[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ54138.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bzkA.bssp"
#ERROR : Can't open dsspfile "3bzcA.bssp"
#ERROR : Can't open dsspfile "3c6hA.bssp"
#ERROR : Can't open dsspfile "3cltC.bssp"
#ERROR : Can't open dsspfile "2eduA.bssp"
#ERROR : Can't open dsspfile "1dgtB.bssp"
#ERROR : Can't open dsspfile "3cluC.bssp"
#ERROR : Can't open dsspfile "2bgwB.bssp"
#ERROR : Can't open dsspfile "2axtU.bssp"
#ERROR : Can't open dsspfile "1c7yA.bssp"
#ERROR : Can't open dsspfile "2bhnA.bssp"
#ERROR : Can't open dsspfile "2bgwA.bssp"
#ERROR : Can't open dsspfile "2ao9E.bssp"
#ERROR : Can't open dsspfile "2ao9B.bssp"
#ERROR : Can't open dsspfile "3clrC.bssp"
#ERROR : Can't open dsspfile "3c1yA.bssp"
#ERROR : Can't open dsspfile "2a1jB.bssp"
#ERROR : Can't open dsspfile "2bhnB.bssp"
#ERROR : Can't open dsspfile "3bz1U.bssp"
#ERROR : Can't open dsspfile "3cw2C.bssp"
#ERROR : Can't open dsspfile "1bnoA.bssp"
#ERROR : Can't open dsspfile "2ahoB.bssp"
#ERROR : Can't open dsspfile "3c19A.bssp"
#ERROR : Can't open dsspfile "2c35B.bssp"
#ERROR : Can't open dsspfile "2duyA.bssp"
#ERROR : Can't open dsspfile "1dgsA.bssp"
#ERROR : Can't open dsspfile "3e0dA.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "2ba0A.bssp"
#ERROR : Can't open dsspfile "1dk2A.bssp"

## Summary of PDB Search
:777
    e-133  59%  3bzkA  [x.x.x] TEX
    e-130  59%  3bzcA  [x.x.x] TEX
    1e-28  12%  3c6hA  [x.x.x] TERMINASE LARGE SUBUNIT
    4e-26  11%  3cltC  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT BETA
    1e-21  21%  2eduA  [x.x.x] KINESIN-LIKE PROTEIN KIF22
    2e-20  12%  1dgtB  [x.x.x] DNA LIGASE
    8e-18   7%  3cluC  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT BETA
    2e-17  12%  2bgwB  [x.x.x] XPF ENDONUCLEASE
    5e-17  16%  2axtU  [x.x.x] PHOTOSYSTEM II 12 KDA EXTRINSIC PROTEIN
    2e-16  12%  1c7yA  [b.40.4 - a.60.2 - a.5.1] HOLLIDAY JUNCTION DNA HELICASE RUVA
    2e-15  13%  2bhnA  [x.x.x] XPF ENDONUCLEASE
    2e-14  14%  2bgwA  [x.x.x] XPF ENDONUCLEASE
    4e-14  13%  2ao9E  [x.x.x] PHAGE PROTEIN
    4e-14  13%  2ao9B  [x.x.x] PHAGE PROTEIN
    1e-13  10%  3clrC  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT BETA
    2e-11  21%  3c1yA  [x.x.x] DNA INTEGRITY SCANNING PROTEIN DISA
    2e-10  17%  2a1jB  [x.x.x] DNA EXCISION REPAIR PROTEIN ERCC-1
    5e-10  15%  2bhnB  [x.x.x] XPF ENDONUCLEASE
    2e-09  16%  3bz1U  [x.x.x] PHOTOSYSTEM II 12 KDA EXTRINSIC PROTEIN
    5e-09   6%  3cw2C  [x.x.x] TRANSLATION INITIATION FACTOR 2 SUBUNIT ALPHA
    1e-08  20%  1bnoA  [a.60.6 (1dk3A)] DNA POLYMERASE BETA
    1e-08   4%  2ahoB  [x.x.x] TRANSLATION INITIATION FACTOR 2 ALPHA SUBUNIT
    2e-08   6%  3c19A  [x.x.x] UNCHARACTERIZED PROTEIN MK0293
    2e-07  11%  2c35B  [x.x.x] DNA-DIRECTED RNA POLYMERASE II 19 KDA
    9e-07  35%  2duyA  [x.x.x] COMPETENCE PROTEIN COMEA-RELATED PROTEIN
    2e-06  12%  1dgsA  [d.142.2 - b.40.4 - a.60.2] DNA LIGASE
    2e-06  15%  3e0dA  [x.x.x] DNA POLYMERASE III SUBUNIT ALPHA
    2e-05   9%  2c0bL  [x.x.x] RIBONUCLEASE E
    6e-05  11%  2bx2L  [x.x.x] RIBONUCLEASE E
    1e-04  11%  2ba0A  [x.x.x] ARCHEAL EXOSOME RNA BINDING PROTEIN RRP4
    2e-04  20%  1dk2A  [a.60.6] DNA POLYMERASE BETA
:777

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxSIHQRIAEELGVRERQVRAAVELLDDGATVPFIARYRKEVTEMLDDAQLRAIXXXXXXXXXXXXXXT
3bzkA           ---SINTRIAEELSALPSGRVAAVALLDEGSTVPFIARYRKEVTGSLDDTQLRMLEERLRYLRELEERRG
3bzcA           ---SINTRIAEELSALPSGRVAAVALLDEGSTVPFIARYRKEVTGSLDDTQLRMLEERLRYLRELEERRG
3c6hA           ----------------------------------------------------------------------
3cltC           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------
1dgtB           ----------------------------------------------------------------------
3cluC           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2axtU           ----------------------------------------------------------------------
