[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ56815.1

[Show Plain Result]


## Summary of Sequence Search
    1::390
   59::182     3e-18  37%  327 aa  HOLB_HAEIN RecName: Full=DNA polymerase III subunit delta';        
   59::169     1e-17  45%  340 aa  HOLB_YERPE RecName: Full=DNA polymerase III subunit delta';        
   28::329     7e-17  31%  329 aa  HOLB_BACSU RecName: Full=DNA polymerase III subunit delta';        
   28::176     4e-16  34%  688 aa  DPO3X_HAEIN RecName: Full=DNA polymerase III subunit gamma/tau;    
   38::184     1e-15  28%  563 aa  DPO3X_BACSU RecName: Full=DNA polymerase III subunit gamma/tau;    
   30::195     2e-15  34%  578 aa  DPO3X_MYCTU RecName: Full=DNA polymerase III subunit gamma/tau;    
   30::195     2e-15  34%  578 aa  DPO3X_MYCBO RecName: Full=DNA polymerase III subunit gamma/tau;    
   39::183     8e-15  33%  642 aa  DPO3X_SALTY RecName: Full=DNA polymerase III subunit tau;       
   39::183     8e-15  33%  643 aa  DPO3X_ECOLI RecName: Full=DNA polymerase III subunit tau;       
   60::182     3e-13  35%  336 aa  HOLB_BUCBP RecName: Full=DNA polymerase III subunit delta';        
   28::187     2e-12  30%  363 aa  DPO3X_BUCAP RecName: Full=DNA polymerase III subunit gamma;        
   39::181     1e-11  30%  361 aa  DPO3X_BUCAI RecName: Full=DNA polymerase III subunit gamma;        
   68::157     2e-11  43%  328 aa  HOLB_PSEAE RecName: Full=DNA polymerase III subunit delta';        
   39::184     4e-11  30%  370 aa  DPO3X_BUCBP RecName: Full=DNA polymerase III subunit gamma;        
   56::167     8e-10  33%  334 aa  HOLB_ECOLI RecName: Full=DNA polymerase III subunit delta';        
   59::166     9e-09  29%  326 aa  HOLB_BUCAI RecName: Full=DNA polymerase III subunit delta';        
   59::166     3e-08  29%  328 aa  HOLB_BUCAP RecName: Full=DNA polymerase III subunit delta';        
  115::198     2e-07  33%  352 aa  RFC5_NEUCR RecName: Full=Replication factor C subunit 5;       
   72::186     2e-07  23%  597 aa  DPO3X_MYCGE RecName: Full=DNA polymerase III subunit gamma/tau;    
   36::169     6e-07  21%  681 aa  DPO3X_MYCPN RecName: Full=DNA polymerase III subunit gamma/tau;    
  129::198     3e-06  34%  356 aa  RFC3_MOUSE RecName: Full=Replication factor C subunit 3;AltName:
  129::198     4e-06  34%  356 aa  RFC3_HUMAN RecName: Full=Replication factor C subunit 3;AltName:
  129::198     4e-06  34%  356 aa  RFC3_BOVIN RecName: Full=Replication factor C subunit 3;AltName:
   36::140     3e-05  29%  253 aa  Y007_MYCPN RecName: Full=Uncharacterized protein MG007 homolog;
  414::570     3e-05  24%  649 aa  RFCS_HALWD RecName: Full=Replication factor C small subunit;       
  102::179     4e-05  30%  338 aa  RFCS_METAC RecName: Full=Replication factor C small subunit;       
   86::184     4e-05  26%  322 aa  RFCS_HALSA RecName: Full=Replication factor C small subunit;       
   86::184     4e-05  26%  322 aa  RFCS_HALS3 RecName: Full=Replication factor C small subunit;       
   90::195     6e-05  24%  325 aa  RFCS_HALMA RecName: Full=Replication factor C small subunit;       
  111::174     6e-05  33%  340 aa  RFC3_YEAST RecName: Full=Replication factor C subunit 3;       
  127::192     6e-05  29%  347 aa  RFC3_DICDI RecName: Full=Probable replication factor C subunit
  102::179     8e-05  29%  338 aa  RFCS_METMA RecName: Full=Replication factor C small subunit;       
   98::171     8e-05  30%  334 aa  RFCS_METBF RecName: Full=Replication factor C small subunit;       
   80::174     1e-04  26%  447 aa  RARA_ECOLI RecName: Full=Replication-associated recombination
