAIRHGITRALIQYDEEGGRSTLRKA
RS9_CLOK5       RSIEEYFGLETLRVIVNQPLVLTSTNGKFDVLVNVHGGGFTGQAGAIRHGISRALLKAD-ENLRLELKKA
RS9_CLOK1       RSIEEYFGLETLRVIVNQPLVLTSTNGKFDVLVNVHGGGFTGQAGAIRHGISRALLKAD-ENLRLELKKA
RS9_VIBPA       RSLDEYFGRPTSRMVVKQPLELVELTEKLDLYVTVKGGGISGQAGAIRHGITRALMEYD-ESLRPALRAA
RS9_SHEWM       LPLDQYFGRETSRMVVRQPLELVEMTDKLDIFVTVKGGGNTGQAGAIRHGITRALMELD-ESLRPSLRAA
RS9_SHESH       LPLDQYFGRETSRMVVRQPLELVEMTDKLDIFVTVKGGGNTGQAGAIRHGITRALMELD-ESLRPSLRAA
RS9_HAEDU       RSLEVYFGRETSRMVVRQPXXXXXXXXXXXXYITVKGGGISGQAGAIRHGITRALMEYD-ETLRPALRAA
RS9_DESVM       RPFEDYFPRKSLQMIIRQPLVLTKNVERFDIKVNVCGGGVTGQAEAVRHGISRALLELEPE-LRGALKRA
RS9_CLONN       RDIEVYFGLETLRYIVNQPLVLTGTKDKFDVIVNVNGGGFTGQAGAIRHGITRALVKAD-ETLKPELKKA
RR9_GUITH       IKGELYFPNYI--RLSKSPLTTLGLENKYNIYVNAHGGGLTGQVEAIRLGLARALCKLNPE-NRTALKFE
RS9_STRU0       KDVEEYIPHADLRLVINQPFAVTSTEGSYDVFVNVNXXXXXXXXXAIRHGIARALLQVDPDF-RDSLKRA
RS9_SODGM       RSLDQYFGRETARMVVRQPLELVDMVGKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ETLRADLRKA
RS9_RHOPT       REVETYFARPVLRMMIQQPLVAAARAGQYDVICTVAGGGLSGQAGAVRHGISKALTNFEPE-LRSVLKKG
RS9_RHOPA       REVETYFARPVLRMMIQQPLVAAARAGQYDVICTVAGGGLSGQAGAVRHGISKALTNFEPE-LRSVLKKG
RS9_RHIME       KPFSDYFARPVLQMILQQPVVAAARDGQFDIDATVAGGGLSGQAGAVRHGISKALTYFEP-GLRPVLKRG
RS9_THESQ       KSLNDYFKNPAWTKHAIEPLEVTNTLGKFDLVIRVNGGGLSGQSGAVRLGIARALLQYD-QNLRPVLKKY
RS9_THEMA       KSLNDYFKNPAWTKHAIEPLEVTNTLGKFDLVIRVNGGGLSGQSGAVRLGIARALLQYD-QNLRPVLKKY
RS9_SYNJB       RPGDQYLQQEALLASVKGPLEILGLENSYDILVRAHGGGVHGQADAIKLGVARALCEVDPA-NRGPLKVE
RS9_SINMW       KPFSDYFARPVLQMILQQPVVAAARDGQFDIDATVAGGGLSGQAGAVRHGISKALTYFEP-GLRAVLKRG
RS9_SHEFN       RPLDVYFGRETARMVVRQPLELVEMTDKLDIYVTVKGGGTTGQAGAIRHGITRALLQLD-EALRPTLRSA
RS9_SHEDO       RPLDVYFGRETARMVVRQPLELVEMTDKLDIYVTVKGGGTTGQAGAIRHGITRALLQLD-EALRPTLRSA
RS9_OLICO       RDVEVYFARPVLRMLIQQPIVAAARQGQYDVVATVAGGGLSGQAGAVRHGISKALTHFEPD-LRGVLKKG
RS9_OCHA4       KEFEKYFARPVLQMILQQPIVASNRAGQFDIVATVAGGGLSGQAGAVRHGISKALTYYEP-GLRTVLKKG
RS9_BRUSU       KEFEKYFARPVLQMILQQPIVASNRAGQFDIVATVAGGGLSGQAGAVRHGISKALTYYEP-GLRTVLKKG