1c7yA           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2ao9E           ----------------------------------------------------------------------
2ao9B           ----------------------------------------------------------------------
3clrC           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
2a1jB           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
3bz1U           ----------------------------------------------------------------------
3cw2C           ----------------------------------------------------------------------
1bnoA           ----------------------------------------------------------------------
2ahoB           ----------------------------------------------------------------------
3c19A           ----------------------------------------------------------------------
2c35B           ----------------------------------------------------------------------
2duyA           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
3e0dA           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2ba0A           ----------------------------------------------------------------------
1dk2A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VILESIKAQGKLTPELEAAIMAADSKARLEDIYLPYKPKRRTKAQIAREAGLEPLADALLNDPSRDPHDQ
3bzkA           AILASIEEQGKLTPELARDIKLADTKTRLEDLYLPYKQKRRTKGQIALEAGLGALADALFDDPTLVPESE
3bzcA           AILASIEEQGKLTPELARDIKLADTKTRLEDLYLPYKQKRRTKGQIALEAGLGALADALFDDPTLVPESE
3c6hA           ----------------------------------------------------------------------
3cltC           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------
1dgtB           ----------------------------------------------------------------------
3cluC           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2axtU           ----------------------------------------------------------------------
1c7yA           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2ao9E           -MAKLDELKQKLTAK--------QIQAAYLLVENELMEEKRTQDEMANELGINRTTLWEWR-TKNQDFIA
2ao9B           -MAKLDELKQKLTAKQ---------IQAAYLLVEELMEEKRTQDEMANELGINRTTLWEW-RTKNQDFIA
3clrC           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
2a1jB           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
3bz1U           ----------------------------------------------------------------------
3cw2C           ----------------------------------------------------------------------
1bnoA           ----------------------------------------------------------------------
2ahoB           ----------------------------------------------------------------------
3c19A           ----------------------------------------------------------------------
2c35B           ----------------------------------------------------------------------
2duyA           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
3e0dA           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2ba0A           ----------------------------------------------------------------------
1dk2A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AAAYVDADKGVADTAAALEGARAILVERFTEDADLIGELRERMWQRGRLVSRVREGKEEVGVKFADYFDF
3bzkA           AARFVDAEKGFADVKAVLEGAKYILMERFAEDATLLDKLRVFMKNEATLTARVVPGKEQEGAKFSDYFEH
3bzcA           AARFVDAEKGFADVKAVLEGAKYILMERFAEDATLLDKLRVFMKNEATLTARVVPGKEQEGAKFSDYFEH
3c6hA           ----------------------------------------------------------------------
3cltC           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------
1dgtB           ----------------------------------------------------------------------
3cluC           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2axtU           ----------------------------------------------------------------------
1c7yA           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2ao9E           FKSEVADSFLAE----KREQVYSKLMQLILGPQPSVKAMQLYMQRFGLLTDKKVIEGD------------
2ao9B           FKSEVADS----FLAEKREQVYSKLMQLILGPQPSVKAMQLYMQRFGLLTDKKVIEGD------------
