[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ57003.1

[Show Plain Result]


## Summary of Sequence Search
    1::792
    5::796       0.0  68%  804 aa  PHK_MYCA1 RecName: Full=Probable phosphoketolase;       
    5::796       0.0  68%  804 aa  PHK_MYCPA RecName: Full=Probable phosphoketolase;       
    1::791       0.0  65%  793 aa  PHK2_ANASP RecName: Full=Probable phosphoketolase 2;       
   10::802       0.0  66%  807 aa  PHK_NITMU RecName: Full=Probable phosphoketolase;       
    6::787       0.0  66%  790 aa  PHK_NITEU RecName: Full=Probable phosphoketolase;       
   12::791       0.0  64%  793 aa  PHK_GLOVI RecName: Full=Probable phosphoketolase;       
   25::796       0.0  65%  801 aa  PHK_BRAJA RecName: Full=Probable phosphoketolase;       
    1::792       0.0  64%  793 aa  PHK_STRAW RecName: Full=Probable phosphoketolase;       
    8::790       0.0  63%  791 aa  PHK_CHLTE RecName: Full=Probable phosphoketolase;       
    5::793       0.0  64%  796 aa  PHK_STRCO RecName: Full=Probable phosphoketolase;       
   14::795       0.0  63%  807 aa  PHK_RHILO RecName: Full=Probable phosphoketolase;       
   10::781       0.0  64%  783 aa  PHK_RHOPT RecName: Full=Probable phosphoketolase;       
   10::781       0.0  64%  783 aa  PHK_RHOPA RecName: Full=Probable phosphoketolase;       
    1::766       0.0  64%  789 aa  PHK1_RHIME RecName: Full=Probable phosphoketolase 1;       
   22::793       0.0  62%  798 aa  PHK_PARUW RecName: Full=Probable phosphoketolase;       
    7::785       0.0  62%  789 aa  PHK_BRUSU RecName: Full=Probable phosphoketolase;       
   10::788       0.0  62%  792 aa  PHK_BRUME RecName: Full=Probable phosphoketolase;       
    7::785       0.0  62%  789 aa  PHK_BRUA2 RecName: Full=Probable phosphoketolase;       
    1::771       0.0  63%  779 aa  PHK2_RHIME RecName: Full=Probable phosphoketolase 2;       
   15::789       0.0  61%  793 aa  PHK_RHOBA RecName: Full=Probable phosphoketolase;       
   42::817       0.0  62%  822 aa  PHK_NOCFA RecName: Full=Probable phosphoketolase;       
   10::783       0.0  61%  784 aa  PHK_RHOP2 RecName: Full=Probable phosphoketolase;       
   13::793       0.0  60%  795 aa  PHK_BEII9 RecName: Full=Probable phosphoketolase;       
    5::782       0.0  60%  784 aa  PHK_RHOPB RecName: Full=Probable phosphoketolase;       
   10::783       0.0  59%  784 aa  PHK_RHOPS RecName: Full=Probable phosphoketolase;       
   24::810       0.0  56%  812 aa  PHK_THEEB RecName: Full=Probable phosphoketolase;       
   17::803       0.0  55%  805 aa  PHK_SYNY3 RecName: Full=Probable phosphoketolase;       
   21::806       0.0  57%  808 aa  PHK1_ANASP RecName: Full=Probable phosphoketolase 1;       
    1::794       0.0  57%  796 aa  PHK_SYNP6 RecName: Full=Probable phosphoketolase;       
    1::794       0.0  57%  796 aa  PHK_SYNE7 RecName: Full=Probable phosphoketolase;       
   29::809       0.0  54%  811 aa  PHK_METCA RecName: Full=Probable phosphoketolase;       
   14::794       0.0  56%  796 aa  PHK_CLOAB RecName: Full=Probable phosphoketolase;       
    9::785       0.0  56%  791 aa  PHK_PSEP1 RecName: Full=Probable phosphoketolase;       
   11::785       0.0  48%  788 aa  XPKA_LACPE RecName: Full=Xylulose-5-phosphate phosphoketolase;     
   11::785       0.0  48%  788 aa  PHK1_LACPL RecName: Full=Probable phosphoketolase 1;       
   12::784       0.0  47%  787 aa  PHK_PEDPA RecName: Full=Probable phosphoketolase;       
   10::785       0.0  47%  787 aa  PHK_LACSS RecName: Full=Probable phosphoketolase;       
   25::799       0.0  48%  803 aa  PHK2_LACPL RecName: Full=Probable phosphoketolase 2;       
   22::803       0.0  47%  825 aa  XFP_BIFAS RecName: Full=Xylulose-5-phosphate/fructose-6-phosphate
   22::803       0.0  47%  825 aa  PHK_BIFA0 RecName: Full=Probable phosphoketolase;       
   10::817     e-173  42%  822 aa  PHK_LACLA RecName: Full=Probable phosphoketolase;       
   41::804     e-165  41%  825 aa  PHK_SCHPO RecName: Full=Probable phosphoketolase;       
    1::792

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTSTESVPRQALTVTELQEIDRYWRAANYLSVGQIYLQDNPLLREPLVPEHIKPRLLGHWGTTPGLNFIY
PHK_MYCA1       -TSTTTPAGSPLSDRELDLIDKYWRAANYLSVGQIYLLDNPLLKEPLSAEHVKPRLLGHWGTTPGLNLVY
PHK_MYCPA       -TSTTTPAGSPLSDRELDLIDKYWRAANYLSVGQIYLLDNPLLKEPLSAEHVKPRLLGHWGTTPGLNLVY
PHK2_ANASP      MTLASPPQIKPLTDEELHKINAYWRAANYLSVGQIYLLDNPLLREPLNKEHVKPRLLGHWGTTPGLNFIY
PHK_NITMU       ---TESNP---LSTDELRKIDAYWRAANYLSVGQIYLLDNPLLKEPLTVTHIKPRLLGHWGTCPGLSFIY
PHK_NITEU       ---------QPLTPDELQKIDAYWRAANYLSVGQIYLLDNPLLQTPLTLQHIKPRLLGHWGTTPGLNFIY
PHK_GLOVI       -----------LSTEQLQKMHAYWRAANYLSVGQIYLMDNPLLREPLKLEHVKPRLLGHWGTTPGLNFIY
PHK_BRAJA       ---------------------RYWRAANYLSVGQIYLLDNPLLREPLRAEHIKPRLLGHWGTTPGLNFIY
PHK_STRAW       MPQVEHQNSTVLTDDELRTLDAHWRAANYLAAGQIYLLANALLTEPLSPAHIKPRLLGHWGTSPGLNLVH
PHK_CHLTE       -----------LSPRELDLMNAYWRAANYLSVGQIYLMDNPLLKEPLSKEHIKPRLLGHWGTTPGLNFLY
PHK_STRCO       ---TQQAPPEP-TDEELAGLDAHWRAANYLAVGQIYLMANPLLTDPLRPEHVKPRLLGHWGTSPGLNLVH
PHK_RHILO       -----------LSDRELHDLDAYWRAANYLTIGQIYLLDNPLLREPLRLEHVKPRLLGHWGTSPGLSFIY
PHK_RHOPT       ----------------LQKMDAYWRAANYLSVGQIYLQDNPLLDQKLQLDHIKPRLLGHWGTTPGLNLLY
PHK_RHOPA       ----------------LQKMDAYWRAANYLSVGQIYLQDNPLLDQKLQLDHIKPRLLGHWGTTPGLNLLY
PHK1_RHIME      -------------------MDAYWRASNYLSVGQIYLLDNPLLSEPLKREHIKPRLLGHWGTSPGLNMLY
PHK_PARUW       ------------------KINAYWRAANYLSVGQIYLLDNPLLKKPLSIKDIKPRLLGHWGTTPGLNFIY
PHK_BRUSU       -----------LTPQQLSLINRYWRAANYLSVGQIYLMKNPLLREPLQPEHIKPRLLGHWGTTPGLNFIY
PHK_BRUME       -----------LTPQQLSLINRYWRAANYLSVGQIYLMKNPLLREPLQPEHIKPRLLGHWGTTPGLNFIY
PHK_BRUA2       -----------LTPQQLSLINRYWRAANYLSVGQIYLMKNPLLREPLQPEHIKPRLLGHWGTTPGLNFIY
PHK2_RHIME      -------------------MDAYWRAANYLSVGQIYLRDNPLLKQKLTLADVKPRLLGHWGTTPGLNFLY
PHK_RHOBA       ----------------LRTIDAYWRAANYLSVGQIYLSDNPLLKRPLRIEDVKKMLLGHWGTTPGQNFIY
PHK_NOCFA       ---------------ELAALDAWWRAANYLSVGQIYLMANPLLTEPLRPEHIKPRLLGHFGTVPGLNLVW