   80::174     1e-04  26%  447 aa  RARA_ECOL6 RecName: Full=Replication-associated recombination
   80::174     1e-04  26%  447 aa  RARA_ECO57 RecName: Full=Replication-associated recombination
   88::193     2e-04  28%  325 aa  RFCS_NATPD RecName: Full=Replication factor C small subunit;       
   83::182     2e-04  29%  325 aa  RFCS_AERPE RecName: Full=Replication factor C small subunit;       
   93::165     2e-04  31%  338 aa  RFC3_ARXAD RecName: Full=Replication factor C subunit 3;       
   82::167     3e-04  27%  323 aa  RFCS_METHJ RecName: Full=Replication factor C small subunit;       
  119::187     8e-04  32%  368 aa  RFC5_CAEEL RecName: Full=Probable replication factor C subunit
    1::390

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxLLSGGDGTGMTHAWLFTGPPXXXXXXXXXXXXXXLQCTHGGCGE
HOLB_HAEIN      -------------------------------------------------------------------CGQ
HOLB_YERPE      -------------------------------------------------------------------CGE
HOLB_BACSU      -----------------------------------LSHAYLFEGKKGTGKLDAALLLAKSFFCLEGGCES
DPO3X_HAEIN     --------------------------LANGLKDNRLHHAYLFSGTRGVGKTSIARLFAKGLNCVHGPCGE
DPO3X_BACSU     ------------------------------------SHAYLFSGPRGTGKTSAAKIFAKAVNCEHAPCNE
DPO3X_MYCTU     -------------------------------DAGRINHAYLFSGPRGCGKTSSARILARSLNCAQGPCGV
DPO3X_MYCBO     -------------------------------DAGRINHAYLFSGPRGCGKTSSARILARSLNCAQGPCGV
DPO3X_SALTY     -------------------------------------HAYLFSGTRGVGKTSIARLLAKGLNCETGPCGV
DPO3X_ECOLI     -------------------------------------HAYLFSGTRGVGKTSIARLLAKGLNCETGPCGV
HOLB_BUCBP      -------------------------------------------------------------------CKT
DPO3X_BUCAP     ---------------------------ISNGFSLGIHHAWLLSGTRGVGKTTIARLIAKSLNCEIGPCRK
DPO3X_BUCAI     -------------------------------------HAWLLSGTRGIGKTTIARLLAKSLNCQNGPCRQ
HOLB_PSEAE      ----------------------------------------------------------------------
DPO3X_BUCBP     -------------------------------------HAWLFFGIRGTGKTTIARILAKSLNCKLGPCRK
HOLB_ECOLI      ----------------------------------------------------------------HKSCGH
HOLB_BUCAI      -------------------------------------------------------------------CDK
HOLB_BUCAP      -------------------------------------------------------------------CDN
RFC5_NEUCR      ----------------------------------------------------------------------
DPO3X_MYCGE     -------------------------------------------------------------------CNS
DPO3X_MYCPN     -----------------------------------LPHGYIFAGERGTGKTTFAKIIAKAINCLNWNCNQ
RFC3_MOUSE      ----------------------------------------------------------------------
RFC3_HUMAN      ----------------------------------------------------------------------
RFC3_BOVIN      ----------------------------------------------------------------------
Y007_MYCPN      ------------------------------------------------------------------GCQT
RFCS_HALWD      ----------------------------------------------------------------------
RFCS_METAC      ----------------------------------------------------------------------
RFCS_HALSA      ----------------------------------------------------------------------
RFCS_HALS3      ----------------------------------------------------------------------
RFCS_HALMA      ----------------------------------------------------------------------
RFC3_YEAST      ----------------------------------------------------------------------
RFC3_DICDI      ----------------------------------------------------------------------
RFCS_METMA      ----------------------------------------------------------------------
