[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ54134.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3ednA.bssp"
#ERROR : Can't open dsspfile "1bwzA.bssp"
#ERROR : Can't open dsspfile "3ejxD.bssp"
#ERROR : Can't open dsspfile "3ejxB.bssp"
#ERROR : Can't open dsspfile "2edmA.bssp"
#ERROR : Can't open dsspfile "3ejxA.bssp"
#ERROR : Can't open dsspfile "3d9bA.bssp"

## Summary of PDB Search
:267
    1e-39  20%  3ednA  [x.x.x] PHENAZINE BIOSYNTHESIS PROTEIN, PHZF FAMILY
    8e-32  16%  1bwzA  [d.21.1 - d.21.1] PROTEIN (DIAMINOPIMELATE EPIMERASE)
    1e-28  15%  3ejxD  [x.x.x] DIAMINOPIMELATE EPIMERASE, CHLOROPLASTIC
    1e-20  14%  3ejxB  [x.x.x] DIAMINOPIMELATE EPIMERASE, CHLOROPLASTIC
    2e-18  15%  2edmA  [x.x.x] 22KDA STRUCTURAL PROTEIN VP22
    3e-18  14%  3ejxA  [x.x.x] DIAMINOPIMELATE EPIMERASE, CHLOROPLASTIC
    3e-04  20%  3d9bA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B[MASQUE : MEMB(X) 253
:267

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxRFHVVDAFTDQPFHGNPAAVLVLDSPYDDAWAQRVAAEFNLSETAFVRPLAGADADYELRWFTPTTEV
3ednA           --NVFHYDAFTNK-PNGNPAGIVLDADGLTE-EEQRIAEKVGFNETSFVLS----SEVADIRRYFTPGYE
1bwzA           ---------FSKMHGLGNDFVVVDGNVFFTPETIRRLANRHGFDQLLIVEAPYDPELDFHYRIFNADSEV
3ejxD           --KETGVLHFVKYHGLGNDFILVSSEPKITQEQAAKLCDRVGADGVIFAMP-GVNGTDYAMRIFNSGSEP
3ejxB           ---------FVKYHGLGNDFILVDNRDSSEQEQAAKLCDRNFADGVIFAMPGVNGTDYAMRIFNSDGSEP
2edmA           --RAKVMSIRGERSY-NTPLGKVAMKNGLSDKDMKDVSADL--VISTVTAPRTDPASNMTLKILNNTGVD
3ejxA           ---------FVKYHGLGNDFILVDNRDSSEPEQAAKLCDRNGADGVIFAMPGVNGTDYAMRIFNSDGSEP
3d9bA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DLCXXXXXXXXXXXXXXXXXXPFRFASRSGVLTVTARDGLLWLDFPANPPYAKDVPDGLVAALGGEPVWA
3ednA           DLCGHGTVGTIYALRERGLLEELTIETKAGILPIQIGVNENGETFIKRQTDFAGSKEELAHSIGLEVNDL
1bwzA           SQCGNGARCFARFVTLKGLTNKISVSTQKGNMVLTVKMNQIRVNMGEPIWEPAKIPFTANKRTDIQTVLC
3ejxD           EMCGNGVRCFARFIAELENLQGFTIHTGAGLIVPEIQDGQVKVDMGTPILKAQDVPTEAELVVDGVSWNV
3ejxB           EMCGNGVRCFARFIAELENLQGFTIHTGAGLIVPEIQDDGQVKVDMGTPLKAQDVPTKLSGNKGEAVVHC
2edmA           LLI-------------------------------------------------------------------
3ejxA           EMCGNGVRCFARFIAELENLQGFTIHTGAGLIVPEIQDDQVKVDMGTPILKAQDVPTKLSGNKGEAVVEA
3d9bA           ----------------------------------------------------------LLAEAAKHP--D


                         +         .         .         .         .         *         .:210
query           GFSDVNDYFVVYPDEATVRALAPDLAEVARCTVRGVTVTAPADPGQPYDFVSRLFAPAIGIPEDPVTGSA
3ednA           DVSLPNWTVIVPVKNLDVCERKPNNEVFPSVLNASIHPICLETYDEKVHHGRHFSSAYAGTIEDPVTGTA
1bwzA           GAVSMGNPHCVVQQTANVEQLGPLLESHERFP-ERVNAGF-MQIINKEHIKLRVYERGAGETQACGSGAC
3ejxD           TCVSMGHCITFGKKGGPNLKVDDLKFEHHEMFPARTNTEF-VEVLSRSHLKMRVWERGAGATLACGTGAC
3ejxB           ITFGKKGGPNLKVDDLNLPEIGPKFEHHEMF-PARTNTE-FVEVLSRSHLKMRVWERGAGATLACGTGAC
2edmA           ----------------------------------------------------------------------
3ejxA           ELVVDGHCITFGKKGLNLPEIGPKFEHHEMF-PARTNTEFV-EVLSRSHLKMRVWERGAGATLACGTGAC
3d9bA           MLTSVRPQFKIDIDQEKAQALGVSINDINT-TLGGSYVNDFIDRGRVKKVYVMSEAKYRMLPDDYVRAAD


                         .         .         .         +         .         .         .:280
query           HTALGPYWAQRLGRTRLDAVQCSARGGRLVVELPADAPDRVLIGGTAVTVSEGTLRx
3ednA           SGVGAYYVEKDFDHEELIVEQGIHKDGRVTVYVTKDVELQIDIAGTAVYVKEFEVL-
1bwzA           AAVAVGIMQGLLNNN----VQVDLPGGSLMIEWNGV-GHPLYMTGEATHIYDGFIT-
3ejxD           ALVVAAVLEGRADRK----CTVDLPGGPLEIEWKQE-DNHIYMTGPAEAVFYGSAL-
3ejxB           ALVVAAVLEGRADRK----CTVDLPGGPLEIEWKQE-DNHIYMTGPAEAVFYGSAL-
2edmA           ---------------------------------------------------------
3ejxA           ALVVAAVLEGRADRK----CTVDLPGGPLEIEWKQE-DNHIYMTGPAEAVFYGSAL-
3d9bA           RWEYGSPRLERYNGLPSMEILGQAAPGKLASKLPTGV--GYDWTGMS----------