PHK_RHOP2       ----------------MQKMDAYWRAANYLSVGQIYLQDNPLLEQPLQLEHIKPRLLGHWGTTPGLNLLY
PHK_BEII9       ---------QPLSPDLLQRLNAWWRAANYLSVAQLYLLDNPLLRQKLTLDHIKPRLLGHWGTTPGLNFIY
PHK_RHOPB       -----------LTSDLLEKMHAYWRAANYLSVGQIYLQDNPLLEVPLRLDHIKPRLLGHWGTTPGLNLLY
PHK_RHOPS       ----------------MQKMDAYWRAANYLSVGQIYLQDNPLLEQPLRIEHIKPRLLGHWGTTPGLNLLY
PHK_THEEB       -----TIQGQPLSDSEVEAMDAFFRACNYLAVGMIYLLDNPLLKEPLKPEHIKKRLLGHWGSSPGLAFCY
PHK_SYNY3       -----TVTGNPLDPTELNQMHGFWRAANYLAVGMIYLRDNPLLREPLQPEQIKHRLLGHWGSSPGISFLY
PHK1_ANASP      -----------LSTEELYQINAYWRACNYLALGMIYLQDNPLLKQPLKPGHIKNRLLGHWGSSPGLSFIY
PHK_SYNP6       MTSTQATDIATLSPNEQAAIDAWWRAANYLSVGQIYLRDNPLLQEPLRPEHIKQRLLGHWGSDPGLSFVY
PHK_SYNE7       MTSTQATDIATLSPNEQAAIDAWWRAANYLSVGQIYLRDNPLLQEPLRPEHIKQRLLGHWGSDPGLSFVY
PHK_METCA       -----------LDAEEVRKIHAFWRACNYLALGMIYLRGNPLLREPLKPEHIKHRLLGHWGSSPNLAFVY
PHK_CLOAB       -----------ITPEYLKKIDAYWRAANFISVGQLYLLDNPLLREPLKPEHLKRKVVGHWGTIPGQNFIY
PHK_PSEP1       ---------------ELESLDAYWRAANYLTVGQIYLQGNALLTRPLTLADVKPRLLGHWGTSPGLNLVY
XPKA_LACPE      ----------------LQKVDKYWRAANYLSVGQLYLKDNPLLQRPLKASDVKVHPIGHWGTIAGQNFIY
PHK1_LACPL      ----------------LQKVDKYWRAANYLSVGQLYLKDNPLLQRPLKASDVKVHPIGHWGTIAGQNFIY
PHK_PEDPA       ------------------KLEKFWRAANYLSVGQLYLKDNPLLKRDIKPEDVKVHPIGHWGTIPGQNYIY
PHK_LACSS       ----------------LAKVDAFWRAANYISVGQLYLKDNPLLQRPLEAKDVKVKPIGHWGTISGQNFLY
PHK2_LACPL      ----------------LKRVDEYWRAANYISVGQLYLLNNPLLREPLKATDVKVHPIGHWGTIAGQNFIY
XFP_BIFAS       ----------------IEGMDKYWRVANYMSIGQIYLRSNPLMKEPFTRDDVKHRLVGHWGTTPGLNFLL
PHK_BIFA0       ----------------IEGMDKYWRVANYMSIGQIYLRSNPLMKEPFTRDDVKHRLVGHWGTTPGLNFLL
PHK_LACLA       ----------------LKKLDKWWRAATYLGAGMIFLKENPLFSTPIKAENLKANPIGHWGTVSGQTFLY
PHK_SCHPO       -TLEAKIDTSKITDEEVANVHRFQRACDYLAASLIFLSNGLYTGGDLEEKDIKTRLLGHWGTCPGLSIVY


                         .         .         *         .         .         .         .:140
query           AHLNHQIRSRGTEMMWIVGPGHGGPSPVATAWLDGVYSQIYPDVGRNAEGMRRLFRQFSFPGGVPSHAAP
PHK_MYCA1       AHLNRIIRNRDADVIYVTGPGHGGPGLVANAYLEGTYSEVYTGIEEDAEGLRKLFRQFSFPGGIPSHVAA
PHK_MYCPA       AHLNRIIRNRDADVIYVTGPGHGGPGLVANAYLEGTYSEVYTGIEEDAEGLRKLFRQFSFPGGIPSHVAA
PHK2_ANASP      VHLNRIIKKYDQSMVYIAGPGHGGPGLVANTYLEGTYSEYYPNISQDAGGMQKLFKQFSFPGGIPSHVAP
PHK_NITMU       AHLNRIIKKFDLDMFYVCGPGHGGPAMVANTWLEGSYSEFYPRISRDATGMKRLFRQFSFPGGIPSHVAP
PHK_NITEU       AHLNRIIRRDDLNMIYIAGPGHGGPALVANTYLEGTYSEHYPDISQDIQGMKHLFRQFSFPGGIGSHATP
PHK_GLOVI       VHLNRVIQDEDLDMIYIAGPGHGGPGLVANTYLEGTYSEYYPNISEDAEGMKRLFKQFSFPGGIPSHVAP
PHK_BRAJA       AHLNRVIRALDLNVLYVCGPGHGGPGMVANTYLEGSYSEIYPNIARDADGLRKLFRQFSFPGGIPSHAAP
PHK_STRAW       THLNRVIKARDLDALCVWGPGHGGPAVLANSWLEGSYSETYPDISRDAAGMGKLFRQFSFPGGVPSHVAP
PHK_CHLTE       VHXXXXXXXXXXXXXYIAGPGHGGPALVANVWLEGTYSEYYPDVSFDEAGMKRLFRQFSFPGGIPSHVAP
PHK_STRCO       THLNRVIKARDLDALCVWGPGHGGPAVLANAWLEGSYTETYPDITRDAAGMARLFKQFSFPGGVPSHVAP
PHK_RHILO       AHLNRAIRLRDANVIYICGPGHGGPAMVANTYLEGTYSELNPDIAMDEQGMRKLFRQFSFPGGIPSHAAP
PHK_RHOPT       VHLNRLITEHDLDMIYITGPGHGGPGLVANAYLEGTYTERYPAIERSRNGMQRLFRQFSWPHGVPSHVSP
PHK_RHOPA       VHLNRLITEHDLDMIYITGPGHGGPGLVANAYLEGTYTERYPAIERSRNGMQRLFRQFSWPHGVPSHVSP
PHK1_RHIME      VHLNRVIKRDDLEMMYVIGPGHGGPSLVAHAYLEGTYSEVYPDISQDAEGLRKLFKQFSFPGGIPSHVAP
PHK_PARUW       VHLNRIIKKFDLDMIYLIGPGHGGPGIVANTYLEGTYSEYYPHISQDAEGMQKLFKQFSFPGGIPSHVAP
PHK_BRUSU       AHLNRIIQQRNANVIYICGPGHGGPGMVANTYLEGTYSEIYPAISEDEAGMERLFRQFSFPGGIPSHAAP
PHK_BRUME       AHLNRIIQQRNANVIYICGPGHGGPGMVANTYLEGTYSEIYPAISEDEAGMERLFRQFSFPGGIPSHAAP
PHK_BRUA2       AHLNRIIQQRNANVIYICGPGHGGPGMVANTYLEGTYSEIYPAISEDEAGMERLFRQFSFPGGIPSHAAP
PHK2_RHIME      VHLNRLIQTHDLNMIYVTGPGHGGPGLVANTYLEGTYSELYPEVSQDEAGIKRLFTQFSYPGGIPSHVAA
PHK_RHOBA       AHLNRTIKQNDLNMIYVSGPGHGGPAVVANTYLEGSYSEIYPHISQDEAGMRKLFVQFSFPGGIPSHASP
PHK_NOCFA       THANRVIRQRGLDAVFVAXXXXXXXXXNACAWLEGTYSELYSHIPRDGEGMAALFAQFSFPGGVPSHCAP
PHK_RHOP2       VHLNRLITEHDLDMIYXXXXXXXXXXLVANSYLEGSYTERYPAIERNRNGLQRLFRQFSWPHGVPSHVSP
PHK_BEII9       VHLNRIIKERDLDILFIAGPGHGAPGLIANSWLEKTYSEVYPAVSQDIEGMTRLCRQFSFPVGIPSHAAP
PHK_RHOPB       VHLNRLIKQHDLNMIYXXXXXXXXXXLVAQSYLEGSYTERYPAIERSRNGMQRLFRQFSWPHGIPSHVSP
PHK_RHOPS       VHLNRLISAHDLDMIYXXXXXXXXXXLVANSYLEGSYTERYPAIERNRNGLQRLFRQFSWPNGVPSHVSP
PHK_THEEB       LHLNRIIKKYQQEVIFLAGPGHGAPGVLAPVYLEGSYSEIYPNISEDAAGLKKFFKQFSFPGGIGSHCTP
PHK_SYNY3       THLNRIIRKFDQDMLYMVGPGHGAPGFLGPCYLEGSYSRFFAECSEDEDGMKRFFKQFSFPGGIGSHCTP
PHK1_ANASP      VHLNRLIKKYDLDVIYIAGPGHGAPGILGPTYLEGTYSEVYPDKSEDEEGMLKFFKQFSFPGGIGSHCTP
PHK_SYNP6       VHXXXXXXXXXXXXXYVTGPGHGAPALLANAWLEGTYSEVYPNCQQSTAGLQQFFKQFSFPGGIGSHCTP
PHK_SYNE7       VHXXXXXXXXXXXXXYVTGPGHGAPALLANAWLEGTYSEVYPNCQQSTAGLQQFFKQFSFPGGIGSHCTP
PHK_METCA       THLNRAIRKHDLDMIFMAGPGHGAPGVLGPLYLEGSYSEIYPDKDLSEEGLLNFFKQFSFPGGIGSHCTP
PHK_CLOAB       AHLNRVIKKYDLDMIYVSGPGHGGQVMVSNSYLDGTYSEVYPNVSRDLNGLKKLCKQFSFPGGISSHMAP
PHK_PSEP1       THLNRLIHQYSLNVLFVTGPGHGGPALVAQAYLDGTYTELNPSVERNALGMARLFRQFSWPYGIGSHVGP
XPKA_LACPE      AHLNRVINKYGLKMFYVEGPGHGGQVMVSNSYLDGTYTDIYPEITQDVEGMQKLFKQFSFPGGVASHAAP
PHK1_LACPL      AHLNRVINKYGLKMFYVEGPGHGGQVMVSNSYLDGTYTDIYPEITQDVEGMQKLFKQFSFPGGVASHAAP
PHK_PEDPA       AHLNRVINKYGVNMFYVEGPGHGGQVMVSNSYLDGSYTEAYPAITQDEEGMKKLFKQFSWPGGVASHAAP
PHK_LACSS       AHLNRAINKYDLNMFYVEGPGHGGQVMVSNSYLDGSYTEIYPEISQDVDGMKKLFKQFSFPGGVASHAAP
PHK2_LACPL      AHLNRAINKYGLNMFYIEGPGHGGQVMVSNSYLDGTYTETYPKITQDKAGMKRLFKQFSFPGGVASHADP
XFP_BIFAS       AHINRLIADHQQNTVFIMGPGHGGPAGTAQSYIDGTYTEYYPNITKDEAGLQKFFRQFSYPGGIPSHFAP
PHK_BIFA0       AHINRLIADHQQNTVFIMGPGHGGPAGTAQSYIDGTYTEYYPNITKDEAGLQKFFRQFSYPGGIPSHFAP
PHK_LACLA       AHANRLINKYDQKMFYMGGPGHGGQAMVVPSYLDGSYTEAYPEITQDLEGMSRLFKRFSFPGGIGSHMTA
PHK_SCHPO       SHCNRIINKYDLNMLFVVGPGHGAPAILSALFLEDSLGPFYPRYQFTKEGLNNLINTFSLPGGFPSHVNA


                         +         .         .         .         .         *         .:210
query           ETPGSIHEGGELGYALAHAFGAAFDNPDLXXXXXXXXXXXXXXXLSGSWQSIRFLNPARDGAVLPILHLN
PHK_MYCA1       QTPGSIHEGGELGYALVHAYGAAFDNPYLVVACVIGDGEAETGPLAAGWHSNKFLNPVTDGAVLPILALN
PHK_MYCPA       QTPGSIHEGGELGYALVHAYGAAFDNPYLVVACVIGDGEAETGPLAAGWHSNKFLNPVTDGAVLPILALN