RS9_BRUSI       KEFEKYFARPVLQMILQQPIVASNRAGQFDIVATVAGGGLSGQAGAVRHGISKALTYYEP-GLRTVLKKG
RS9_BRUO2       KEFEKYFARPVLQMILQQPIVASNRAGQFDIVATVAGGGLSGQAGAVRHGISKALTYYEP-GLRTVLKKG
RS9_BRUME       KEFEKYFARPVLQMILQQPIVASNRAGQFDIVATVAGGGLSGQAGAVRHGISKALTYYEP-GLRTVLKKG
RS9_BRUMB       KEFEKYFARPVLQMILQQPIVASNRAGQFDIVATVAGGGLSGQAGAVRHGISKALTYYEP-GLRTVLKKG
RS9_BRUC2       KEFEKYFARPVLQMILQQPIVASNRAGQFDIVATVAGGGLSGQAGAVRHGISKALTYYEP-GLRTVLKKG
RS9_BRUAB       KEFEKYFARPVLQMILQQPIVASNRAGQFDIVATVAGGGLSGQAGAVRHGISKALTDYEP-GLRTVLKKG
RS9_BRUA2       KEFEKYFARPVLQMILQQPIVASNRAGQFDIVATVAGGGLSGQAGAVRHGISKALTDYEP-GLRTVLKKG
RS9_BRUA1       KEFEKYFARPVLQMILQQPIVASNRAGQFDIVATVAGGGLSGQAGAVRHGISKALTDYEP-GLRTVLKKG
RS9_BRASO       RDIEVYFARPVLRMMIEQPMVVAARKGQYDVICTVAGGGLSGQAGAVRHGLSKALTNFEPE-LRSVLKKG
RS9_BRASB       RDIEVYFARPVLRMMIQQPLVAAARNGQYDVICTVAGGGLSGQAGAVRHGLSKALTNFEPE-LRGVLKKG
RS9_AGRVS       RDFPVYFARPVLQMILQQPVVAAARTGQFDVIATVTGGGLSGQAGAVRHGISKALTYFEP-GLRSVLKKG
RS9_RHOPS       REVEVYFARPVLRMMIQQPLVAAARAGQYDVICTVAGGGLSGQAGAVRHGISKALTNFEPE-LRGVLKKG
RS9_PARD8       RELEKYFPSSILQFIVKQPLAKLNVAEQYDIKINLDGGGFKGQSEAARLAISRALIKINPE-DKAVLRAE
RS9_CLOTE       RDEEEYFGLETLRVIVNQPLVLTGTKDKFDVLVNVYGGGLTGQAGAIRHGISRALLKAD-ESLRPELKKA
RS9_CLOBA       REIETFFGLETLRVIVNQPLVLTGTKDKFDVLVNVHGGGFTGQAGAIRHGITRALVKSD-ETLRPELKKA
RS9_BACFR       RDLAEYFPSTILQYVVKQPLNKLGVAEKYDIKVNLCGGGFTGQSQALRLAIARALVKINAE-DKPALRSE
RS9_BACFN       RDLAEYFPSTILQYVVKQPLNKLGVAEKYDIKVNLCGGGFTGQSQALRLAIARALVKINAE-DKPALRSE
RS9_AZOPC       RSLESYFPSSILRYVVKQPLNKLGVSEQYDITINLKGGGYKGQSEAIRLGIARALIKINSK-DKPLLRSE
RS9_VIBVY       RALEEYFGRPTSCMVVKQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRPALRAA
RS9_VIBVU       RALEEYFGRPTSCMVVKQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRPALRAA
RS9_THEP1       KSLNDYFKNPAWTKHAIEPLEVTNTLGKFDLVIRVNGGGLSGQSGAVRLGIARALLQYD-QKLRPVLKKY
RS9_THENN       KSLNDYFKNIAWTKHAIEPLEVTNTIGKFDLVIRVNGGGLSGQAGAVRLGIARALLQYD-ENLKPVLKKY
RS9_SHESW       RPLDQYFGRETARMVVRQPLELVEMTDKLDIYVTVKGGGITGQAGAIRHGITRALMQLD-EALRPSLRSA
RS9_SHESR       RPLDQYFGRETARMVVRQPLELVEMTDKLDIYVTVKGGGITGQAGAIRHGITRALMQLD-EALRPSLRSA