RFCS_METBF      ----------------------------------------------------------------------
RARA_ECOLI      ----------------------------------------------------------------------
RARA_ECOL6      ----------------------------------------------------------------------
RARA_ECO57      ----------------------------------------------------------------------
RFCS_NATPD      ----------------------------------------------------------------------
RFCS_AERPE      ----------------------------------------------------------------------
RFC3_ARXAD      ----------------------------------------------------------------------
RFCS_METHJ      ----------------------------------------------------------------------
RFC5_CAEEL      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           CASCHQVLAGTHPDVLYVRPSGLSFGVEQTRELVVRAASSPTGGRFRVVLFEDADRATEAASNALLKAIE
HOLB_HAEIN      CHSCHLMQAHSHPDYHELSPNGKDIGVDQVRDINEMVAQHAQQNGNKVVYVQGAERLTEAAANALLKTLE
HOLB_YERPE      CHSCRLMLAGNHPDVLTPEKGKSSIGVELVRQLIDKLYSHAQQGGAKVVWLPHAEVLTDAAANALLKTLE
HOLB_BACSU      CRNCKRIESGNHPDLHLVQPDGLSIKKAQIQALQEEFSKTGLESHKKLYIISHADQMTANAANSLLKFLE
DPO3X_HAEIN     CENCKAIEQGNFIDLIEIDAASRT-KVEDTRELLDNVQYKPVVGRFKVYLIDEVHMLSRHSFNALLKTLE
DPO3X_BACSU     CAACKGITNGSISDVIEIDAASNN-GVDEIRDIRDKVKFAPSAVTYKVYIIDEVHMLSIGAFNALLKTLE
DPO3X_MYCTU     CESCVSLAPNAPGSIDVVELDAASHGVDDTRELRDRAFYAPVQSRYRVFIVDEAHMVTTAGFNALLKIVE
DPO3X_MYCBO     CESCVSLAPNAPGSIDVVELDAASHGVDDTRELRDRAFYAPVQSRYRVFIVDEAHMVTTAGFNALLKIVE
DPO3X_SALTY     CDNCREIEQGRFVDLIEIDAASRT-KVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLE
DPO3X_ECOLI     CDNCREIEQGRFVDLIEIDAASRT-KVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLE
HOLB_BUCBP      CHSCQLMNSKNHPDWHYFKNSSKTIGVNEVRNFTNTIFNSAQQGQNKIVYIPNIKKLTEFAINSLLKIIE
DPO3X_BUCAP     CTICQEIEKGICLDFIEIDAASRT-KVEEIREILDNIYYTPSKSRFKVYLIDEVHMLSRHSFNALLKTLE
DPO3X_BUCAI     CIICKEIEKGLCLDVIEIDGASRT-KVEEMREILDSIYYSPIKSRFKVYLIDEVHMLSRHSFNALLKTLE
HOLB_PSEAE      --------AGTHPDYFVLEPEEAEIRVDQVRDLVGFVVQTAQLGGRKVVLLEPAEAMNVNAANALLKSLE
DPO3X_BUCBP     CSNCVEVEQGNFID-LYEVDAASRTKVEDMKELLDNIRYLPSKGRFKIYLIDEVHMLSRYSFNFLLKNIE
HOLB_ECOLI      CRGCQLMQAGTHPDYYTLAPGKNTLGVDAVREVTEKLNEHARLGGAKVVWVXXXXXXXXXXXXXXXXXXE
HOLB_BUCAI      CHGCKLMSANNHPDWHNFTPEKNNFSIESVRIINEKIFTCSRQGGSKIIFLSDTGKLTESAINAFLKTLE
HOLB_BUCAP      CHGCKLMSANNHPDWTIINEKNDVFDVDSIRVINEKIFKRAQQGNNKIIFLPNVHKLTESAVNALLKILE
RFC5_NEUCR      --------------------------VAQTQQVDLSAKQ-----RFKVVVINEADHLTRDAQAALRRTME
DPO3X_MYCGE     CDVCKSINTNSAIDIVEIDAASKN-GINDIRELVENVFNHPFTFKKKVYILDEAHMLTTQSWGGLLKTLE
DPO3X_MYCPN     CEACQAINSNSAIDVFEIDAASKN-GINDIRELAENVFNLPFKFKKKVYILDEAHMLTPQSWSGLLKTLE
RFC3_MOUSE      ---------------------------------------------FKVVLLTEVDKLTKDAQHALRRTME
RFC3_HUMAN      ---------------------------------------------FKVVLLTEVDKLTKDAQHALRRTME
RFC3_BOVIN      ---------------------------------------------FKVVLLTEVDKLTKDAQHALRRTME
Y007_MYCPN      CPSCLEILHGTYNN-FYSFDQANPFKREHALHLSEVLNRQSESNQKQLYLIKNLETLTATAMNSLLRLIE
RFCS_HALWD      -------------------------GIDVVRDRIKNFARSSFGGYHRIIFLDEADSLTDDAQSALRRTME
RFCS_METAC      ------------------------------------AKTAPIGGAFKIIFLDEADALTADAQSALRRTME
RFCS_HALSA      -------------------------GIDVVRDRIKDFARSSFGGHYRVIFLDEADALTDDAQSALRRTME
RFCS_HALS3      -------------------------GIDVVRDRIKDFARSSFGGHYRVIFLDEADALTDDAQSALRRTME
RFCS_HALMA      -------------------------GIDVVRDRIKNFARTSFGGEYRIIFLDEADALTSDAQSALRRTME
RFC3_YEAST      ---------------------------------------------FKLIILDEADAMTNAAQNALRRVIE
RFC3_DICDI      -------------------------------------------GAFKIVILNEVDKLSKDAQHALRRTME