PHK2_ANASP      ETPGSIHEGGELGYALVHAFGAAFDNPDLIVAAVVGDGEAETGALATSWHSNKFLNPASDGAVLPILHLN
PHK_NITMU       ETAGSINEGGELGYSLSHAFGAAFDNPDLIVACVVGDGEAETGPLAASWHSNKFLNPARDGAVLPILHLN
PHK_NITEU       EIPGSIHEGGELGYALSHAFGAVFDNPDLIAACVVGDGEAETGPLATAWHSNKFLNPVHDGAVLPILHLN
PHK_GLOVI       ETPGSIHEGGELGYAVSHAYGAVFDNPDLIVACVVGDGEAETGPLATSWHSNKFLNPVRDGAVLPILHLN
PHK_BRAJA       ETPGSIHEGGELGYALVHAYGAALDNPDLVVACVVGDGEAETGPLAASWHSNKFLNPAHDGAVLPILHLN
PHK_STRAW       ETPGSIHEGGELGYSLAHAYGAAFDNPDLLVACVIGDGEAETGPLAASWHSNKFLDPVHDGAVLPILHLN
PHK_CHLTE       ATPGSIHEGGELGYALSHAYGAVFDNPDLVAACVIGDGEAETGPLATAWHSNKFLNPKRDGAVLPVLHLN
PHK_STRCO       ETPGSIHEGGELGYALSHAYGAAFDHPDLVVACVIGDGEAETGPLATSWHSNKFLDPVHDGAVLPILHLN
PHK_RHILO       DVPGSIHEGGELGYSLSHAYGAAFDNPDLVVACVVGDGEAETGPLAAAWHSNKFLNPARDGAVLPILHLN
PHK_RHOPT       ETPGSIHEGGELGYSLAHAYGAAFDNPNLIVACVVGDGEAETGALATSWHSNKFLNPARDGAVLPILHLN
PHK_RHOPA       ETPGSIHEGGELGYSLAHAYGAAFDNPNLIVACVVGDGEAETGALATSWHSNKFLNPARDGAVLPILHLN
PHK1_RHIME      ETPGSIHEGGELGYALSHAYGAAFDNPELIVACVVGDGEAETGPLATGWHGNKFLNPARDGCVLPILHLN
PHK_PARUW       ETPGSINEGGELGYSLSHAFGAAFNNPDLIVGCVIGDGEAETGPLATAWHSNKFLNPAIDGAVLPILHLN
PHK_BRUSU       ETPGSIHEGGELGYALVHAYGAAFDNPDLVVACVVGDGEAETGALATSWHSNKFLNPARDGAVLPILHLN
PHK_BRUME       ETPGSIHEGGELGYALVHAYGAAFDNPDLVVACVVGDGEAETGALATSWHSNKFLNPARDGAVLPILHLN
PHK_BRUA2       ETPGSIHEGGELGYALVHAYGAAFDNPDLVVACVVGDGEAETGALATSWHSNKFLNPARDGAVLPILHLN
PHK2_RHIME      EVPGSINEGGELGYCLMHAYGAVFDNPDLIAACVVGDGEAETGALATSWHSNKFLNPARDGAVLPILHLN
PHK_RHOBA       ECPGSIHEGGELGYSLSHSFGAVFDNPDLIVACVVGDGEAETGPLATAWHSNKFLNPATDGAVLPILHLN
PHK_NOCFA       ETPGSFHEGGELGYSLLHAYGAALDNPDLTVFCVIGDGEAETGPLATSWHGNKFLNPGRDGAVLPILALN
PHK_RHOP2       ETPGSIHEGGELGYSLAHAYGAAFDNPDLIVACIVGDGEAETGALATSWHSNKFLNPARDGAVLPILHLN
PHK_BEII9       ETPGSIHEGGELGYSLSHAFGAVFDNPDLIAACVIGDGEAETGPLATSWHANKFLDAARDGAVLPILHLN
PHK_RHOPB       ETPGSIHEGGELGYSLAHAYGAAFDNPDLIVACIVGDGEAETGALASSWHSNKFLNPARDGAVLPILHLN
PHK_RHOPS       ETPGSIHEGGELGYSLAHAYGAAFDNPDLIVACIVGDGEAETGALATSWHSNKFLNPARDGAVLPILHLN
PHK_THEEB       ETPGSIHEGGELGYVLSHACGAAFDNPDLIVAAVVGDGEAETAPLATSWHINKFLNPARDGAVLPILNLN
PHK_SYNY3       ETPGSIHEGGELGYCLSHAYGAAFDNPNLIVVGLAGDGESETGPLATSWHSNKFINPIRDGAVLPVLHLN
PHK1_ANASP      ETPGSIHEGGELGYSLSHAYGAAFDNPDLIVTAVIGDGEAETGPLATAWHSNKFINPIRDGAVLPILHLN
PHK_SYNP6       ETPGSIHEGGELGYSLSHAFGAALDNPDLIVACVIGDGEAETGPLATSWHSNKFLNPAQDGAVLPILHLN
PHK_SYNE7       ETPGSIHEGGELGYSLSHAFGAALDNPDLIVACVIGDGEAETGPLATSWHSNKFLNPAQDGAVLPILHLN
PHK_METCA       ETPGSIHEGGELGYVLSHACGAAFDNPDLIVAAVVGDGEAETGPLATSWHINKFLNPIRDGAVLPILNLN
PHK_CLOAB       ETPGSINEGGELGYSLAHSFGAVFDNPDLITACVVGDGEAETGPLATSWQANKFLNPVTDGAVLPILHLN
PHK_PSEP1       HVPGSIHEGGELGYSLAHAYGAALDNPQLIVACVIGDGEAETGPLAASWHCNKFLNPARDGAVLPILHLN
XPKA_LACPE      ETPGSIHEGGELGYSISHGVGAILDNPDEIAAVVVGDGESETGPLATSWQSTKFINPINDGAVLPILNLN
PHK1_LACPL      ETPGSIHEGGELGYSISHGVGAILDNPDEIAAVVVGDGESETGPLATSWQSTKFINPINDGAVLPILNLN
PHK_PEDPA       VTPGSIHEGGELGYSLSHGVGAILDNPDQIAAVVVGDGEAETGPLAASWQHNRFINPITDGAVLPILDIN
PHK_LACSS       ETPGSIHEGGELGYSLSHGVGAILDNPDVIAAVVVGDGEAETGPLAASWLSSTFINPKNDGAVLPILNLN
PHK2_LACPL      KTPGSIHEGGELGYSILHGAGAVLDNPGLIAATVVGDGESETGPLATSWQVNKFLNPITDGTVLPILNLN
XFP_BIFAS       ETPGSIHEGGELGYALSHAYGAIMDNPSLFVPCIIGDGEAETGPLATGWQSNKLVNPRTDGIVLPILHLN
PHK_BIFA0       ETPGSIHEGGELGYALSHAYGAIMDNPSLFVPCIIGDGEAETGPLATGWQSNKLVNPRTDGIVLPILHLN
PHK_LACLA       QTPGSLHEGGELGYVLSHATGAILDQPEQIAFAVVGDGEAETGPLMTSWHSIKFINPKNDGAILPILDLN
PHK_SCHPO       EVPGAIHEGGELGYALSVSYGAVLDRPDLIVTCVVGDGEAETGPTATSWHAHKFLDPAESGAVIPVLELN


                         .         .         .         +         .         .         .:280
query           GYKIAGPTVLARIPEEDLLAQMRGHGYEPHVVAGDDPDTVHQLMAGTLASCLERIDTIRFRARQEDGDIA
PHK_MYCA1       GYKIANPTVLARIPHTELEALLRGYGYRPITVAGDDPTDVHRQLAAALDEAFDDIAAIQGVARG-GGEVQ
PHK_MYCPA       GYKIANPTVLARIPHTELEALLRGYGYRPITVAGDDPTDVHRQLAAALDEAFDXXXXXXXXXXXXX-EVQ
PHK2_ANASP      GYKIANPTVLARLSYEELESLFVGYGYKPYFVEGSDPALVHQQMAAILDTVIAEIHSIQREARVH-GFSK
PHK_NITMU       GYKIANPTILARISHEELESLFAGYGYQPYFVEGSDPGPMHQSMAAVLDTAIESIRRIQREARERQEAVT
PHK_NITEU       GYKIANPTILARISREELDQLFQGYGYQPYIVEGEDPLTMHQLMAGTLDQVLAEIRSIQTRARL-DGVTQ
PHK_GLOVI       GYKIANPTVLARISHEELEKLFEGYGYKPYFVEGSEYEPTHQLMAATLDTCIAEIKAIQHEART-GGATA
PHK_BRAJA       GYKIANPTVLGRMSDSEIRDLFRGFGHEPLFVEGDDPKLMHRIMADALDVAFASIRSIQQHARDGRKNIE
PHK_STRAW       GYKIANPTVLSRIPEPELDELLRGYGHEPLHVTGDDPHQVHRALAEAFDRALDRVALMQRTAREE-GATE
PHK_CHLTE       GYKIANPTVLARISHEELEQLMIGYGYKPYFVEGDDPATMHQMMAATMDRCFDEIAEIQRRAR-VDGVTE
PHK_STRCO       GYKIANPTVLARLPETELDELLRGYGHDPVHVTGDDPAAVHRATARAMDTALD-XXXXXXXXXXXXXXTG
PHK_RHILO       GYKIANPTILARIPEDELRALFAGYGYEPLFVAGHEPALMHQRMATVLDDAFDRISAIKHAARNGSGATG
PHK_RHOPT       GFKIANPTVLARITPQELTDLMRGYGYEPHFVEGDDPAVVHQTLAATLERVLGEIRAIQDKARNH-GDTE
PHK_RHOPA       GFKIANPTVLARITPQELTDLMRGYGYEPHFVEGDDPAVVHQTLAATLERVLGEIRAIQDKARNH-GDTE
PHK1_RHIME      GYKIANPCFLARIPREELQKFFEGMGYAPLFVEGHDPADVHQQXXXXXXXXXXXIRRIQTDARV-NGNLK
PHK_PARUW       GYKIANPTILARISQEELKSLFVGYGYKPYFVEGSDPQLMHRLMAETLDMIIKEIQEIQTNARK-NGIVK
PHK_BRUSU       GYKIANPTVLARLSDDDLDNLFRGYGYEPFFVEGSEPADMHQKMAATLDTIFQRIQDIKKNADVHSPE--
PHK_BRUME       GYKIANPTVLARLSDDDLDNLFRGYGYEPFFVEGSEPADMHQKMAATLDTIFQRIQDIKKNADVHSPE--
PHK_BRUA2       GYKIANPTVLARLSDDDLDNLFRGYGYEPFFVEGSEPADMHQKMAATLDTIFQRIQDIKKNADVHSPE--
PHK2_RHIME      GYKIANPTVLARISHDELEALFMGYGYEPLFVEGADPRQMHQLMASALDKAHGKIAEIQRQARSR-GFSD
PHK_RHOBA       GFKIANPTILARINHEELEQLMRGYGWTPIFVEGKDPMKMHAAMAEALDVAIGQIRSIQQNAR-ETGDTS
PHK_NOCFA       EYKIANPTLFARIPEPELINLLEGYGHEPIVVAGDDPGVVHQRLAAAMDTCMNRIAQIQ-RAARDGADGS
PHK_RHOP2       GFKIANPTVLARISRQELTDLMRGYGYEPIVVEGDEPXXXXXXXXXXXXXXXXXXXXXXXXXXHQ-GVTA
PHK_BEII9       GYKIANPTVLGRIPSDELENLLQGYGYAPLFVEGDDPDIMHRHMAEALNVAFAGIAKIQ-RAARVEGHIE
PHK_RHOPB       GFKIANPTVLARIGRVELTELLRGYGYEPDFVEGDDPAIVHQLLAGTLDRILAQIRHIQDEARNH-GVTA
PHK_RHOPS       GFKIANPTILARIGRQELTDLMRGYGYEPIVVEGDDPKLVHHTLAAALEXXXXXXXXXXXXXXHQ-GVTV
PHK_THEEB       GYKINNPTILARIPHQDLENYFRGLGYDPCFVEGSDRPSMHQAMAATLDYCVTRIKEIQRTAREE-GLTT
PHK_SYNY3       GYKINNPSVLSRISHEELKALFEGYGYTPYFVEGSDPESMHQAMAATLDHCVSEIHQIQQEARST-GIAV