RS9_SHESM       RPLDQYFGRETARMVVRQPLELVEMTDKLDIYVTVKGGGITGQAGAIRHGITRALMQLD-EALRPSLRSA
RS9_SHESA       RPLDQYFGRETARMVVRQPLELVEMTDKLDIYVTVKGGGITGQAGAIRHGITRALMQLD-EALRPSLRSA
RS9_SHEPC       RPLDQYFGRETARMVVRQPLELVEMTDKLDIYVTVKGGGITGQAGAIRHGITRALMQLD-EALRPSLRSA
RS9_SHEON       RPLDQYFGRETARMVVRQPLELVEMTDKLDIYVTVKGGGITGQAGAIRHGITRALMQLD-EALRPSLRSA
RS9_SHELP       RPLDEYFGRETARMVVRQPLELVEMTEKLDIYVTVKGGGITGQAGAIRHGITRALMELD-EALRPSLRAA
RS9_SHEHH       LPLDEYFGRETSRMVVRQPLELVEMTDKLDIMVTVKGGGNTGQAGAIRHGITRALMELD-ESLRPSLRAA
RS9_SHEB9       RPLDQYFGRETARMVVRQPLELVEMTDKLDIYVTVKGGGITGQAGAIRHGITRALMQLD-EALRPSLRSA
RS9_SHEB8       RPLDQYFGRETARMVVRQPLELVEMTDKLDIYVTVKGGGITGQAGAIRHGITRALMQLD-EALRPSLRSA
RS9_SHEB5       RPLDQYFGRETARMVVRQPLELVEMTDKLDIYVTVKGGGITGQAGAIRHGITRALMQLD-EALRPSLRSA
RS9_SHEB2       RPLDQYFGRETARMVVRQPLELVEMTDKLDIYVTVKGGGITGQAGAIRHGITRALMQLD-EALRPSLRSA
RS9_METRJ       RPVETYFARPVLRMILRQPLEIAGRVDQYDITVTVAGGGLSGQAGAVRHGLSKALTYYEPE-LRAPLKRE
RS9_CLOBB       REIETFFGLETLRVIVNQPLVLTGTKDKFDVLVNVHGGGFTGQAGAIRHGITRALVKSD-ETLRPELKKA
RS9_BART1       KEFDKYFARPVLRMILRQPIVATNRDTQFDIVATVAGGGLSGQAGAIRHGISKALTYYEPE-LRPILKKG
RS9_BARBK       KEFEQYFARPVLRMILRQPIVIAKRDTQYDVVATVAGGGLSGQAGAIRHGISKALTYYEPA-LRTILKKG
RS9_AGRT5       RDFTTYFARPVLQMILQQPLVAAARAGQFDIIATVAGGGLSGQAGAVRHGVSKALTYFEP-GLRPVLKKG
RS9_ACTPJ       RSLDVYFGRETSRMVVRQPXXXXXXXXXXXXYITVKGGGISGQAGAIRHGITRALMEYD-ETLRPALRAA
RS9_ACTP7       RSLDVYFGRETSRMVVRQPXXXXXXXXXXXXYITVKGGGISGQAGAIRHGITRALMEYD-ETLRPALRAA
RS9_SHEPA       LPLDEYFGRETSRMVVRQPLELVEMTEKLDIMVTVKGGGNTGQAGAIRHGITRALMELD-ESLRPSLRAA
RS9_RHOP2       REVEVYFARPVLRMMIQQPLVAAARAGQYDVICTVAGGGLSGQAGAVRHGISKALTNFEPE-LRGVLKKG
RS9_PORGI       REIEQYFPSSILQYIVKQPLLKLDVAAKYDIKINLRGGGFKGQSEAARLAIARALVKINPD-DKPALRSE
RS9_PORG3       REIEQYFPSSILQYIVKQPLLKLDVAAKYDIKINLRGGGFKGQSEAARLAIARALVKINPD-DKPALRSE
RS9_NITHX       REVEVYFARPVLRMMIQQPLVAAARAGQYDVVCTVAGGGLSGQAGAVRHGLSKALTNFEPE-LRGVLKKG
RS9_METI4       KDLEFYFPTFVHRYEVFKPLEVIEGTKKFDIIAKARGGGLMGQAQALKLAVSRALIKYDPSY-RSLLKKE
RS9_EXIS2       RDISEYFGYETLIMTAKEPLVLTETEGKYDIMVTVKGGGFTGQAGAIRHGISRALLQADPDF-RGTLKAK