RFCS_METMA      ------------------------------------AKTAPMGGAFKIIFLDEADALTSDAQSALRRTME
RFCS_METBF      ------------------------------------AKTAPMGGEFKIIFLDEADALTSDAQSALRRTME
RARA_ECOLI      ------------------RISAVTSGVKEIREAIERARQNRNAGRRTILFVDEVHRFNKSQQDAFLPHIE
RARA_ECOL6      ------------------RISAVTSGVKEIREAIERARQNRNAGRRTILFVDEVHRFNKSQQDAFLPHIE
RARA_ECO57      ------------------RISAVTSGVKEIREAIERARQNRNAGRRTILFVDEVHRFNKSQQDAFLPHIE
RFCS_NATPD      -------------------------GIDVVRDRIKSFARASFGGYHRIIFLDEADALTSDAQSALRRTME
RFCS_AERPE      -------------------------GINVIREKVKEFARSRTPPEFKIVLLDEADNMTSDAQQALRRLME
RFC3_ARXAD      -------------------------GIDVVRDQIKTFASTRQSSGFKLVILDEADAMTNAAQNALRRIIE
RFCS_METHJ      -------------------------GIDVVRNQIKQARTSPFGGSFKILFLDEADALTTDAQSALRRTME
RFC5_CAEEL      ----------------------------QTKGLQAFSTSSNTGTPFKLVILDEADAMTKDAQNALRRVIE


                         +         .         .         .         .         *         .:210
query           EPAPRTVWLLCTPTAHDLLVTIRSRCRLVNLRTPSTEAIIDALVTRDGIDXXXXXXXXXXXXXXXXXXXQ
HOLB_HAEIN      EPRPNTYFXXXXXXXXXXXXTIYSRCQVWNLSVPNEEIAFEWLKSKSAVE--------------------
HOLB_YERPE      EPPEKTYFLLDCHQPASLLATLRSRCFYWYLACPDT----------------------------------
HOLB_BACSU      EPNKDTMAVLITEQPQRLLDTIISRCQTLPFQPLQPKAIEDRLIEQD-----------------------
DPO3X_HAEIN     EPPEYVKFLLATTDPQKLPVTILSRCLQFHLK--------------------------------------
DPO3X_BACSU     EPPEHCIFILATTEPHKIPLTIISRCQRFDFKRITSQAIV------------------------------
DPO3X_MYCTU     EPPEHLIFIFATTEPEKVLPTIRSRTRLLPPRT--MRALLARICEQEGV---------------------
DPO3X_MYCBO     EPPEHLIFIFATTEPEKVLPTIRSRTRLLPPRT--MRALLARICEQEGV---------------------
DPO3X_SALTY     EPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQI-------------------------------
DPO3X_ECOLI     EPPEHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQI-------------------------------
HOLB_BUCBP      EPPQNTYFLLINYLPHKIITTLRSRCIIHNLYGPTKENRIEWL---------------------------
DPO3X_BUCAP     EPPQHIKFILATTDVEKIPKTIRSRCLHFKLNILSEEDIFNFL---------------------------
DPO3X_BUCAI     EPPEHVKFVLATTDVDRIPKTIISRCLYFKLQIISEE---------------------------------
HOLB_PSEAE      EPSGDTVLLLISHQPSRLLPTIKSRC--------------------------------------------
DPO3X_BUCBP     EPPQHIKFILATTNLEKIPDTILSRCLQFQLKPINLNEIV------------------------------
HOLB_ECOLI      EPPAETWFFLATREPERLLATLRSRCRLHYLAPP------------------------------------
HOLB_BUCAI      EPPRKTWFFLVNYKNLNSHSTLNSRCLIYKLFIP------------------------------------
HOLB_BUCAP      EPPEKNWFFLIDYNYLKLHSTLKSRCFLYRLPLP------------------------------------
RFC5_NEUCR      KYSPNLRLILLANSTANIIAPIRSRCLLVRVAAPTHKEICDVLAS-------------------------
DPO3X_MYCGE     ESPPYVLFIFTTTEFNKIPLTILSRCQSFFFKKITSDLILERL---------------------------
DPO3X_MYCPN     EAPDYVLFIFATTEFNKIPITILSRCQ-------------------------------------------
RFC3_MOUSE      KYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICSVLST-------------------------
RFC3_HUMAN      KYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLST-------------------------
RFC3_BOVIN      KYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLST-------------------------
Y007_MYCPN      EHPVNTYGVFTTKNENMILPTILSRVQKVVLK--------------------------------------
RFCS_HALWD      QFADNTRFILSCNYSSKIIDPIQSRCAVIRGQTKDIAAAENIELTEDGLDALVYAAGGDMRRAINSLQAA
RFCS_METAC      RFSSNCRFILSCNYSSKIIEPIQSRCAVYRFRRLSDEAIKERL---------------------------
RFCS_HALSA      QFSNNTRFILSCNYSSKIIDPIQSRCRFAQLGDDAVAAHLREIAETEGLE--------------------
RFCS_HALS3      QFSNNTRFILSCNYSSKIIDPIQSRCRFAQLGDDAVAAHLREIAETEGLE--------------------
RFCS_HALMA      QFSNNVRFILSCNYSSQIIDPIQSRCAVFRFSPLADDAVAEEILTEDGLD--------------------