3clrC           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
2a1jB           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
3bz1U           ----------------------------------------------------------------------
3cw2C           ----------------------------------------------------------------------
1bnoA           ----------------------------------------------------------------------
2ahoB           ----------------------------------------------------------------------
3c19A           ----------------------------------------------------------------------
2c35B           ----------------------------------------------------------------------
2duyA           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
3e0dA           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2ba0A           ----------------------------------------------------------------------
1dk2A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AEAFTTLPSHRVLALFRGEKEEVLDLTLXXXXXXXXXXXXSSYEVRIAQHFGIADQGRPGDRWLLDTVRW
3bzkA           DEPLKSAPSHRALAIFRGRNEGVLSASLKVGAPGTLHP----CEVMIAERFGLSNQGRAADKWLAEVVRW
3bzcA           DEPLKSAPSHRALAIFRGRNEGVLSASL--KVGEEAPGTLHPCEVMIAERFGLSNQGRAADKWLAEVVRW
3c6hA           ----------------------------------------------------------------------
3cltC           ------------------------------------------------------------------TAAL
2eduA           ----------------------------------------------------------------------
1dgtB           ----------------------------------------------------------------------
3cluC           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2axtU           ----------------------------------------------------------------------
1c7yA           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2ao9E           ----------------------------------------------------------------------
2ao9B           ----------------------------------------------------------------------
3clrC           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
2a1jB           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
3bz1U           ----------------------------------------------------------------------
3cw2C           ----------------------------------------------------------------------
1bnoA           ----------------------------------------------------------------------
2ahoB           ----------------------------------------------------------------------
3c19A           ----------------------------------------------------------------------
2c35B           ----------------------------------------------------------------------
2duyA           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
3e0dA           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2ba0A           ----------------------------------------------------------------------
1dk2A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AWRTRILVRLDIDLRSRLWQEAEDEAVRVFAANLRDLLLAAPAGTRPTIGLDPGLRTGVKVAVVDGTGKV
3bzkA           TWKVKLYTHLETDLFGELRDGAEDEAISVFARNLHDLLLAAPAGPRATLGLDPGLRTGVKVAVVDATGKL
3bzcA           TWKVKLYTHLETDLFGELRDGAEDEAISVFARNLHDLLLAAPAGPRATLGLDPGLRTGVKVAVVDATGKL
3c6hA           ---------------------SRLSFIDVVNDNGFYQFEKPKEGRKYVATLDCSDYHA--LQIIDITEFP
3cltC           EEDFEIVDEDFMMYDLNEWDDSLEEAMKIKESSDTDVEVVVVSVGPDRV--DESLRKCLAKGA-DRAVRV
2eduA           ----------------------------------------------------------------------
1dgtB           ----------------------------------------------------------------------
3cluC           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2axtU           ----------------------------------------------------------------------
1c7yA           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2ao9E           ----------------------------------------------------------------------
2ao9B           ----------------------------------------------------------------------
3clrC           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
