[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ54145.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3d03B.bssp"
#ERROR : Can't open dsspfile "3c9fA.bssp"
#ERROR : Can't open dsspfile "2cv9A.bssp"
#ERROR : Can't open dsspfile "3c9fB.bssp"
#ERROR : Can't open dsspfile "2dxnA.bssp"
#ERROR : Can't open dsspfile "2bcdA.bssp"
#ERROR : Can't open dsspfile "3d03A.bssp"
#ERROR : Can't open dsspfile "2bq8X.bssp"
#ERROR : Can't open dsspfile "3e7bA.bssp"
#ERROR : Can't open dsspfile "3e0jA.bssp"
#ERROR : Can't open dsspfile "3e0jE.bssp"
#ERROR : Can't open dsspfile "3dsdA.bssp"
#ERROR : Can't open dsspfile "3c8gD.bssp"
#ERROR : Can't open dsspfile "3ejxD.bssp"
#ERROR : Can't open dsspfile "3e0jC.bssp"

## Summary of PDB Search
:306
    6e-12  12%  3d03B  [x.x.x] PHOSPHOHYDROLASE
    2e-11  12%  3c9fA  [x.x.x] 5'-NUCLEOTIDASE
    5e-11  11%  2cv9A  [x.x.x] HYPOTHETICAL PROTEIN TTHA0625
    6e-10  13%  3c9fB  [x.x.x] 5'-NUCLEOTIDASE
    9e-10  12%  2dxnA  [x.x.x] PHOSPHOHYDROLASE
    9e-09   9%  2bcdA  [x.x.x] SERINE/THREONINE PROTEIN PHOSPHATASE PP1-GAMMA
    1e-08  13%  3d03A  [x.x.x] PHOSPHOHYDROLASE
    1e-07  14%  2bq8X  [x.x.x] TARTRATE-RESISTANT ACID PHOSPHATASE TYPE 5
    9e-07   9%  3e7bA  [x.x.x] SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-ALPHA
    7e-06  11%  3e0jA  [x.x.x] DNA POLYMERASE SUBUNIT DELTA-2
    7e-06  12%  3e0jE  [x.x.x] DNA POLYMERASE SUBUNIT DELTA-2
    2e-05  14%  3dsdA  [x.x.x] DNA DOUBLE-STRAND BREAK REPAIR PROTEIN MRE11
    4e-05   7%  3c8gD  [x.x.x] PUTATIVE TRANSCRIPTIONAL REGULATOR
    2e-04  14%  3ejxD  [x.x.x] DIAMINOPIMELATE EPIMERASE, CHLOROPLASTIC
    4e-04  11%  3e0jC  [x.x.x] DNA POLYMERASE SUBUNIT DELTA-2
:306

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRLRHYEIPILAPGSDRLRILHLSDAHLTPGRR
3d03B           ------------------------------------------------------MLLAHISDTHFRSKLY
3c9fA           --------------------------------------------FPHRNLTWNDINFVHTTDTHGWYSIS
2cv9A           -------------------------------------------------------RVLFIGDVAE-PGLR
3c9fB           --------------------------------------------FPHRNLTWNDINFVHTTDTHGWYFIS
2dxnA           ------------------------------------------------------MLLAHISDTHFRSKLY
2bcdA           -----------------------------------------------------EAPLKICGDIHGQYYD-
3d03A           ------------------------------------------------------MLLAHISDTHFGEKLY
2bq8X           ---------------------------------------------------TPALRFVAVGDWGGVPEMA
3e7bA           -----------------------------------------------------EAPLKICGDIHG--QYY
3e0jA           ---------------------------------------------------------LLVDVVTGQ----
3e0jE           -----------------------------------------------------------VDVVT-----G
3dsdA           ------------------------------------------------------MKFAHLADIHLGYFAE
3c8gD           -------------------------------------------------------EDDVLEQLDAQDNLF
3ejxD           --------------------------------------ILKAQDVPTKLSGNKGEAVVEAELVVD--GVS
3e0jC           -----------------------------------------------------------VDVVTGQ----