PHK1_ANASP      GYKIANPTILARISHEELEDLFKGYGYTPYFVEGHDPAQVHQLMAATLETVILEIKKIQTEAR-TSGVAK
PHK_SYNP6       GYKIANPTLLSRISHEELRSLFIGYGYEPFFVEGNDPAILHGVMASTLATCVQKIQAIQAAARSGESSDR
PHK_SYNE7       GYKIANPTLLSRISHEELRSLFIGYGYEPFFVEGNDPAILHGVMASTLATCVQKIQAIQAAARSGESSDR
PHK_METCA       GYKINNPTLLARISHEELENLLRGYGYTPYFVEGSEPESMHQAMAATVDRSIEDIRAAQTEARAS-GIAR
PHK_CLOAB       GYKISNPTVLSRIPKDELEKFFEGNGWKPYFVEGEDPETMHKLMAETLDIVTEEILNIQKNAR-ENNDCS
PHK_PSEP1       GYKIANPSVLSMISEEELTSLMYGYGYDPYFVEGDEPMEVHRALARTLDVIYEKISQIQRLARAEDPQVV
XPKA_LACPE      GFKISNPTIFGRTSDEKIKQYFESMNWEPIFVEGDDPEKVHPALAKAMDEAVEKIKAIQKNARENDDATL
PHK1_LACPL      GFKISNPTIFGRTSDAKIKEYFESMNWEPIFVEGDDPEKVHPALAKAMDEAVEKIKAIQKHAR-ENNDAT
PHK_PEDPA       GYKLSNPSLTSRMSDEELTEFFHGQHWDPYFVEGDDSEAMDPKMAEVMDKAIEKIQEIQKNAR-ENHDET
PHK_LACSS       GFKISNPTILSRKSDEELTKYFEGNGWAPIFVEGDDPEKMHPATAAAMDXXXXXXXXXXXXXR-ENGDTS
PHK2_LACPL      GFKISNPTVLSRESHEELEDYFKGLGWDPHFVEGTDPAKMHKIMAEELDKVIEEIHAIRKNAK-DNNDES
XFP_BIFAS       GYKIANPTILARISDEELHDFFRGMGYHPYFVAGFDNESIHRRFAELFETIFDEICDIKAAAQTD--DMT
PHK_BIFA0       GYKIANPTILARISDEELHDFFRGMGYHPYFVAGFDNESIHRRFAELFETIFDEICDIKAAAQTD--DMT
PHK_LACLA       GFKISNPTLFARTSDVDIRKFFEGLGYSPRYIENDDIHAYHKLAAEVFDKAIEDIHQIQKDAREDNGEIP
PHK_SCHPO       GYKISERTIYGCMDDSELLSLFSGFGYEVAIV-NDTPDQ-NRVMAATMDWAVERIHDIQHRARVNREEI-


                         .         *         .         .         .         .         +:350
query           NVRWPMIILRTPKGWTGPRAVDGKPVEDTWRSHQVPLAATRENPEHLRLLEEWLRSYRPEELFDEHGAPR
PHK_MYCA1       RPVWPMIVLRTPKGWTGPKVVDGKRVEGTWRSHQVPLAETHDNPEHRAQLEEWLRSYGPEQLFDDDGRLR
PHK_MYCPA       RPVWPMIVLRTPKGWTGPKVVDGKRVEGTWRSHQVPLAETHDNPEHRAQLEEWLRSYGPEQLFDDDGRLR
PHK2_ANASP      RPQWPMIILRTPKGWTGPKEVDGKKTEDYWRSHQVPFGNVTGNPEHLKLLEEWLKSYKPEELFDANGKLI
PHK_NITMU       YPRWPLIILRSPKGWTGPEEVDGKKLEDYWRSHQVPLAELGSKPDHLKQLEDWMRSYKPEELFDENGCLM
PHK_NITEU       YPRWPMIILRTPKGWTGPATVDGLKTEGSWRSHQVPLSELAKKPEHIQQLEAWLRSYRPEELFDTQGRLV
PHK_GLOVI       RPRWPMIVLRTPKGWTGPKEVDGKKTEDFWRSHQVPFSEMAGKPEHVQLLETWMRSYQPEELFDENGTFL
PHK_BRAJA       RPRWPMIVLRSPKGWTGPKEVDGKKVEGFWRAHQVPVASCRENPAHLKVLEDWMRSYEPEKLFDASGALV
PHK_STRAW       RIRWPMIVLRTPKGWTGPAEVDGRPVEGTWRAHQVPLPEVRENPEHLRQLEGWLRSYRPEELFDADGRPT
PHK_CHLTE       RPMWPMIVFRSPKGWTGPKVVDGKPAEGSWRSHQVPFSTVRDNPEHMALLETWLKSYRAEELFTADGVLL
PHK_STRCO       RPRWPMIVLRTPKGWTGPAEVDGLPVENTWRAHQVPLSAVRTNPEHLAQLERWLRSYRPEELFDDAGAPR
PHK_RHILO       SPEWPMIVLRSPKGWTGPKEVDGLKTEGFWRSHQVPLSGLAENPAHLKLLEEWLKSYRPEELFDAAGAPV
PHK_RHOPT       RPRWPMIVMRTPKGWTGPKQVDGKPVEGTWRAHQVPIADFK-NPEHLTLLEDWMRSYRPDELFDATGKLR
PHK_RHOPA       RPRWPMIVMRTPKGWTGPKQVDGKPVEGTWRAHQVPIADFK-NPEHLTLLEDWMRSYRPDELFDATGKLR
PHK1_RHIME      RPAWPMIVFRTPKGWTCPAEIDGKKCEDYWRSHQVPMG-DMDKPEHIRILEGWMKSYRPEELFDGDGRLT
PHK_PARUW       RPIWPMIILRTPKGWTGPKEVDGKKTENYWRSHQVPFSDMKE--EHIKLLEEWLKSYRPEELFDETGKLF
PHK_BRUSU       RPRWPMIILRSPKGWTGPKTVDGLVVENYWRAHQVPVANCRENDAHRKILEDWMKSYDPSDLFDEKGALK
PHK_BRUME       RPRWPMIILRSPKGWTGPKTVDGLVVENYWRAHQVPVANCRENDAHRKILEDWMKSYDPSDLFDEKGALK
PHK_BRUA2       RPRWPMIILRSPKGWTGPKTVDGLVVENYWRAHEVPVANCRENDAHRKILEDWMKSYDPSDLFDEKGALK
PHK2_RHIME      RPAWPMIIFRSPKGWTGPREVDGKKTEGTWRSHQVPLAKLAEVPAHLGILEEWLKSYRPWELFDESGSLR
PHK_RHOBA       RPRWPMIVLRSPKGWTGPKFVDGVRNEGTFHSHQVPLSDPAKCPEHLKQIEQWLRSYRPEELLDENGRLR
PHK_NOCFA       RPAWPMIVLRTPKGWTCPPVVDGDRVEGTFRAHQVPLPAARTDDGHRAVLEQWLRSYRPEELFDDRGRPV
PHK_RHOP2       RPRWPMIILRTPKGWTGPKQVDGKQVEGTWRAHQVPIADFKD-PAHVQLLETWLRSYRPEELFDANGKFR
PHK_BEII9       RPRWPMLVLRSPKGWTGPKTVDGLKTEGFWRAHQVPFTIA-DKPEHLSLLESWLKSYRPEELFEESGALK
PHK_RHOPB       RPRWPMIVLRTPKGWTGPKFVDNLPVEGTWRAHQVPIADFKA-PEHLKLLEDWMRSYRPQDLFDDNGKLR
PHK_RHOPS       RPRWPMIILRTPKGWTGPKQVDGKQIEGTWRAHQVPIASFKD-PTHVQLLETWLRSYRPEELFDASGKFR
PHK_THEEB       LPRWPMIVLRTPKGWTGPAEVNGHKVEGSWRAHQVPLADVHTNPENLQLLENWLRSYRPEELFDHNGTFR
PHK_SYNY3       RPRWPMVVMRTPKGWTGPDYVDGHKVEGFWRSHQVPMGGMHENPAHLQQLEAWMRSYKPEELFDEQGTLK
PHK1_ANASP      RPRWPMIVLRTPKGWTAPAEIDGHKLEGFWRSHQVPITDVATNPDHLKILEQWMKSYKPEELFDEHGSLI
PHK_SYNP6       PM-WPMIVLRTPKGWTGPATIKGHVVEGSWRSHQVPMADVLTNPEHLQLLEDWLRSYRPEELFDASGAPV
PHK_SYNE7       PM-WPMIVLRTPKGWTGPATIKGHVVEGSWRSHQVPMADVLTNPEHLQLLEDWLRSYRPEELFDASGAPV
PHK_METCA       RPRWPMIVLRSPKGWTAPRQIDGHNVEGFWRAHQVPVADVAKNPEHLKLLEGWMRSYKPEELFDAEGCPV
PHK_CLOAB       RPKWPMIVLRTPKGWTGPKFVDGVPNEGSFRAHQVPLAVDRYHTENLDQLEEWLKSYKPEELFDENYRLI
PHK_PSEP1       DPLWPVLILRTPKGWTGPRYVDGQRVEGTWRSHQLPL-ADLDKPPHLMQLQQWLESYRPHELFDAQGXXX
XPKA_LACPE      PV-WPMIVFRAPKGWTGPKSWDGDKIEGSFRAHQIPIPVDQTDMEHADALVDWLESYQPKELFNEDGSLK
PHK1_LACPL      LPVWPMIVFRAPKGWTGPKSWDGDKIEGSFRAHQIPIPVDQNDMEHADALVDWLESYQPKELFNEDGSLK
PHK_PEDPA       MPYWPVIVFRSPKGWTGPKTWDNKVIEGTFRAHQIPIPVDQKNLEHVDALIDWMKSYKPEELFDENGRVL
PHK_LACSS       RPVWPMIVFRAPKGWTGPKTWDGVPIENSFRAHQIPVPIDSTDMQHADALVDWMKSYRPEELFTAEGQLK
PHK2_LACPL      RPKWPMIVFRAPKGWTGPKSWDGEPIEGSFRAHQIPIPVDRNHMEHADKLVDWLKSYKPEELFDENGTLK
XFP_BIFAS       RPFYPMLIFRTPKGWTCPKFIDGKKTEGSWRAHQVPLASARDTEAHFEVLKGWMESYKPEELFNADGSIK
PHK_BIFA0       RPFYPMLIFRTPKGWTCPKFIDGKKTEGSWRAHQVPLASARDTEAHFEVLKGWMESYKPEELFNADGSIK
PHK_LACLA       --AWPIVIARLPKGWGGPRYNDGMPIEHSFRAHQVPLPLSSKNMGTLPEFVKWMTSYQPETLFNADGSLK
PHK_SCHPO       KPRWPMIILRTPKGKGCPKYLNGKFLEGTFRAHQVPLKLARTDTNQRNLLKDWLNSYNCQDFLDEHGLPT


                         .         .         .         .         *         .         .:420
query           PEXXXXXXXXDCRISSSPHANGGXXXXXXXXPDFRDYAVEVERPGVDMVEATRVLGGFLRDVVAANPHNF
PHK_MYCA1       AELRALAPTGDRRMSANPHANGGXXXXXXXXXXFRDYAVPVTRPGSVTHEATRVLGTFLRDVIARNKDRF
PHK_MYCPA       AELRALAPTGDRRMSANPHANGGXXXXXXXXXXFRDYAVPVSRPGSVTHEATRVLGTFLRDVIARNKDRF
PHK2_ANASP      PELAELAPKGDRRMGDNPHANGGILLRDLVMPDFQNYAIEVPQPGRVMAEATQVTGKFLRDVMKLNSRNF
PHK_NITMU       PELAALAPEGDRRMGANPHANGGLLLKELEMPDFRSYAVDVPVPGTEVREATRETGKFLRDIMKLNSSNF
PHK_NITEU       EPLQTLAPLGNRRMGANPHANGGSLMKQLRMPDFRKYAVEIVQPGQIEAESTRIMGSFLRDIMCLNLKNF
PHK_GLOVI       GELKALAPKGHRRMGDNPHANGGILLKDLKMPDFRSYAVDVAKPGTTFAEATKVMGIFLRDVMKANQRNF
PHK_BRAJA       PELQALAPEGNRRMGANPHANGGLLKKELKLPDFRSFAVEVPQPGAVTGEATRELGRFLRDVIRLNERNF