2a1jB           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
3bz1U           ----------------------------------------------------------------------
3cw2C           ----------------------------------------------------------------------
1bnoA           ----------------------------------------------------------------------
2ahoB           ----------------------------------------------------------------------
3c19A           ----------------------------------------------------------------------
2c35B           ----------------------------------------------------------------------
2duyA           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
3e0dA           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2ba0A           ----------------------------------------------------------------------
1dk2A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VDTATIYPHEPQKRWDESIAVLAALAQKHRVELVAIGNGTASRETDRLAADLIKRHPELKLTKVMXXXXX
3bzkA           LDTATVYPHAPKNQWDQTLAVLAALCAKHQVELIAIGNGTASRETDKLAGELIKKYPGMKLTKIMVSEAG
3bzcA           LDTATVYPHAPKNQWDQTLAVLAALCAKHQVELIAIGNGTASRETDKLAGELIKKYPGMKLTKIMVSEAG
3c6hA           YKQVAVYHSNTT-SHFILPDIVFKYLCPVYIELNSTGVSIAKSLAMDLEYDNIFIDLGMKQSKRSKAMGC
3cltC           WDDAA-----EGSDAIVVGRILTEVIKKEAPDMVFAGVQSSDQAYASTGISVASYPHAAVVADLQYKPGD
2eduA           ----------------------------------------------------------------------
1dgtB           ----------------------------------------------------------------------
3cluC           ----------EGSDAIVVGRILTEVIKKEAPDMVFAGVQSSDQAYASTGISVASYLHAAVVADLQYKPGD
2bgwB           ----PRVYVDVREERSPVPSILESLGVQVIPKQLPMGDYLVSDSIIVERKTSSDFA-------KSLFDGR
2axtU           ----------------------------------------------------------------------
1c7yA           ----------------------------------------------------------------------
2bhnA           -------------------SILESLGVQVIPKQLPMGDYLVSDSIIVERKTSSDFAKSLFDGFEQASRLA
2bgwA           ---------------------VPSILESLGVQVIPKQLPMGDYLVSDSIIVERKTSSD-----FAKSLFD
2ao9E           ----------------------------------------------------------------------
2ao9B           ----------------------------------------------------------------------
3clrC           -------------DAIVVGRILTEVIKKEAPDMVFAGVQSSDQAYASTGISVASYPHAAVVADLQYKPGD
3c1yA           ----------------------------------------------------------------------
2a1jB           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
3bz1U           ----------------------------------------------------------------------
3cw2C           ----------------------------------------------------------------------
1bnoA           ----------------------------------------------------------------------
2ahoB           ----------------------------------------------------------------------
3c19A           ----------------------------------------------------------------------
2c35B           ----------------------------------------------------------------------
2duyA           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
3e0dA           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2ba0A           ----------------------------------------------------------------------
1dk2A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           XXXXXXXXXXXQELPDLDVSLRGAVSIARRLQDPLAELVKIDPKSIGVGQYQHDVSEVKLSRSLDAVVED
3bzkA           ASVYSASELAAKEFPELDVSLRGAVSIARRLQDPLAELVKIEPKSIGVGQYQHDVSQLKLARSLDAVVED
3bzcA           ASVYSASELAAKEFPELDVSLRGAVSIARRLQDPLAELVKIEPKSIGVGQYQHDVSQLKLARSLDAVVED
3c6hA           SALKDLIEKDKLIINHKGTQELRTFSEKFHDDLVMSLV--------------------------------
3cltC           NKAVIRRELEGGMLQEVEINCPAVLTIQLGINKPTKPIEEVSLADIGLSANDVGAAQSMSRVRRMYIPET
2eduA           -----------------------------------------------SGEKAEDCWELQI---SPELLAH
1dgtB           ------------------VLVHKAGGVIPEVLRVLKERRTGKERPIRWPEACPECGHVKEGKVHRCPNPL
3cluC           NKAVIRRELEGGMLQEVEINCPAVLTIQLGINKPSKPIEEVSLADIGLSANDVGAAQSMSRVRRMYIPEK
2bgwB           LFEQASRLAEHYETVFIIVEGPPVPRRYRGRERSLYAAMAALQLDYGI-RLMNTMDPKGTALVIESLARL