RS9_CLOAB       RSAEDYFGLETLRFIVNQPLNLTGTKGKFDVLVNVHGGGFTGQAGAIRHGISRALLKAD-ETLKGELKKA
RS9_ALKMQ       RNIEEYFNYETLRRDVRLPLELTETLSQFDVLATVNGGGYTGQAGALRHGIARALLKADDE-LRPALKKA
RS9_STRS2       KDVEEYIPHADLRLVINQPFAVTSTQGSYDVFVNVNXXXXXXXXXAIRHGIARALLQVDPDF-RDSLKRA
RS9_SHEPW       LPLDEYFGRETSRMVVRQPLELVEMTEKLDINVTVKGGGNTGQAGAIRHGITRALMELD-ESLRPSLRAA
RS9_LACPL       KSVEDYIPFADIRKELLQPFEVTETTDQYDVLVNVNGGGFHGQAGATRHGIARALLEVDPDF-RTPLKRA
RS9_CLOB8       REIENFFGLETLRVIVNQPLVLTGTKDRFDVLVNVHGGGFTGQAGAIRHGIARALVKSD-EALKPELKKA
RS9_BARQU       KEFDKYFARPVLRMILRQPIVAINRDTQFDIIATVTGGGLSGQAGAVRHGISKALTYYEPEF-RTILKKR
RS9_VARPS       KDIQEFFGRETSIMIAKQPLVLTNNLEAFDVMVNVNGGGESGQAGATRHGITRALIDYDAS-LKPVLSQA
RS9_SACD2       KTLDEYFGREVARMIVRQPIELTDNVEKFDINVTVKGGGSFGQAGAIRHGLTRALMAYD-EAMRPTLRAA
RS9_RHIEC       KDFTAYFARPVLQMILRQPIVAAARDGQFDIIATVAGGGLSGQAGAVRHGLSKALTYFEP-GLRSVLKKG
RS9_EUBR3       RDIDEYLGLETLKVVVRQPLVATETVDKFDVLVNVRGGGYTGQAGAIRHGIARALLQVDSEY-RPVLKSA
RS9_CHLAB       KAFDEYFPLEIQRVTILSPLKVLGYSNDFDLVIRINGGGIQGQVIATRLGLARALLKKNVD-SKQELKSH
RS9_BACP2       REITEYIPFAALIEDVKQPLNITETANSYDVLVTVHGGGFSGQAGAIRHGISRALLEVDPEY-RTSLKRA
RS9_ALKOO       RDIEEYFKYETLKRDVRMPLTITDTLSRFDVIATVAGGGYTGQAGALRHGISRALTKSD-EELRGTLKRA
RS9_STACT       KDVREYLPFESLILDLNQPFEVTETKGNYDVLVNVHGGGFTGQAQAIRHGIARALLEADPEY-RSSLKRA
RS9_NITWN       REVDVYFARPVLRMMIQQPLVAAARAGQYDVVCTVAGGGLSGQAGAVRHGLSKALTHFEPE-LRGVLKKG
RS9_LACBA       KAIEDYIPFASIREVVLQPFNVTETLGNYDALVTVRGGGFSGQAGATRHGIARALLEVDPDF-RGPLKRA
RS9_CLOPH       RDMDAYFGLETLKLIARQPLVLTETADKFDVLVNVHGGGFTGQAGAIRHGISRALLQADADY-RPALKKA
RS9_BEII9       RPLDVYFARPVLRMILQQPLGVAKRVDQYDLMVTVAGGGLSGQAGAVRHGLAKALVNYEPE-LRSALKKE
RS9_AMOA5       TSLEKYFPSEAIITLVKQPLQQIEAIDQYDIKINVKGGGFKGQAEAVRLGIARALCEVNPSF-RPSLKKE
RS9_THELT       KSAEEYFKDRVRARHAFEPLVVTNNDGKLDVFVRVEGGGLSGQAGAVXXXXXXXXIKMDTSF-KPVLKSH
RS9_LEPCP       KTVEEYFGRQTSIMICKQPLFLTNNAEAFDIKVNVHGGGESGQAGAVRHGVTRALIDYDAA-LKPELSNA
RS9_HERAR       KPANEYFSRETGLMVIRQPLELTNNVETFDIMVNVNGGGESGQAGAVRHGITRALIDYDAT-LKPELSKA
RS9_GEMAT       RTLGDYFPRPTLVSAIQQPFTLTDTLGRFDVKATIDGGGVSXXXXXXXXXXXXXXXXXD-ETNRKKLREF