PHK_STRAW       ADVLACVPHGARRLGATPHANGGXXXXXXXXXXXDRFAVAVDKPGATLHEPTRVLGDLLEQVMTSARRDF
PHK_CHLTE       PELQELAPRGKKRMGDIPHANGGLLLKELRMPDFREYGIDVPKPGSVEAEAPKPMARFLRDIMKMNEKNF
PHK_STRCO       PAVLAAIPEGPRRLGATPYANGGXXXXXXXXXXXXKYAVPVGEPGASTHEPTRVLGDLLRDVMAADRRDF
PHK_RHILO       ASIRATAPQATKRMSANPHANGGLLRRSLELPGLHDHAVSLERPGAVKAESTRVMGSFLRDVMRLNEKNF
PHK_RHOPT       DELQALAPTGRRRMSANPHANGGELLEPLSLPDFHDYAVTLTGPGALKAEATRVLGTFLRDVMSLESENF
PHK_RHOPA       DELQALAPTGRRRMSANPHANGGELLEPLSLPDFHDYAVTLTGPGALKAEATRVLGTFLRDVMSLESENF
PHK1_RHIME      AELAALAPTGRRRMSDNPHANGGLLLRDLKMPDFRDYAVAVQSPGAATAESARVMGSYLRDVMKLNSGNF
PHK_PARUW       PILAELAPKGKRRMGDNFHANGGLLRKNLRLPDFRSYQLEVVTPGVVEAESTRIMGSFLRDVLKLNPHNF
PHK_BRUSU       PELRALAPKGEARIGANPHANGGLLRKELHMPDFRQYAVNVTEPGAIEAQSTKILGDFLRDVMKLNEKNF
PHK_BRUME       PELRALAPKGEARIGANPHANGGLLRKELHMPDFRQYAVNVTEPGAIEAQSTKILGDFLRDVMKLNEKNF
PHK_BRUA2       PELRALAPKGEARIGANPHANGGLLRKELHMPDFRQYAVNVTEPGAIEAQSTKILGDFLRDVMKLNEKNF
PHK2_RHIME      PELRELAPKGERRMGANPHANGGLLLKDLNLPDFRQYAVEIGIPGTVTAESTRTAGLYLRDVMKLNAQNF
PHK_RHOBA       QEIADLAPTGDRRMGANPHANGGRLLRRLKMPDFRDYAVEISQRGCRGIGDTHVTGKFIRDIVRLNEENF
PHK_NOCFA       PELLALAPEGDRRMSANPVANGGALVRDLRLPDWREFGVEVKTPGGSTHEATRVLGGWLREVTRLNPHNF
PHK_RHOP2       DELAALAPTGHCRMSANPHANGGELLQPLSLPDFRNYAVALSAPGAAKAEATRALGTFLRDVMRDNTKNF
PHK_BEII9       PEIASLAPSGERRMSANPQANGGNLPRPLQIPDFTLHAVDVDYPGARTAEATFVMGQFLRDIMRANEKNF
PHK_RHOPB       DELVALAPTGHRRMSANPHANGGELLQPLSLPDFHDYAVTLPAPGAVRAESTRVLGKYLRDVMKANSQNF
PHK_RHOPS       DDLAALAPTGHRRMSANPHANGGELLQPLSLPDFHDYAVTQSGPGTVKAEATRVLGAFLRDVMKSNAKNF
PHK_THEEB       PDLKALAPTGNYRMGMNPHANGGLLRKDLKMPNFREYGITFDKPGQIEVENTRPLGVFLRDVMRNNPRNF
PHK_SYNY3       PGFKAIAPEGDKRLGSTPYANGGLLRRGLKMPDFRQYGIDVDQPGTIEAPNTAPLGVFLRDVMANNMTNF
PHK1_ANASP      PELKELAPIGHRRISANPVANGGILRKELRLSDFRNNAVEVSKPGAVEVENTKPLGNFLRDIMRNNMTNF
PHK_SYNP6       AELQAIAPIGDRRMSANPVTNGGLLRRALTLPDFRDQAVSVPAPGKSRADSTRPLGQFLREVIRHNPDNF
PHK_SYNE7       AELQAIAPIGDRRMSANPVTNGGLLRRALTLPDFRDQAVSVPAPGKSRADSTRPLGQFLREVIRHNPDNF
PHK_METCA       AEIREMAPAGLRRMGLNPHANGGHLKKALRIPNFRNYGIEVAKPGQIEAPNTQPLGVFLRDVMKENAHNF
PHK_CLOAB       PELEELTPKGNKRMXXXXXXXXXXXXRELRTPDFRDYAVDVPTPGSTVKQDMIELGKYVRDVVKLNERNF
PHK_PSEP1       XXXXXXXXXGRRRMSANPHANGGLLLRALDLPHYADYCVPMPGPGQVRAEATRVLGGYVRDVMSLASQNF
XPKA_LACPE      DDIKEIIPTGDARMAANPITNGGVDPKALNLPNFRDYAVDTSKHGANVKQDMIVWSDYLRDVIKKNPDNF
PHK1_LACPL      DDIKEIIPTGDSRMAANPITNGGVDPKALNLPNFRDYAVDTSKEGANVKQDMIVWSDYLRDVIKKNPDNF
PHK_PEDPA       PEIAEIAPKGEKRMASNPITNGGVNPTDLNLPDYRDYAVDTTKRGQNIKQDMLVWSDYLRDVITKNPTNF
PHK_LACSS       PEIAAMAPKGDKRMAANPITNGGIDPKPLRLPDYRDYAVDNTEHGKVVAQDMIVLGEYVRDIIKDNDQNF
PHK2_LACPL      PEIAAIIPEGQARMAANPVTNGGKLTKDLITPNIDDYALDNKSHGKEDGSDMTELGKYIRDLIELNKKNF
XFP_BIFAS       EDVTAFMPKGELRIGANPNANGGRIREDLKLPELDQYGVKEYGHGWGQVEAPRSLGAYCRDIIKNNPDSF
PHK_BIFA0       EDVTAFMPKGELRIGANPNANGGRIREDLKLPELDQYGVKEYGHGWGQVEAPRSLGAYCRDIIKNNPDSF
PHK_LACLA       EELRDFAPKGEMRMASNPVTNGGVDSSNLVLPDWQEFANPISEPDTNDNMDMNVLSKYFAEIVKLNPTRF
PHK_SCHPO       KGITEHLPPREKRMGQRHETYNSYLPLKV--PDWKKYGVKKG----ETTSATSVVGQYLDELLVTNDSTL


                         .         .         +         .         .         .         .:490
query           RIMGPDETQSNRLGAVFESTDRAWTTERLPVDQQLSPDGRVMEVLNEQLCQGWLEGYLLTGRHGLFNSYE
PHK_MYCA1       RMMGPDETASNRLDAVYGATEKVWLSATEPDDEHLAPDGRVMEVLSEHLCQGWLEGYLLTGRHGLFNCYE
PHK_MYCPA       RMMGPDETASNRLDAVYGATEKVWLSATEPDDEHLAPDGRVMEVLSEHLCQGWLEGYLLTGRHGLFNCYE
PHK2_ANASP      RVFGPDETASNRINAVLDVTDRTWVAQKLPEDDHLDPSGRVMEILSETCCQGWLEGYLLTGRHGFFSCYE
PHK_NITMU       RVMGPDETSSNRLDALFDVTARAWVAQQLPEDEHLSPDGRVMEILSEHICQGWLEGYLLTGRHGLFSCYE
PHK_NITEU       RVFGPDETASNRLGSLYDVTPKTWLAETLPEDEHLAPDGRVMEILSEHTCQGWLEGYLLTGRHGLFSCYE
PHK_GLOVI       RIVGPDETASNRWGPLFEITNRTWMDAIHPYDDHLSQDGRVMEILSEHTCQGWLEGYLLTGRHGFFSCYE
PHK_BRAJA       RIMGPDETASNRLDAVFETTERVWMEPIEPYDVHLAQDGRVMEVLSEHLCQGWLEGYLLTGRHGFFSCYE
PHK_STRAW       RLVGPDETASNRLDAVFDASGKAWQAQTLPVDEHLDRHGRVMEILSEHTCQGWLEGYLLTGRHGLFSCYE
PHK_CHLTE       RVFGPDETASNRLGELFEETDRTWMAGMLPTDDHLSRDGRVMEILSEHTCQGWLEGYLLTGRHGFFSCYE
PHK_STRCO       RLVGPDETASNRLQAVYAATGKAWQERTLPVDEDLDRHGRVMEILSEHTCQGWLEGYLLTGRHGLFSCYE
PHK_RHILO       RIVGPDETASNRLQDVFEVTERGWMEKILPEDVHLGREGRVLEILSEHTCQGWLEGYLLTGRHGLFSCYE
PHK_RHOPT       RLFGPDETASNRLDAVLQVSPKEWMAAIEDVDVDLSPDGRVMEVLSEHLCQGWLEGYLLTGRHGFFSCYE
PHK_RHOPA       RLFGPDETASNRLDAVLQVSPKEWMAAIEDVDVDLSPDGRVMEVLSEHLCQGWLEGYLLTGRHGFFSCYE
PHK1_RHIME      RLFSPDENNSNRWQDVLEVTDRCFMADIYPEDDHLSPDGRLMEVLSEHQSQGWLEGYLLTGRHGFFSCYE
PHK_PARUW       LVTGPDETASNRLTNLFEVTQRRWLAEYLPEDTDLSLEGRVLEILSEHTCLGWLEGYILTGRHGFFSTYE
PHK_BRUSU       RIFGPDETASNRLGSVLEATNRVWMAETLDMDDHLAADGRVMEVLSEHLCQGWLEGYLLSGRHGFFSCYE
PHK_BRUME       RIFGPDETASNRLGSVLEATNRVWMAETLDMDDHLAADGRVMEVLSEHLCQGWLEGYLLSGRHGFFSCYE
PHK_BRUA2       RIFGPDETASNRLGSVLEATNRVWMAETLDMDDHLAADGRVMEVLSEHLCQGWLEGYLLSGRHGFFSCYE
PHK2_RHIME      RIFGPDETESNRLSPVFQETDRVFTGDILASDMQLSPDGRVMEVLSEQLCQGWLEGYLLTGRHGFFSCYE
PHK_RHOBA       RIFGPDETISNGLEAVFDVTQRQWNAAIVEDDESLAPTGRVLEMLSEHQCEGWLEGYLLTGRHGLFNCYE
PHK_NOCFA       LTFAPDELASNRLQDILEVTGRDWQAEVGEYDVALDRSGRVIEVLSEHICQGLLEGYLLTGRHGVFTCYE
PHK_RHOP2       RLFGPDETASNRLDGVLEVTDKQWMADIEDVDIALGPDGRVMEVLSEHLCQGWLEGYLLTGRHGLFSCYE
PHK_BEII9       RVFGPDETASNRLQALYDVTDKTWNAAFIAEDEHLDPTGRVMEILSEHTCQGWLEGYLLTGRHGLMSCYE
PHK_RHOPB       RLFGPDETASNRLEAVFEVSGKEWMAEVEHVDINLSVDGRVMEVLSEHLCQGWLEGYLLTGRHGLFSCYE
PHK_RHOPS       RLFGPDETASNRLDAVLEVTDKEWMAEIEDVDVALGPDGRVMEVLSEHLCQGWLEGYLLTGRHGFFSCYE
PHK_THEEB       RIFGPDETTSNKLNAVYEASKKFWIAESFDEDAELSPEGRVIEMLSEHTLEGMLEGYLLTGRHGFFSTYE
PHK_SYNY3       RLFGPDENSSNKLHAVYEVSKKFWIAEYLEEDQELSPDGRVMEMLSEHTLEGWLEAYLLTGRHGFFATYE
PHK1_ANASP      RIFGPDETASNRLSAVYEVSEKTWLADILPEDSELSTDGRVMEMLSEHNLFGWLEGYLLSGRHGLFHSYE
PHK_SYNP6       RLFGPDETASNRLDAVYEVTSKVWLGDRIPEDEDLSDRGRVMEILSEHTLEGWLEAYLLTGRHGFFATYE
PHK_SYNE7       RLFGPDETASNRLDAVYEVTSKVWLGDRIPEDEDLSDRGRVMEILSEHTLEGWLEAYLLTGRHGFFATYE
PHK_METCA       RLFGPDENTSNKLDAVYAAAKKFWIAEYFPEDQELAPDGRVMEMLSEHTLEGMLEGYLLTGRHGFLSTYE
PHK_CLOAB       RIFGPDETMSNRLWAVFEGTKRQWLSEKEPNDEFLSNDGRIVDMLSEHLCEGWLEGYLLTGRHGFFASYE