RFC3_YEAST      RYTKNTRFCVLANYAHKLTPALLSRCTRFRFQPLPQEAI-------------------------------
RFC3_DICDI      KYATFCRLILCCDSTAKVIDPIKSRCLGIRVPAPSQEEI-------------------------------
RFCS_METMA      KFSSNCRFILSCNYSSKIIEPIQSRCAVYRFRRLSDKAIRERL---------------------------
RFCS_METBF      RFSNNCRFILSCNYSSRIIEPIQSRCAVFRFRRLSDEAI-------------------------------
RARA_ECOLI      DGTITFIGATTENPSFELNSALLSRARVYLLKSLSTEDIEQVL---------------------------
RARA_ECOL6      DGTITFIGATTENPSFELNSALLSRARVYLLKSLSTEDIEQVL---------------------------
RARA_ECO57      DGTITFIGATTENPSFELNSALLSRARVYLLKSLSTEDIEQVL---------------------------
RFCS_NATPD      QFSDNTRFILSCNYSSQIIDPIQSRCAVFRF-SPLGDAAVDEQITDDGVD--------------------
RFCS_AERPE      LYSSVTRFILIANYPSKIIDPIQSRCAFFRFQPLSKQDVIERLAENEGVD--------------------
RFC3_ARXAD      KYSAHTRFCILANYTHKLNPALLSRC--------------------------------------------
RFCS_METHJ      TYAQTCRFILSCNYSAKIIDPIQSRCAIYRFRPLGRQAV-------------------------------
RFC5_CAEEL      KYTDNVRFCIICNYLASIVPAIQSRC--------------------------------------------


                         .         .         .         +         .         .         .:280
query           LATDETARARREEVLTIPARLDSLGACVHAAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
HOLB_HAEIN      ----------------------------------------------------------------------
HOLB_YERPE      ----------------------------------------------------------------------
HOLB_BACSU      ----------------------------------------------------------------------
DPO3X_HAEIN     ----------------------------------------------------------------------
DPO3X_BACSU     ----------------------------------------------------------------------
DPO3X_MYCTU     ----------------------------------------------------------------------
DPO3X_MYCBO     ----------------------------------------------------------------------
DPO3X_SALTY     ----------------------------------------------------------------------
DPO3X_ECOLI     ----------------------------------------------------------------------
HOLB_BUCBP      ----------------------------------------------------------------------
DPO3X_BUCAP     ----------------------------------------------------------------------
DPO3X_BUCAI     ----------------------------------------------------------------------
HOLB_PSEAE      ----------------------------------------------------------------------
DPO3X_BUCBP     ----------------------------------------------------------------------
HOLB_ECOLI      ----------------------------------------------------------------------
HOLB_BUCAI      ----------------------------------------------------------------------
HOLB_BUCAP      ----------------------------------------------------------------------
RFC5_NEUCR      ----------------------------------------------------------------------
DPO3X_MYCGE     ----------------------------------------------------------------------
DPO3X_MYCPN     ----------------------------------------------------------------------
RFC3_MOUSE      ----------------------------------------------------------------------
RFC3_HUMAN      ----------------------------------------------------------------------
RFC3_BOVIN      ----------------------------------------------------------------------
Y007_MYCPN      ----------------------------------------------------------------------
RFCS_HALWD      ATTGEVVDEETVYTITSTARPEDIETMVTAA---------------------------------------
RFCS_METAC      ----------------------------------------------------------------------
RFCS_HALSA      ----------------------------------------------------------------------
