[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ56713.1

[Show Plain Result]


## Summary of Sequence Search
    1::248
  142::245     2e-11  31%  273 aa  YSNF_BACSU RecName: Full=Stress response protein ysnF;
   29::231     3e-09  26%  274 aa  Y1314_DEIRA RecName: Full=Uncharacterized protein DR_1314;
 1344::1452    6e-05  31% 1497 aa  TEX14_HUMAN RecName: Full=Testis-expressed protein 14;AltName:
 1091::1219    4e-04  24% 3664 aa  MINT_HUMAN RecName: Full=Msx2-interacting protein;AltName: Full=SPEN
  788::918     7e-04  30% 1173 aa  FBF1_MOUSE RecName: Full=Fas-binding factor 1;         Short=FBF-1;
  125::218     0.001  28%  288 aa  PEP12_YEAST RecName: Full=Syntaxin PEP12;AltName: Full=Vacuolar
    1::248

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxIGHKLIDQDGHSVGKIGQVYRDDQTQEPTWVTVHTGMFGHQESFVPLVGAEVTEQDLRVP
YSNF_BACSU      ----------------------------------------------------------------------
Y1314_DEIRA     ----------VGAAAYGVNGDKIGTVRDALVEPETGRIRYFLVDVGWFSSKEVLVPVGYGRVDDSGVYFD
TEX14_HUMAN     ----------------------------------------------------------------------
MINT_HUMAN      --------------------------------------------------------LAGESVENQEVQ--
FBF1_MOUSE      ----------------------------------------------------------------------
PEP12_YEAST     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FSKKMIKDSPRFETGGHLSPEQEAQLYEHYGVRPKVPGPRGDVEGVAEQERAQQKEETSMTVSEERARIG
YSNF_BACSU      ------------------------------------------------------KEEKTMPLREEQLKVD
Y1314_DEIRA     LTKDQVKD---------MSEYRADQAYSSEMMDTDERVLRGNQSQEEYHQRAYQTPDR-LQLLEERLVVN
TEX14_HUMAN     -----------------LKQQQGSSTVLHENTASDGGGTANDQRHLEEQETDSKKEDSSMLLSKETEDLG
MINT_HUMAN      -SKKPIPSKPQLKQLQVLDPEREDVRKNYCSLRDETP------------ERKSGQEKSHSVNTEEKIGID
FBF1_MOUSE      FSSSLNTLSSRVEAS-HLTTSQQREL----GIRQQDEQLRALQERLGRQQRDMEEEEQSRLLEQERWRVA
PEP12_YEAST     -----------------------------------------------EFQGIQRQFTQVMKQVNERAKES


                         +         .         .         .         .         *         .:210
query           VERTESGHARVHKTVEREEFEQDVPVRREELRIEREPVTGEEQAAATDRIGEQDQEITLHEERAVVGKEE
YSNF_BACSU      KEDVQTGEVEIGKEVKTEKRDMDIPVRHDEIYVERRPVDENKTDAAPVNDSEEIR-VPIVEEKLEVTKKP
Y1314_DEIRA     KDRFKAGSVQIGKRIETRQETVSVPLQREEVVIERHAVTGRAVEGAVLGEGHQTMSVDLEAERANISKQA
TEX14_HUMAN     -EDTERAHSTLDEDLERESVEQDLPKGSERETNIKDQKVGEEKRKREDSI--------------------
MINT_HUMAN      IDHTQSYRKQMEQSRRKQQMEMEI-AKSEKFGSPKKDVDEYERRSLVHEVGKPPQDVT------------
FBF1_MOUSE      AEKTKAESAQRTLEEQRKIMVQQIAMEREELERAKSALL-EEQKSVMNKCG-------------------
PEP12_YEAST     LEASEMANAALLDEEQRQNSSKSTRIPGSQIVIERDPINNEEFAYQQNLIEQRDQEIS-NIERGITELNE


                         .         .         .         +         .         .         .:280
query           VPVERVRISKEEVTDTERVxxxxxxxxxxxxxxxxxxx
YSNF_BACSU      VVTDEVVVGKRTVEENEHI-------------------
Y1314_DEIRA     YVTEEVSVGK----------------------------
TEX14_HUMAN     --------------------------------------
MINT_HUMAN      --------------------------------------
FBF1_MOUSE      --------------------------------------
PEP12_YEAST     V-------------------------------------