PHK_PSEP1       RLFGPDETASNRLDAVFEVTDKVWLDARASDDRHLSAQGRVMEILSEHICEGWLEGYLLTGRHGLFSCYE
XPKA_LACPE      RLFGPDETMSNRLYGVFETTNRQWMEDIHPSDQYEAPAGRVLDALSEHQAEGWLEGYVLTGRHGLFASYE
PHK1_LACPL      RLFGPDETMSNRLYGVFETTNRQWMEDIHPSDQYEAPAGRVLDALSEHQAEGWLEGYVLTGRHGLFASYE
PHK_PEDPA       RMFGPDETMSNRLYGLFEVTNRQFVAPKKDWDEALAPEGRILDALSEHSAEGWLETYTLTGRHGIFTSYE
PHK_LACSS       RIFGPDETMSNRLNHIFDVTNRQWMEPKEPNDQFMATEGRVLDQLSEHQAEGWLEGYVLTGRHGFFASYE
PHK2_LACPL      RGWGPDETLSNKLGAAFEDTKRQWMEPHEPNDALLAPQGRIIDMLSEHMDEGMLEAYNLTGRYGFFASYE
XFP_BIFAS       RVFGPDETASNRLNATYEVTKKQWDNGYLSVDENMAVTGQVVEQLSEHQCEGFLEAYLLTGRHGIWSSYE
PHK_BIFA0       RVFGPDETASNRLNATYEVTKKQWDNGYLSVDENMAVTGQVVEQLSEHQCEGFLEAYLLTGRHGIWSSYE
PHK_LACLA       RLFGPDETMSNRFWEMFKVTNRQWMQVKNPNDEFISPEGRIIDSLSEHQAEGWLEGYTLTGRTGAFASYE
PHK_SCHPO       RIFSPDELESNKLDGALKHSYRTMQTD----PELMAKRGRVTEVLSEHLCQGFMQGYTLTGRTAIFPSYE


                         *         .         .         .         .         +         .:560
query           AFIHIVDSMVNQHAKWLKVSRELPWRRPISSLNYLLSSHVWRQDHNGFSHQDPGFIDHVVNKKPEIIRVY
PHK_MYCA1       AFVHIVDSMLNQHAKWLATSRELPWRRPIASLNYLLTSHVWRQDHNGASHQDPGFIDLVANKRAELTRVY
PHK_MYCPA       AFVHIVDSMLNQHAKWLATSRELPWRRPIASLNYLLTSHVWRQDHNGASHQDPGFIDLVANKRAELTRVY
PHK2_ANASP      AFIHIIDSMFNQHAKWLKTTRHISWRRPVASLNYLLTSHVWRQDHNGFSHQDPGFIDHVVNKKSEIIRVY
PHK_NITMU       AFIHIVDSMFNQHAKWLKVSKEIPWRRPIASLNYLLTSHVWRQDHNGFSHQDPGFIDLVVNKKASIIRVY
PHK_NITEU       AFIHIVDSMFNQHAKWLKVSKEIPWRRPIASLNYLLTSHVWRQDHNGFSHQDPGFIDHVINKKADTIRIY
PHK_GLOVI       AFIHLVDSMFNQHAKWLKTTRHIPWRRPIASLNYLLTSHVWRQDHNGFSHQDPGFIDHVVNKRAEVIRVY
PHK_BRAJA       AFIHIVDSMFNQHAKWLKVTRHLPWRRPIASLNYLLTSHVWRQDHNGFSHQDPGFVDLVANKKADIVRIY
PHK_STRAW       AFVHIVDSMVNQHIKWLKTSRELAWRAPIASLNYLLTSHVWRQDHNGFSHQDPGFVDHVLNKSPEAVRVY
PHK_CHLTE       AFIHIIDSMFNQHAKWLKVTAEIPWRRPIASLNYFLTSHVWRQDHNGFSHQDPGFIDHVVNKKSSVIRVY
PHK_STRCO       AFVHIVDSMVNQHVKWLRVTRRLPWRAPIASLNYLLTSHVWRQDHNGFSHQEPGFVDHILNKSPEAVRVY
PHK_RHILO       AFIHIVDSMFNQHAKWLDACREIPWRRPIASLNYLLSSHVWHQEHNGFSHQDPGFIDVALNKKADIVRVY
PHK_RHOPT       AFIHIIDSMFNQHAKWLKACATIPWRKPIASLNYLLTSHVWRQDHNGFSHQDPGFIDHVANKKSNVVRIY
PHK_RHOPA       AFIHIIDSMFNQHAKWLKACATIPWRKPIASLNYLLTSHVWRQDHNGFSHQDPGFIDHVANKKSNVVRIY
PHK1_RHIME      AFIHIIDSMFNQHAKWLKVCNEIPWRRPIASLNYFLSSHVWRQDHNGFSHQDPGFIDHVVNKKADIIRVY
PHK_PARUW       AFAHIIDSMFNQHAKWLQTTLTIPWRAPIPSINILLSSHVWRQDHNGFSHQDPGFIDLVMNKKAAVVRVY
PHK_BRUSU       AFIHIIDSMFNQHAKWLQVARELEWRKPISSLNYLLTSHVWRQDHNGFSHQDPGFVDLVANKSADIVRVY
PHK_BRUME       AFIHIIDSMFNQHAKWLQVARELEWRKPISSLNYLLTSHVWRQDHNGFSHQDPGFVDLVANKSADIARVY
PHK_BRUA2       AFIHIIDSMFNQHAKWLQVARELEWRKPISSLNYLLTSHVWRQDHNGFSHQDPGFVDLVANKSADIARVY
PHK2_RHIME      AFIHIVDSMFNQHAKWLKVCREVPWRKPIASLTYLLTSHVWRQDHNGFSHQDPGFIDHVANKKADIIRVY
PHK_RHOBA       AFVHIVDSMFNQHAKWLKVTSELPWRHKIASLNYLLASHVWRQDHNGFTHQDPGFLDVVVNKKAEIVRVY
PHK_NOCFA       AFIHIVDAMFNQHAKWLDASAAVPWRRPLASLNYLLSSHVWRQDHNGFTHQDPGFLDVVLNKKPEIVRVY
PHK_RHOP2       AFIHIIDSMFNQHAKWLKACDAIPWRRPIASLNYLLTSHVWRQDHNGFSHQDPGFIDHVVNKKASVVRVY
PHK_BEII9       AFIHIVDSMVNQHAKWLKTARGVPWRRPIASLNYLLTSHVWRQDHNGFSHQDPGFIDHIANKKSDIARVY
PHK_RHOPB       AFIHIIDSMFNQHAKWLKVCATIPWRKPIGSLNYLLTSHVWRQDHNGFSHQDPGFIDHVANKKADIARIY
PHK_RHOPS       AFIHIVGSMFNQHAKWLKTCDAIPWRRPIASLNYLLTSHVWRQDHNGLSHQDPGFIDHVVNKKASVVRVY
PHK_THEEB       AFVHVIDSMFNQHAKWLSICNELSWRADVSSLNLLITSTVWRQDHNGFTHQDPGFLDIVCNKSAKVTRIY
PHK_SYNY3       SFAHVITSMVNQHAKWLDICRHLNWRADISSLNILMTSTVWRQDHNGFTHQDPGFLDVILNKSPDVVRIY
PHK1_ANASP      AFAHIVDSMFNQHAKWLEISKEVAWRSPISSENILLSSTVWRQDNNGFSHQDPGFIDLVTNKSANVTRIY
PHK_SYNP6       AFAHVIDSMVNQHAKWLDVSREVDWRAPVSSLNILLSSTVWRQDHNGFSHQDPGFIDLVTNKSARVTRIY
PHK_SYNE7       AFAHVIDSMVNQHAKWLDVSREVDWRAPVSSLNILLSSTVWRQDHNGFSHQDPGFIDLVTNKSARVTRIY
PHK_METCA       AFVHVIDSMFNQHAKWLSICNQLSWRQDVASLNLLITSTVWRQDHNGFTHQDPGFLDVVVNKSADVTRIY
PHK_CLOAB       AFLRIVDSMITQHGKWLKVTSQLPWRKDIASLNLIATSNVWQQDHNGYTHQDPGLLGHIVDKKPEIVRAY
PHK_PSEP1       AFIHIVDSMINQHAKWLKTAAEVPWRKPIASLNILLTSHVWRQDHNGFSHQDPGXXXXXXXXXXXXXRIY
XPKA_LACPE      AFLRVVDSMLTQHFKWLRKANELDWRKKYPSLNIIAASTVFQQDHNGYTHQDPGALTHLAEKKPEYIREY
PHK1_LACPL      AFLRVVDSMLTQHFKWLRKANELDWRKKYPSLNIIAASTVFQQDHNGYTHQDPGALTHLAEKKPEYIREY
PHK_PEDPA       AFLRVVDSMITQHFKWLRKADELDWRNDYPSLNLVSTSTSFQQDHNGYTHQDPGLLTHLAEKKPEFIREY
PHK_LACSS       SFLRVVDSMLTQHFKWLRKADEQAWRNKYPSLNVIATSTVFQQDHNGYTHQDPGVLTHLAEKKPEFIREY
PHK2_LACPL      SFLRVVDSMLTQHFKWLRNSEETPWRADVPSLNVIASSTAFQQDHNGYSHQDPGIISHLAEKKTEYVRAY
XFP_BIFAS       SFVHVIDSMLNQHAKWLEATREIPWRKPISSVNLLVSSHVWRQDHNGFSHQDPGVTSVLLNKNDHVTNIY
PHK_BIFA0       SFVHVIDSMLNQHAKWLEATREIPWRKPISSVNLLVSSHVWRQDHNGFSHQDPGVTSVLLNKNDHVTNIY
PHK_LACLA       SFLRVVDSMLTQHFKWIRQAADQKWRHDYPSLNVISTSTVFQQDHNGYTHQDPGMLTHLAEKKSDFIRQY
PHK_SCHPO       AFMTIVVSMLVQYSKFLKMGLETGWHGKFGSLNYVTSSTWARQEHNGFSHQSPRFITTMLSLKPGVSRVY


                         .         .         .         *         .         .         .:630
query           LPPDCNTLLCTMDHCLRSRNFINVVIAGKQPQLTYLPMEAAIAHCTRGAGIWEWASSDEGAEPDVVLACA
PHK_MYCA1       LPPDGNTLLSVADHCLRSRDYINVIVAGKQPALAYLDMDAAIAHCTRGLGIWDWASTARGAEPDVVLACA
PHK_MYCPA       LPPDGNTLLSVADHCLRSRDYINVIVAGKQPALAYLDMDAAIAHCTRGLGIWDWASTARGAEPDVVLACA
PHK2_ANASP      LPPDANTLLSVTDHCLRSRNYVNVIVAGKQPALQFLDMDAAVKHCTKGIGIWEWASNDQGSEPDVVMACA
PHK_NITMU       LPPDANTLLYITDKCLRSRNFINVIVAGKQPALQWLDMDAAIRHGSAGIGIWGWASNDQEDEPDVVMACA
PHK_NITEU       LPPDANCLLYITDKCLRSRNFVNVIVAGKQPQLQWLDMDAAIKHCTAGIGIWGWASNDQAGEPDVVIACA
PHK_GLOVI       LPPDANTLLSVTDHCLRSRHYVNVVVAGKQPALQYLDMDAAIKHCTKGIGIWDWASNDQGVEPDVVMACC
PHK_BRAJA       FPPDANTLLWIADHCLRTYNRINVIVAGKQPAPQWLSMQDAATHCDVGIGIWTWATEDAGGEPDVVMACA
PHK_STRAW       LPPDANTLLSVADHVLRSRDYVNVVVAGKQPCFDWLSMEQARAHCARGAGIWEWAGTQNDGEPDVVLACA
PHK_CHLTE       LPPDANSLLSVTNHCLRSRNYINVIVAGKQPAWQWLDMESAVRHCTSGIGIWEWASNDANGEPDVVMACA
PHK_STRCO       LPPDANTLLSVADHALRSRDYVNVIVAGKQPCFDWLTMDQAKAHCARGAGIWDWAGTEDGSEPDVVLACA
PHK_RHILO       LPPDANTLLCVTDHVLQTWNRINVIVAGKPPSWQWLSMDKAIVHCRAGIGVWDWASTDDGAEPDVVMACA
PHK_RHOPT       LPPDANCLLSVADHCLRSRNYVNLIVAGKQPEWQWLDIDAAVRHCTTGAGIWHWA-SDEG-EPDVVMACA
PHK_RHOPA       LPPDANCLLSVADHCLRSRNYVNLIVAGKQPEWQWLDIDAAVRHCTTGAGIWHWA-SDEG-EPDVVMACA