RFCS_HALS3      ----------------------------------------------------------------------
RFCS_HALMA      ----------------------------------------------------------------------
RFC3_YEAST      ----------------------------------------------------------------------
RFC3_DICDI      ----------------------------------------------------------------------
RFCS_METMA      ----------------------------------------------------------------------
RFCS_METBF      ----------------------------------------------------------------------
RARA_ECOLI      ----------------------------------------------------------------------
RARA_ECOL6      ----------------------------------------------------------------------
RARA_ECO57      ----------------------------------------------------------------------
RFCS_NATPD      ----------------------------------------------------------------------
RFCS_AERPE      ----------------------------------------------------------------------
RFC3_ARXAD      ----------------------------------------------------------------------
RFCS_METHJ      ----------------------------------------------------------------------
RFC5_CAEEL      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLVAFYRDVLAIQLGASVELSTXXXXXXXXXXXXS
HOLB_HAEIN      ----------------------------------------------------------------------
HOLB_YERPE      ----------------------------------------------------------------------
HOLB_BACSU      ------------------------------------LLLIYRDVLSIQIGNEDKLIYQDLFQSIKQHALQ
DPO3X_HAEIN     ----------------------------------------------------------------------
DPO3X_BACSU     ----------------------------------------------------------------------
DPO3X_MYCTU     ----------------------------------------------------------------------
DPO3X_MYCBO     ----------------------------------------------------------------------
DPO3X_SALTY     ----------------------------------------------------------------------
DPO3X_ECOLI     ----------------------------------------------------------------------
HOLB_BUCBP      ----------------------------------------------------------------------
DPO3X_BUCAP     ----------------------------------------------------------------------
DPO3X_BUCAI     ----------------------------------------------------------------------
HOLB_PSEAE      ----------------------------------------------------------------------
DPO3X_BUCBP     ----------------------------------------------------------------------
HOLB_ECOLI      ----------------------------------------------------------------------
HOLB_BUCAI      ----------------------------------------------------------------------
HOLB_BUCAP      ----------------------------------------------------------------------
RFC5_NEUCR      ----------------------------------------------------------------------
DPO3X_MYCGE     ----------------------------------------------------------------------
DPO3X_MYCPN     ----------------------------------------------------------------------
RFC3_MOUSE      ----------------------------------------------------------------------
RFC3_HUMAN      ----------------------------------------------------------------------
RFC3_BOVIN      ----------------------------------------------------------------------
Y007_MYCPN      ----------------------------------------------------------------------
RFCS_HALWD      ----------------------------------------------------------------------
RFCS_METAC      ----------------------------------------------------------------------
RFCS_HALSA      ----------------------------------------------------------------------