RS9_BRAJA       REVEVYFARPVLRMMIEQPFSVAQRSGQYDVICTVAGGGLSGQAGAVRHGISKALTYFEPE-LRTVLKKG
RS9_BARHE       KEFDKYFARPVLRMILRQPIVATNRDTQFDIIATVAGGGLSGQAGAVRHGISKALTYYEPE-LRTILKKG
RS9_BACTN       RDLAEYFPSTILQYVVKQPLNKLGAAEKYDIKVNLCGGGFTGQSQXXXXXXXXXXXKMNAE-DKAALRAE
RS9_ACTP2       RSLDVYFGRETSRMVVRQPXXXXXXXXXXXXYITVKGGGISGQAGAIRHGITRALMEYD-ETLRPALRAA
RS9_RHOP5       REVEVYFARPVLRMMIQQPLVAAARAGQYDVICTVAGGGLSGQAGAVRHGISKALTYFEPE-LRGVLKKG
RS9_PROMA       RPGDHYLNNPAYLSAVKAPLHTLGLGEAYDVLVNVYGGGLTGQSDAIKQGAARALCELSVD-NRKPLKTE
RS9_PASMU       RDLDVYFGRETARMIVRQPLELVEMTEKLDLYVTVKGGGISGQAGAIRHGITRALIEYD-ESLRSVLRAA
RS9_DELAS       KDIQEYFGRETSIMIAKQPLALTSNLEAFDIQVNVHGGGESGQAGATRHGITRALIDYDAA-LKPVLSQA
RS9_CELJU       RPLDEYFGRPVARMVVRQPLELVDLVEKFDVNVTVSGGGSFGQAGAIRHGLTRALMEYD-ENLRSELRKA
RS9_BORA1       KPVDEFFARETGRMVVRQPLALTGHLESFDIKVNVIGGGETGQAGAVRHGITRALIDYDAT-LKPALSQA
RR9_GRATL       LPGESYLPN--YLRVSYSPLKILGLNKEYDIYVKTEGGGLTGQANAIRLGLARALCRMNPD-NRTTLKAE
RT09_DEBHA      KSLLEYFPKEADRRRIAYPFQVVSQEGQYNVFAEVQSGGSTGQAEAVMYGIAKDLVIFNP-LLKSRLHKS
RS9_RHISN       KPFSAYFARPVLQMILQQPIVAAARDGQFDVDATVAGGGLSGQAGAVRHGIAKALTYFEP-GLRSVLKRG
RS9_PROM4       RPGDHYLNNPAYLAAVKAPLQTLGLSDSYDVLVNVYGGGLTGQADAIKQGAARALCELSAD-NRKPLKIE
RS9_PROM3       RPGDHYLNNPAYLAAVKAPLQTLGLNEQYDVLVNVHGGGLTGQADAIKQGAARALCELSAD-NRKPLKTE
RS9_PETMO       KSLVEYLRNEVWEIEALKPLTVTSTNGQFDLVIRVNGGGLSGQAGAIRLGIARALLSYD-ESFRPILKKE
RS9_MARMS       RSIDQYFGRETARMVVRQPLELVDATEKFDVYITVKGGGISGQAGAIRHGITRALMQYD-ETLRRTLRSA
RS9_GEOUR       KTLDEYFGRETSKMVVKQPLELTENMGKFDIYVTVCGGGDSGQAGAIKHGITKALLEVDAA-LRGTLKKA
RS9_CLOBM       RDIENYFPIETLRVIVNQPLVLTETKDKYDVLVNVHGGGFTGQAGAVRHGISRALVKAD-ENMKSSLKKA
RS9_CLOBL       RDIENYFPIETLRVIVNQPLVLTETKDKYDVLVNVHGGGFTGQAGAVRHGISRALVKAD-ENMKSSLKKA
RS9_CLOBK       RDIENYFPIETLRVIVNQPLVLTETKDKYDVLVNVHGGGFTGQAGAVRHGISRALVKAD-ENMKSSLKKA
RS9_CLOBJ       RDIENYFPIETLRVIVNQPLVLTETKDKYDVLVNVHGGGFTGQAGAVRHGISRALVKAD-ENMKSSLKKA
RS9_CLOBH       RDIENYFPIETLRVIVNQPLVLTETKDKYDVLVNVHGGGFTGQAGAVRHGISRALVKAD-ENMKSSLKKA
RS9_CLOB6       RDIENYFPIETLRVIV