PHK1_RHIME      LPPDANTLLSVTDHCLRSRNYINVVVAGKQPSPQWLTMDQAVKHCTEGLGIWEWASNDKGCEPDVVMACC
PHK_PARUW       LPPDSNTLLSVTDHCLRSLNYINVIVAGKQPALQYLSMEAAIKHCTAGIGIWEWASNDKGGEPDVVLACA
PHK_BRUSU       FPPDANTLLWVGDHCLKTWNRVNVIVAGKQPEPQWLTMAEAEKHCEAGLGIWEWAGTEDGLEPDIVMACA
PHK_BRUME       FPPDANTLLWVGDHCLKTWNRVNVIVAGKQPEPQWLTMAEAEKHCEAGLGIWEWAGTEDGLEPDIVMACA
PHK_BRUA2       FPPDANTLLWVGDHCLKTWNRVNVIVAGKQPEPQWLTMAEAEKHCEAGLGIWEWAGTEDGLEPDIVMACA
PHK2_RHIME      LPPDANTLLSVVDHCARSRDYINVIVAGKQPQLQWLDMGAAVAHCRAGLGVWEWASNDEG-DPDAVVACA
PHK_RHOBA       LPPDANCLLSVMDHCLRSQHYVNVVVAGKHPSPQWLTMGEAAEHCAKGIGIWDWAGNESSSDPDVVMACC
PHK_NOCFA       LPPDANTLLSTYDHCLRSRHYVNVVVAGKQPQEDWLSVEQAAVHCARGLGIWEWANDDPGTTPDVVLACA
PHK_RHOP2       LPPDANCLLSVADHCLRSRNYVNLIVAGKQPEWQWLDIDAAVRHCTAGAGIWHWASNDDG-DPDVVMACA
PHK_BEII9       LPPDANCLLYITDHCLRSWNRINVIVAGKQPEPQWLDMEEAISHCRAGLGIWSFASNDQDSEPDVVLACA
PHK_RHOPB       LPPDANCLLSVTDHCLRSRNYVNVIVAGKQPEWQWLDIDAAVRHCTAGAGIWRFASNDAG-DPDVVMACA
PHK_RHOPS       LPPDANCLLSVADHCLRSRNYVNLIVAGKQPEWQWLDIDSAVRHCSAGAGIWHWASNGED-DPDVVMACA
PHK_THEEB       LPPDVNSLLSVADHCLRSKNYVNVIVSDKQLHLQYLTMDQAIIHCTKGVGIWDWASNDQGYEPDLVMASA
PHK_SYNY3       LPPDVNSLLSVADHCLQSKNYINIIVCDKQAHLQYQDMTSAIRNCTKGVDIWEWASNDAGTEPDVVMAAA
PHK1_ANASP      LPPDANCLLSVADHCLRSTNYVNVIVADKQKHLQFLSIEEAIAHCTKGIGIWDWASNDHHGQPDVIMASC
PHK_SYNP6       LPPDANCLLSVADHCLRSTDYINVIVADKQSHLQYLDAEAAARHCAKGIGIWDWASNDQGASPDVVIASC
PHK_SYNE7       LPPDANCLLSVADHCLRSTDYINVIVADKQSHLQYLDAEAAARHCAKGIGIWDWASNDQGASPDVVIASC
PHK_METCA       LPPDVNSLLSVADHCLRSQNYINVIVSDKQLHLQFMDMDAAIAHCTEGLGIWEWASNDEGQEPDVVMACA
PHK_CLOAB       LPADANTLLAVFDKCLHTKHKINLLVTSKHPRQQWLTMDQAVKHVEQGISIWDWASNDKGQEPDVVIASC
PHK_PSEP1       LPPDANCLLSVAEHCLRSRGYINVIVAGKQMEWQWLDCEAAAVHCQSGIGRWGWACHDD-EMPEVVLACA
XPKA_LACPE      LPADANSLLAVGDVIFRSQEKINYVVTSKHPRQQWFSIEEAKQLVDNGLGIIDWASTDQGSEPDIVFAAA
PHK1_LACPL      LPADANTLLAVGDVIFRSQEKINYVVTSKHPRQQWFSIEEAKQLVDNGLGIIDWASTDQGSEPDIVFAAA
PHK_PEDPA       LPADANSLLAISPLVMNDRNKINLIIASKQPRPQFYSMEEAEVLAKNGLGIIDWASTTNGEEPDVVFAAA
PHK_LACSS       LPADANTLLATMNTVFQSQEKINLVIASKHPRQQWFSIDEATVLVKNGLKIIDWASTDQDAEPDVVIAAA
PHK2_LACPL      LPGDANTLIATFDKAIQSKQLINLIIASKHPRPQWFTMDEAKRLVRDGLGVVDWASTDHGEEPDVVFATA
XFP_BIFAS       FATDANMLLAIAEKCFKSTNKINAIFAGKQPAATWITLDEVRAELEAGAAEWKWASAKSNDEVQVVLAAA
PHK_BIFA0       FATDANMLLAIAEKCFKSTNKINAIFAGKQPAATWITLDXXXXXXXXXXXXWKWASAKSNDEVQVVLAAA
PHK_LACLA       LPADGNTLLAVFDRAFQDRSKINHIVASKQPRQQWFTKEEAEKLATDGIATIDWASAKDGEAVDLVFASA
PHK_SCHPO       FPPDANCFLATVARCMKSENTINLMVSSKNPQPAYLSVEEAEHHCKAGASVWKFASTDNGENPDVVIAGV


                         .         +         .         .         .         .         *:700
query           GDVPTLETLAAADLLRRHLPELRVRVVNVVDLMRLSNEGEHPHAMTDREYDTLFTRDKPVIFAFHGYPWL
PHK_MYCA1       GDIPTLETLAAADILRRELPDLAVRVVNVVDLMRLQPDSEHPHGLPDREFDALFTRDRPVIFAYHGYPWL
PHK_MYCPA       GDIPTLETLAAADILRRELPDLAVRVVNVVDLMRLQPDSEHPHGLPDREFDALFTRDRPVIFAYHGYPWL
PHK2_ANASP      GDVPTLETLAAVDILRQHFPDLKVRVVNVVDLMTLQPKTEHPHGLNPKDFETIFTTDKPIIFAFHGYPWL
PHK_NITMU       GDIPTLETLAAVDLLRRHVPELRIRVVNIVDLMTLQPRSEHPDGLSDWDFDTLFTTNKPIIFAYHGYPWL
PHK_NITEU       GDVPTIEVLAAVSILREHLPDLRIRVINVVDLMTLQHDREHPQGLSDREFDTLFTTDKPIIFAYHGYPWL
PHK_GLOVI       GDIPTLETLAAVDILRQNFPDLKIRVINVVNLMKLQPESEHPHGLSDKDFDSIFTPDKPVVFAFHGYPWL
PHK_BRAJA       GDVPTLETLAAVDLLRKALPDLNIRVVNVVDLMTLQPQDQHPHGLSDRDFDSLFTRDKPVIFAYHGYPHL
PHK_STRAW       GDVPTQEVLAASALLRRHLPALAVRVVNVVDMTRLLPREAHPHGMSDFEYDGLFTTDKPVIFAYHGYPWL
PHK_CHLTE       GDVPTLETLAAVKILRKLAPELKIRVVNVVDLMTLQPKEEHPHGLADRDFDDMFTTDKPIIFAYHGYPWL
PHK_STRCO       GDVPTLEILAAAQLIRHHLPELAVRVVNVVDIARLLPSGEHPHGMSDFEYDGLFTADKPVIFAYHGYPWL
PHK_RHILO       GDVPTLETLAAVQILRQQVPDLRIRVVNVVDLMTLQPKEYHPHGLSDREFDALFTPDKPVIFAYHGYPWT
PHK_RHOPT       GDVPTVETLAAVKLLREYVPDIKIRVVNVVDLMVLQPSSEHPHGLDDRRFDELFTTDKPVIFAFHGYPWL
PHK_RHOPA       GDVPTVETLAAVKLLREYVPDIKIRVVNVVDLMVLQPSSEHPHGLDDRRFDELFTTDKPVIFAFHGYPWL
PHK1_RHIME      GDVPTLETLAAVQLLREHLPELKVRVINVVNLMKLQPSGEHPHGLPDRDFDALFTKDKPIIFAFHGYPWL
PHK_PARUW       GDIPTLEILAAVDILRQSIPTLKIRVINVVDLMTLQPKEEHPHGLSNTDFDEMFTTNKPIIFAYHGYPWL
PHK_BRUSU       GDVPTMETLAAVDLLRQSLPHLRIRVVNVVDLMVLQSPHQHPHGISDEEFDRMFTTNRPVIFAYHGYPYL
PHK_BRUME       GDVPTMETLAAVDLLRQSLPHLRIRVVNVVDLMVLQSPHQHPHGISDEEFDRMFTTNRPVIFAYHGYPYL
PHK_BRUA2       GDVPTMETLAAVDLLRQSLPHLRIRVVNVVDLMVLQSPHQHPHGISDEEFDRMFTTNRPVIFAYHGYPYL
PHK2_RHIME      GDVPTMEALAAVMIVREAFPSLRLRVVNVVDLMALQAPSQHPHGIADDAFDRMFTTDKPVIFAYHGYPGL
PHK_RHOBA       GDVPTLETLAAVSILREHLPDLTIRVVNVVDLMRLQPKSEHPHGLSDSDFDALFTKNKHVIFAFHAYPWL
PHK_NOCFA       GDVPTLETLAAAAIXXXXXXXXXXXXINVVDLMRLLPAEEHPHGLPDREFDTLFTTASPIIFAFHGYPWL
PHK_RHOP2       GDVPTVETLAAVMLLREYVPDIRIRVVNVVDLMVLQPSSEHPHGLDDRRFDELFTVDKPVVFAFHGYPWL
PHK_BEII9       GDVPTLETLAAADFLHTHLPEVKVRVVNIVDLFALEPQTRHPHGWSXXXXXXXXXXXXPVIFAYHGYPSL
PHK_RHOPB       GDVPTVEALAAVKLLREYXXXXXXXXXXXXXXXXXQPRSEHPHGLDDRGFDELFTTDKPVIFAFHGYPSM
PHK_RHOPS       GDVPTLETLAAVMLLREYXXXXXXXXXXXXXXXXXQPSSEHPHGLDDKRFDEIFTVDKPVVFAFHGYPWL
PHK_THEEB       GDIPTQEALAAIALLRQEFPELKIRYINVVDLFKLQPETEHPHGLSDRDFDSLFTLDRPIIFNFHGYPWL
PHK_SYNY3       GDIPTKEALAATAMLRQFFPNLRIRFVSVIDLLKLQPESEHPHGLSDRDFDSLFTTDKPIIFNFHAYPWL
PHK1_ANASP      GDVVTMEALAATAILRDEFPDLKVRFINVVDLYKLQPDTEHPHGLSDWDFDSLFTTDKPVIFNFHGYPWL
PHK_SYNP6       GDVVXXXXXXXXXXXREHFPDLKIRFVNVVDLFRLQPDTEHPHGLSDRDFDSLFTVDKPIIFNFHGYPWL
PHK_SYNE7       GDVVXXXXXXXXXXXREHFPDLKIRFVNVVDLFRLQPDTEHPHGLSDRDFDSLFTVDKPIIFNFHGYPWL
PHK_METCA       GDIPXXXXXXXXXXXXXXFPELKIRFINVVDLFKLQPESEHPHGLSDKDFDSLFTRDKPVIFNFHGYPWL
PHK_CLOAB       GDTPTLEALAAVTILHEHLPELKVRFVNVVDMMKLLPENEHPHGLSDKDYNALFTTDKPVIFAFHGFAHL
PHK_PSEP1       GDVPTLEVLAAVTLLQEQAPDXXXXXXXXXDLMALQLSQQHPHGLSDSDFNGLFTEDRPVIFAFHGYPAL
XPKA_LACPE      GTEPTLETLAAIQLLHDSFPDMKIRFVNVVDILKLRSPEKDPRGLSDAEFDHYFTKDKPVVFAFHGYEDL
PHK1_LACPL      GTEPTLETLAAIQLLHDSFPEMKIRFVNVVDILKLRSPEKDPRGLSDAEFDHYFTKDKPVVFAFHGYEDL
PHK_PEDPA       GTEPNMESLAAINILHDNFPDLKIRFINVVDLLKLQSPKVNPNGLSDEEFDRYFTKDKPVIFTFHGFEDL
PHK_LACSS       GTEPTLESLAAISILHKQYPDMKIRFINVVDLLKLRSPKVDPRGLTDEEFDMYFTKDKPVVFAFHGFEGL
PHK2_LACPL      GSEPTTESLAAVSILHARFPEMKIRFINVVDLLKLKK--DDPRGLSDAEFDAFFTKDKPVIFAYHAYDDL