2axtU           ----------------------------------------------------------------------
1c7yA           --------------------LIEVGGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLLYGFNNKQ
2bhnA           EHYETVFIIVEGPPVPRRYRGRERSLYAAMAALQLDYGIRMNTMDPKGTALVIESLARLSTREGGQRIVI
2bgwA           GRLFEQASRLAEHYETVFIIVEGPPVPRRSLYAAMAALQLDYGIRLMNTMDPKGTALVIESLARLSTREG
2ao9E           ----------------------------------------------------------------------
2ao9B           ----------------------------------------------------------------------
3clrC           NKAVIRRELEGGMLQEVEINCPAVLTIQLGINKPTKPIEEVSLADIGL-----SANDVGAAQSMSRVRR-
3c1yA           -----------------------------------------------------EPSPISISRVLGYDVQQ
2a1jB           --------------------------------------------------------------------DL
2bhnB           --------------ETVFIIVEGPPVPRRYRGRERSLYAAMAALQLDYGIRLMNTMDPKGTALVIESLAR
3bz1U           ----------------------------------------------------------------------
3cw2C           ----------------------------------------------------------------------
1bnoA           ----------------------------------------------------------------------
2ahoB           ----------------------------------------------------------------------
3c19A           ----------------------------------------------------------------------
2c35B           ----------------------------------------------------------------------
2duyA           ----------------------------------------------------------------------
1dgsA           --------------------------------TGKERPIRWPEACPECGHRLVK--EGKVHRCPNP---L
3e0dA           ------------------VERHDSDKVAEYIRDARALGIPVLPPDVNRSGFDFKVVGEEILFGLSAV---
2c0bL           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2ba0A           ----------------------------------------------------------------------
1dk2A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           CVNAVGVDVNTASVPLLSRVSGITASLAQNIVAYRDANGPFRTRAQLREVPRLGPKAFEQCAGFLRIPDG
3bzkA           CVNAVGVDVNTASAALLARISGLNSTLAQNIVAHRDANGAFRTRDELKKVSRLGEKTFEQAAGFLRVMNG
3bzcA           CVNAVGVDVNTASAALLARISGLNSTLAQNIVAHRDANGAFRTRDELKKVSRLGEKTFEQAAGFLRVMNG
3c6hA           ----------------------------------------------------------------------
3cltC           MIEGTISEQAAKIIQIINEFKG------------------------------------------------
2eduA           GRQKILDLLNEGSARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQMESFLKANILGLA
1dgtB           CPAKRFEAIRHYASRKAMDIEGLGEKLIERLLEKGLVRDVADRKEDLLGLERMGEKSAQNLLRQIKHRGL
3cluC           GRATMIEGTISEQAAKIIQI--------------------------------------------------
2bgwB           STKPRLSDVREWQLYILQSFPGIGRRTAERILERFGSLERFASKAEISKVEGIGEKRAEEIKKILMTP--
2axtU           ------IDLNNTNIAAFIQYRGLYPTLAKLIVKN----APYESVEDVLNIPGLTERQKQILRENLEHFTV
1c7yA           ---------ERTLFKELIKTNGVGPKLALAILSGMSAQQFVNEVGALVKLPGIGKKTAERLIVEMKDRFK
2bhnA           HKKPRLSDVREWQLYILQSFPGIGRRTAERILERFGSLERFFSKAEISKVEGIGEKRAEEIKKILMTP--
2bgwA           GQRIVIHDVREWQLYILQSFPGIGRRTAERILERFGSLERFFSKAEISKVEGIGEKRAEEIKKILMTP--
2ao9E           ----------------------------------------------------------------------
2ao9B           ----------------------------------------------------------------------
3clrC           --------MYIPEKGRATMIEGTISEQAAKIIQIINE---------------------------------
3c1yA           AAQLDDVLVSARGYRLLKTVARIPLSIGYNVVRMFKTLDQISSVEDLKKVEGIGEKRARAISESISSL--
2a1jB           LMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGEQLIAASREDLALCPGLGPQKARRLFDVLHEP--
2bhnB           LSTRRLSDVREWQLYILQSFPGIGRRTAERILERFGSLERFFSKAEISKVEGIGEKRAEEIKKILMTP--
3bz1U           ------IDLNNTNIAAFIQYRGLYPTLAKLIVKN----APYESVEDVLNIPGLTERQKQILRENLEHFTV
3cw2C           --------------------------------------DEYGGLQAFLPWSEVSSKWVKNIRDVIRVDRR
1bnoA           ------ETLNGGITDMLVELANFEKNVSQAIHKYNKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLA----
2ahoB           ----------------------------------------------------------------------