RFCS_HALS3      ----------------------------------------------------------------------
RFCS_HALMA      ----------------------------------------------------------------------
RFC3_YEAST      ----------------------------------------------------------------------
RFC3_DICDI      ----------------------------------------------------------------------
RFCS_METMA      ----------------------------------------------------------------------
RFCS_METBF      ----------------------------------------------------------------------
RARA_ECOLI      ----------------------------------------------------------------------
RARA_ECOL6      ----------------------------------------------------------------------
RARA_ECO57      ----------------------------------------------------------------------
RFCS_NATPD      ----------------------------------------------------------------------
RFCS_AERPE      ----------------------------------------------------------------------
RFC3_ARXAD      ----------------------------------------------------------------------
RFCS_METHJ      ----------------------------------------------------------------------
RFC5_CAEEL      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           STPEATLRRIDAIMECRRRINANVHPQIAMEAMTAALYLG
HOLB_HAEIN      ----------------------------------------
HOLB_YERPE      ----------------------------------------
HOLB_BACSU      STQQSVTNQILAVLEAKKRLHSNVNVQGLMEHLVLMLQEG
DPO3X_HAEIN     ----------------------------------------
DPO3X_BACSU     ----------------------------------------
DPO3X_MYCTU     ----------------------------------------
DPO3X_MYCBO     ----------------------------------------
DPO3X_SALTY     ----------------------------------------
DPO3X_ECOLI     ----------------------------------------
HOLB_BUCBP      ----------------------------------------
DPO3X_BUCAP     ----------------------------------------
DPO3X_BUCAI     ----------------------------------------
HOLB_PSEAE      ----------------------------------------
DPO3X_BUCBP     ----------------------------------------
HOLB_ECOLI      ----------------------------------------
HOLB_BUCAI      ----------------------------------------
HOLB_BUCAP      ----------------------------------------
RFC5_NEUCR      ----------------------------------------
DPO3X_MYCGE     ----------------------------------------
DPO3X_MYCPN     ----------------------------------------
RFC3_MOUSE      ----------------------------------------
RFC3_HUMAN      ----------------------------------------
RFC3_BOVIN      ----------------------------------------
Y007_MYCPN      ----------------------------------------
RFCS_HALWD      ----------------------------------------
RFCS_METAC      ----------------------------------------
RFCS_HALSA      ----------------------------------------
RFCS_HALS3      ----------------------------------------
RFCS_HALMA      ----------------------------------------
RFC3_YEAST      ----------------------------------------
RFC3_DICDI      ----------------------------------------
RFCS_METMA      ----------------------------------------
RFCS_METBF      ----------------------------------------
RARA_ECOLI      ----------------------------------------
RARA_ECOL6      ----------------------------------------
RARA_ECO57      ----------------------------------------
RFCS_NATPD      ----------------------------------------
RFCS_AERPE      ----------------------------------------
RFC3_ARXAD      ----------------------------------------
RFCS_METHJ      ----------------------------------------
RFC5_CAEEL      ----------------------------------------