XFP_BIFAS       GDVPTQEIMAASDALNK--MGIKFKVVNVVDLIKLQSSKENDEAMSDEDFADLFTADKPVLFAYHSYAQD
PHK_BIFA0       GDVPTQEIMAASDALNK--MGIKFKVVNVVDLIKLQSSKENDEAMSDEDFADLFTADKPVLFAYHSYAQD
PHK_LACLA       GAEPTIETLAALHLVNEVFPQAKFRYVNVVELGRLQKKKNQERELSDEEFEKYFPSGTPVIFGFHGYEDL
PHK_SCHPO       GNEIMFEVVKAAEMLQNDIPELRVRVINVTDLMVLSS--LHPHGMNPAEFDSLFTKDRHVHFNYHGYVMD


                         .         .         .         .         +         .         .:770
query           IHRLTYRRAGHPNLHVRGYKEEGTTTTPFDMVMLNDLDRFHLVMDVIDRVPGLGVRAAGLRQHMQDERLR
PHK_MYCA1       IHRLTYRRANHAQLHVRGFKERGTTTTPFDMVMLNDLDRFHLVIDVLDRVEGLASRAAMLRQRMVDARLA
PHK_MYCPA       IHRLTYRRANHAQLHVRGFKERGTTTTPFDMVMLNDLDRFHLVIDVLDRVEGLASRAAMLRQRMVDARLA
PHK2_ANASP      IHRLTYRQPNHNNLHVRGYKEEGTTTTPFDMVVLNDLDRFHLVMDVIDRVPKLGYKAAYVKQQLQDKLIE
PHK_NITMU       IHRLTYRRTNHPNLHVRGYKEEGTTTTPFDMTVLNDLDRFHLVMDVADRVPKLSSKGAYLKQLMRDKLID
PHK_NITEU       IHRLTYRRTNHANLHVRGYKEEGTTTTPFDMTVLNDMDRFHLVDDVIDRVPHLGYKAAYLRQIMRDKLVE
PHK_GLOVI       IHRLTYRRNNHNNIHVRGYKEEGTTTTPFDMVVMNDLDRFNLADDVIDRVPRLRYTAAHVKQMLHDKLIE
PHK_BRAJA       IHRLTYNRTNHAGLHVRGFAEEGTTTTPFDMVVLNELDRYHLAIEAIERVPGLATRAAQVKQQLRDKLLE
PHK_STRAW       IHRLAYSRTGHGNLHVRGYKEMGTTTTPFDMVVRNDLDRYRLVMDVVDRVPGLGVRAAAVRQTMADARTR
PHK_CHLTE       IHRLTYRRTNHHNLHVRGYKEEGTTTTPFDMVVMNELDRFHLVADVANRVESLRPQAAYIKQYVRDRLIE
PHK_STRCO       IHRLAYRRTGHAHLHVRGYKEIGTTTTPFDMVVGNDLDRYRLVMDVIDRVPGLAVRAAAVRQRMEDARQR
PHK_RHILO       IHRLTYRRTNHDNIHVRGYNEEGTTTTPFDMTVLNGLDRFHIVQSVLDWVPRLGVRVS-LKQAMDSKLLE
PHK_RHOPT       IHRLTYRRRNHVNIHVRGYKEEGTTTTPFDMVVLNDLDRYRLALDAILRIPRLADQRDAATSRYWATMQR
PHK_RHOPA       IHRLTYRRRNHVNIHVRGYKEEGTTTTPFDMVVLNDLDRYRLALDAILRIPRLADQRDAATSRYWATMQR
PHK1_RHIME      IHRLTYRRTNHANLHVRGYKEEGTTTTPFDMVVLNHLDRFHLVEDVIDRLPQLGARAAYFKQAIHERLID
PHK_PARUW       IHRLTYRRSNHSNIHVRGYKEEGTTTTPFDMVVLNEVDRFHLVGDVIDRVPKLGYLAAYTKQEMRHKLIE
PHK_BRUSU       IHRLVYKRTNHSNFHVRGFIEQGTTTTPFDMTVLNELDRFHLAMEAVERLPLGESVAKPLIDNFTEKLAL
PHK_BRUME       IHRLVYKRTNHSNFHVRGFIEQGTTTTPFDMTVLNELDRFHLAMEAVERLPLGESVAKPLIDNFTEKLAL
PHK_BRUA2       IHRLVYKRTNHSNFHVRGFIEQGTTTTPFDMTVLNELDRFHLAMEAVERLPLGESVAKPLIDNFTEKLAL
PHK2_RHIME      IHRLTYRRTNHANFHVHGYQEEGTTTTPFDMAVLNKLDRFHLAKAVVERVPSLASPREGFAHFVESKLAE
PHK_RHOBA       VHRLTYRRTNHANIHVRGYKEEGTITTPFDMTVLNDLDRFHLVMDAIDRLPETGGRGQRLKALMQEKLVE
PHK_NOCFA       IHRLTYRRTNHDGLHVRGYKEEGTTTTPFDMVMLNDLDRYHLVMDVIDRVPGLRETAAGLRQEMVDARWR
PHK_RHOP2       IHRLTYRRRNHFNIHVRGYKEEGSTTTPFDMVVLNDLDRYRLALDAIRRIPRLAGQVESATDRYWATMQR
PHK_BEII9       IHRLIYKRTNHSNFHVHGYQEEGSTTTPFDMVVRNRLDRFHLVGDVVDHLPKLGAKAAYVKQWLRDKFAE
PHK_RHOPB       IHKLTYRRHNHHNIHVRGYKEEGTTTTPFDMVVLNDLDRYRLTLDAILRIPRLSGQREAATARYWDSIQR
PHK_RHOPS       IHRLTYRRRNHFNIHVRGYKEEGSTTTPFDMVVLNDLDRYRLALDAIRRIPRLAGEVEAATARYWATMQR
PHK_THEEB       IHRLAYRRHNHRNLHVRGYKEKGNINTPLELAINNEIDRFSLAIDAIDRLPELQVAGAHAKEKFRNMQIA
PHK_SYNY3       IHRLTYRRTNHGNLHVRGYKEKGNINTPMDLAIQNQIDRFSLAIDVIDRLPQLRVAGAHIKEMLKDMQID
PHK1_ANASP      IHKLAYRRTNHENIHVRGYKEKGSINTPLELAINNQVDRFNLVIDVIDRVPKLGSAAVYVRERMKKEIIN
PHK_SYNP6       IHKLAYRRHNHNNLHVRGYKEVGNINTPLELAIRNQVDRFNLAIDVIDRVPHLRDRGAHVKEWLKDQIHD
PHK_SYNE7       IHKLAYRRHNHNNLHVRGYKEVGNINTPLELAIRNQVDRFNLAIDVIDRVPHLRDRGAHVKEWLKDQIHD
PHK_METCA       IHRLAYRRTNHANMHVRGYKEKGNINTPLELAINNQIDRFSLAIDVIDRIPEIAVSGAHAKARFRKQQIA
PHK_CLOAB       INQLTYHRENR-NLHVHGYMEEGTITTPFDMRVQNKLDRFNLVKDVVENLPQLGNRGAHLVQLMNDKLVE
PHK_PSEP1       IHRLIYKRANPQRFHVRGFREEGATTTPFDMAVINNLDRYQLLLDVFERVPRLQPQLEQARARYWATMEK
XPKA_LACPE      VRDIFFDRHNH-NLHVHGYRENGDITTPFDVRVMNQMDRFDLAKSAIAAQPAMENTGAAFVQDMDNMLAK
PHK1_LACPL      VRDIFFDRHNH-NLYVHGYRENGDITTPFDVRVMNQMDRFDLAKSAIAAQPAMENTGAAFVQSMDNMLAK
PHK_PEDPA       IRSIFFDRHNH-NLHVHGYREEGDITTPFDMRVLNELDRFHLAQDTINSIPEFAEKGADFSQQMDNTLER
PHK_LACSS       VRDIFFDRHNH-NLHVHGYRENGDITTPFDMRVLNQMDRYNLSKEV--AIDVLGDQAGQFAQSMDDMVAK
PHK2_LACPL      VKTIFFDRHNH-NLHVHGYREEGDITTPFDMRVRNELDRFHLVKAALLATPAYAEKGAHVIQEMNSILDK
XFP_BIFAS       VRGLIYDRPNHDNFTVVGYKEQGSTTTPFDMVRVNDMDRYALQAKALELID--ADKYADKINELNEFRKT
PHK_BIFA0       VRGLIYDRPNHDNFTVVGYKEQGSTTTPFDMVRVNDMDRYALQAKALELID--ADKYADKINELNEFRKT
PHK_LACLA       IESIFYQR-GHDGLIVHGYREDGDITTTYDMRVYSELDRFHQAIDAVNRKVNQGLAKAFI-DRMKRTLVK
PHK_SCHPO       LKALLFDRIQGTRVTMEGYREEGTTTTPFNMMMCNNTSRYHVARMALQHA-----------LHNPTVAVN


                         .         .         *         .         .         .         .:840
query           CRAYTRQYGEDAPDIRNWVWEP
PHK_MYCA1       ARMYTREHGEDDPAIANWTWEP
PHK_MYCPA       ARMYTREHGEDDPAIANWTWEP
PHK2_ANASP      HKHYISQHGEDMPDISDWQW--
PHK_NITMU       HKRYIRQYGEDMPEIRDWHW--
PHK_NITEU       HREYINRHGEDMPEIRDWKW--
PHK_GLOVI       HKQYIHEHGDDMPEIRDWCW--
PHK_BRAJA       HSRYVREHGEDMPEIRDWVW--
PHK_STRAW       HHAWIREHGTDLPEVANWTWE-
PHK_CHLTE       HKEYITKYGEDMPEVRDWRWE-
PHK_STRCO       HHDWIREHGVDLPEVADWTWE-
PHK_RHILO       HRAYICSHGQDMPEILDWKW--
PHK_RHOPT       HKLYIGEHGDDLPEVRDWRW--
PHK_RHOPA       HKLYIGEHGDDLPEVRDWRW--
PHK1_RHIME      HRHHIEKYGEDMPVI-------
PHK_PARUW       HKEYIHQFGEDMPSVKNWKW--
PHK_BRUSU       HKDYIRQHGEDMPEIRDWKW--
PHK_BRUME       HKDYIRQHGEDMPEIRDWKW--
PHK_BRUA2       HKDYIRQHGEDMPEIRDWKW--
PHK2_RHIME      HDAYIRENGEDLPEIRNWRW--
PHK_RHOBA       HRRYINENGQDMPEIRDWEW--
PHK_NOCFA       ARAWTREHGADIPVVADWTW--
PHK_RHOP2       HKLYIGEHGDDMPEIRDWRWQ-
PHK_BEII9       HERYIVAHGEDLPEIRHWRW--
PHK_RHOPB       HKLYIGEHGDDLPEIVDWRW--
PHK_RHOPS       HKLYIGEHGDDMPEVRDWSWQ-
PHK_THEEB       ARNYAYEYGVDKPEFSHWTW--
PHK_SYNY3       CTNYAYEHGIDMPEIVNWRW--
PHK1_ANASP      NRNYAHKHGIDQPEILNWKW--
PHK_SYNP6       HIQYAYQEGIDRPEINQWQW--
PHK_SYNE7       HIQYAYQEGIDRPEINQWQW--
PHK_METCA       CRQYAYEHGVDMPEVAGWRW--
PHK_CLOAB       HNQYIREVGEDLPEITNWQW--
PHK_PSEP1       HKLYLIEHGEDMPEVAQWRW--
XPKA_LACPE      HNAYIRDAGTDLPEVNDWQWK-
PHK1_LACPL      HNAYIRDAGTDLPEVNDWQWK-
PHK_PEDPA       HYQYIRDNGDDLPEVTNWTWK-
PHK_LACSS       HNQYIRDEGTDLPEVEEWQWTP
PHK2_LACPL      HHDYIRAEGTDIPEVENWKW--
XFP_BIFAS       AFQFAVDNGYDIPEFTDWVY--
PHK_BIFA0       AFQFAVDNGYDIPEFTDWVY--
PHK_LACLA       HFEVTRNEGVDIPDFTEWVW--
PHK_SCHPO       CNMLCAKYAWKLEEIENYIME-