3c19A           ----------------------------------------------------------------------
2c35B           ----------------------------------------------------------------------
2duyA           ----TPVSLNEASLEELA-LPGIGPVLARRIVEGR----PYARVEDLLKVKGIGPATLERLRPYLR----
1dgsA           CPAKRFEAIRHYASRKAMDIEGLGEKLIERLLEKGLVRDVADRKEDLLGLERMGEKSAQNLLRQIEHRGL
3e0dA           --------------------KNVGEMAARAILEERERGGPFKSLGDFLKEQVVNKRALEKAGALDAFGDR
2c0bL           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2ba0A           ----------------------------------------------------------------------
1dk2A           ------ETLNGGITDMLVELANFEKNVSQAIHKYNKYPHKIKSGAEAKKLPGVGTKIAEKIDEFL-----


                         .         .         .         *         .         .         .:630
query           DDPLDSSSVHPEAYPVVRRILEATGRDIRALIGDTDTLRSLRPDDFVDERFGLPTVTDILAELEKPGRDP
3bzkA           DNPLDASAVHPETYPLVQRIAADTERDIRSLIGDSAFLKRLDPKKFTDETFGLPTVTDILKELDKPGRDP
3bzcA           DNPLDASAVHPETYPLVQRIAADTERDIRSLIGDSAFLKRLDPKKFTDETFGLPTVTDILKELDKPGRDP
3c6hA           ----------------------------------------------------------------------
3cltC           ----------------------------------------------------------------------
2eduA           AG--------------------------------------------------------------------
1dgtB           ERLLYALGLPGVGEVLARNLARRFG---------------------------------------------
3cluC           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2axtU           TEVETALVEGGDRY--------------------------------------------------------
1c7yA           GLHGDLFTPAADLVLTS-----------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2ao9E           ----------------------------------------------------------------------
2ao9B           ----------------------------------------------------------------------
3clrC           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
2a1jB           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
3bz1U           TEVETALVEGGDRY--------------------------------------------------------
3cw2C           KGTVDVSLKKVTDDERRKKNLQWKKIQRLDKILELVSQKLKLSEKDAWEQVAWKLEAKYGDPITAIEKAV
1bnoA           ----------------------------------------------------------------------
2ahoB           ---VDVSLKKVTDDERRKKNLQWKKIQRLDKILELVSQKLKLSEKDAWEQVAWKLEAKYGDPITAIEKAV
3c19A           -------DYEPSHLMFLVTVLDDRDGEVLGDAIQKLIEREEVLACHATKKNRPGHVLVVLVDGGEDPDRV
2c35B           ISLEHEILLHPRYFGPNLLNTV------------KQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPG
2duyA           ----------------------------------------------------------------------
1dgsA           ERLLYALGLPGVGEVLARNLARRFG-TMDRLLASLEELIEVETARAILETLKDPAFRDLVRRLKEAGVSM
3e0dA           ARLLAS---LEPLLRWAAETRERGRSGLVGLFAEVEEPPLVEASPLDEI---------------------
2c0bL           ------------------------------------------------------HMKRMLINATQQEELR
2bx2L           ------------------------------------------------------HMKRMLINATQQEELR
2ba0A           -----------------------------------------------------YGTYVEGGKVYAKIIGL
1dk2A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           RPEFQTAAFRDGVEDITDLEPGMVLEGVVTNXXXXXXXXXXXXXXXXXXXXSAMSKSFVKDPRDVVKPGD
3bzkA           RPEFKTAEFQEGVESLKDLKPGMVLEGVVTNVTNFGAFVDIGVHQDGLVHISALSEKFVKDPYEVVKAGD
3bzcA           RPEFKTAEFQEGVESLKDLKPGMVLEGVVTNVTNFGAFVDIGVHQDGLVHISALSEKFVKDPYEVVKAGD
3c6hA           ----------------------------------------------------------------------
3cltC           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------
1dgtB           ----------------------------------------------------------------------
3cluC           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2axtU           ----------------------------------------------------------------------
1c7yA           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2ao9E           ----------------------------------------------------------------------
2ao9B           ----------------------------------------------------------------------
3clrC           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
2a1jB           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
3bz1U           ----------------------------------------------------------------------
3cw2C           KEGEKILIDAGVPEIWVEEASKHAEERKVKMSGLITVRTNEPLGVEKI---KEVISKALENIEQDYESLL
1bnoA           ----------------------------------------------------------------------
2ahoB           KEGEKILIDAGVPEIWVKPLLEEASKHEERKVKMSGLITVRTNEPLGVEKIKEVISKALENIEQDYESLL
3c19A           AEDVARDIMVLTGSEDVRVVYGEREWRVSVKETEEGEVVTVKAEFDECREIGEETGIPPREVKAAARVGG
2c35B           RGFVLYPVKYK--AIVFRPFKGEVVDAVVTQ-VNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYK
2duyA           ----------------------------------------------------------------------
1dgsA           ESK-------------------------------------------------------------------
3e0dA           ----------------------------------------------------------------------
2c0bL           VALVDGQRLYDLDIESPEQKKANIYKGKITR---------------------------------------
2bx2L           VALVDGQRLYDLIESPGEQKKANIYKGKITR---------------------------------------
2ba0A           FDQTETHVRVIPLKGRYTPSVGDVVIGIIREVAANGWAVDIYSPYQAFLPVSENPEMPNKKPNEVLDIGD
1dk2A           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           IXXXXXXXXXXXXXXISLTLRLDDExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bzkA           IVKVKVMEVDIPRNRVGLSMRMSDT---------------------------------------------
3bzcA           IVKVKVMEVDIPRNRVGLSMRMSDT---------------------------------------------
3c6hA           ----------------------------------------------------------------------
3cltC           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------
1dgtB           ----------------------------------------------------------------------
3cluC           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2axtU           ----------------------------------------------------------------------
1c7yA           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2ao9E           ----------------------------------------------------------------------
2ao9B           ----------------------------------------------------------------------
3clrC           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
2a1jB           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
3bz1U           ----------------------------------------------------------------------
3cw2C           NIKIYTIGAPRYRVDVVGTNPKEAS---------------------------------------------
1bnoA           ----------------------------------------------------------------------
2ahoB           ----------------------------------------------------------------------
3c19A           W---------------------------------------------------------------------
2c35B           ----------------------------------------------------------------------
2duyA           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
3e0dA           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2ba0A           A---------------------------------------------------------------------
1dk2A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxx
3bzkA           -------
3bzcA           -------
3c6hA           -------
3cltC           -------
2eduA           -------
1dgtB           -------
3cluC           -------
2bgwB           -------
2axtU           -------
1c7yA           -------
2bhnA           -------
2bgwA           -------
2ao9E           -------
2ao9B           -------
3clrC           -------
3c1yA           -------
2a1jB           -------
2bhnB           -------
3bz1U           -------
3cw2C           -------
1bnoA           -------
2ahoB           -------
3c19A           -------
2c35B           -------
2duyA           -------
1dgsA           -------
3e0dA           -------
2c0bL           -------
2bx2L           -------
2ba0A           -------
1dk2A           -------