                         .         .         *         .         .         .         .:140
query           LLIDWIRSLDAHNPDLVVNTGDSLAHPQAVKPFLDALGPLLDRPGLFVYGSNDLFSPQPKNPARYLWRSS
3d03B           GFIDVNAANADERPDAVVVSGD-IVNCGRPEEYQVARQILGSLNYPLYLIPGNHDDKALFLEYLQPLCPQ
3c9fA           FTTHMRRIAHSRNQDLLIDSGDSDITSPNGLKSTPIFIKQDYDLLTIGNHELYLWENSKQEYETVVNHFQ
2cv9A           AVGLHLPDIRDRYDLVIANGENAARGKGLDRRSYRLLREAGVD---LVSLGNHAWDHKEVYALLESEPVV
3c9fB           FTTHMRRIAHSRNQLLLIDSGDNGLSDITSPNGLKSTPIFIKQDYDLLTIGNHELYLWENSKQEYETVVN
2dxnA           GFIDVNAANADERPDAVVVSGD-IVNCGRPEEYQVARQILGSLNYPLYLIPGNHDDKALFLEYLQPLCPQ
2bcdA           -LLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDEC
3d03A           GFIDVNAANADERPDAVVVSGD-IVNCGRPEEYQVARQILGSLNYPLYLIPGNHDDKALFLEYLQPLCPQ
2bq8X           NAKEIARTVQILGADFILSLGDDINDKRFQETFEDVFSDRSLRKVVSAQIAYSKISKRWNFPSPFYRLHF
3e7bA           DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDEC
3e0jA           -LGDEGEQCSAAHVSRVILAGNLLSHLT--KKTQAASVEAVKMLDEI------LLQLSASVPVDVMPGEF
3e0jE           QLGDEGEQCSAAHVSRVILAGN----------LLSHLTKKTQAASVEAVKMLDEILLQLSASVPVDVMPE
3dsdA           AFKNALEIAVQENVDFILIAGDSRPSPGTLKKAIALLQIPKEHSIFAIEGNSDRTQRGPSVLNLLEDFGL
3c8gD           AHSILLQGIRQFLPSLFVDNDEEIVEAVPLLAQSGPLDDIDALRLIYALGDKWLYA----DITHFSQYWH
3ejxD           WNVTCV---SMGNPHCITFGKKGGPNLKVDDLNLPEIGPKFEHHEMFPARTN------------------
3e0jC           -LGDEGEQCSAAHVSRVILAGN----------LLSHLTKKTQAASVEAVKMLDEILLQLSASVPVDVMPG


                         +         .         .         .         .         *         .:210
query           KADYRKRKIPDLPWRELGAAMREAGWLDLNNQKGHLTAGNLRIAAAGIHDSHIGLDRYEKIAGPADPTAD
3d03B           LGSDAN--NMRCAVDDFATRLLFIDSSRAGTSKGWLTDETISWLEAQLFEGGDKPATFMHHPPLPLGNAQ
3c9fA           DKYVCSNVDIRLDNGLFVPLGLKYKYFTTPIRGIRVMAFGFLFDFKRFNSGTRVTPMAETFQEALKHEVD
2cv9A           RPLNYPPGTPGKGFWRLEVGGESLLFVQVGRIFDPLDDP---------------FRALDRLLEEEKADYV
3c9fB           HFQDCSNVDIRLDNGLFVPLGLKYKYFTTPIRGIRVMAFGFLFDFKRFNSGTRVTPMAETIQEALKHEVD
2dxnA           LGSDANNM--RCAVDDFATRLLFIDSSRAGTSKGWLTDETISWLEAQLFEGGDKPATFMHHPPLPLGNAQ
2bcdA           KRRYNIKL-----WKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRCDLLWSDPDKDVLGWGEN
3d03A           LGSDANNMRCAVDDFATRLLF--IDSSRAGTSKGWLTDETIWLEAQLFEGGDKPATIFMHHPPLPLGNAQ
2bq8X           KIPQTNVSVAIFMLDTVTLCGNSDDFLSQQPERPRDVKLARTQLSWLKKQLAAAREDYVLVAGHYPVWSI
3e7bA           KRRYNIK-----LWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQITDVPDQGLLCDLLWSDPDK
3e0jA           DPTNYTLPQQPL-HPCMFPLATAYSTLQLVTNPYQATIDGVRFLGTSGQNVSDIFRYSSMEDHLEILEWT
3e0jE           FDPTNYTLPQQPLHPCMFPLATAYSTLQLVTNPYQATIDGVRFGTSGQNVSDIFRYSSMEDHLEILEWTL
3dsdA           VYVIGMRKEKVLTSERLGNGEYLVKGVYKDLEIHGMKYMSSAWFEANKEILKRLFRPTDNAILMLHQGVR
3c8gD           YLNEQDETPGFADDITWDFISNVNSITRNATLYDALAFAEARFSG-------------------------
3ejxD           ----------------------------------------------------------------------
3e0jC           EFDPTNYTLPQQPL------HPCMFPLATAYSTLQLVTNPYQATIDGVRFLGTSGQNVSDIFRYSSMEDH


                         .         .         .         +         .         .         .:280
query           VRIGVMHSPEPRNLDRFTADGYELLLAGHTHGGQICLPFYGTLVTNCGIDRARAWGLSRNGTSWLHVSGG
3d03B           MDPIACENGHRLLALVERFPSLTRIFCGHNHSLTMTQYRQALISTLPGTVHQVPYCLSPASCLMHRQVGE
3c9fA           LIIIVGHTPVHQYLRQFFPDTIIQYFGGHSHIRDFTVFDSLSTGLQS-----------------------
2cv9A           LVEVHAEATSEKALAHYLDGRASAVLGTHTHVPTLDATRLGTLYQTDVGTYHSIIGGEVETFLARFLTGR
3c9fB           LIIIVGHTPVHQYLRQFFPDTIIQYFGGHSHIRDFTVFDSLSTGLQSG----------------------
2dxnA           MDPIACENGHRLLALVERFPSLTRIFCGHNHSLTMTQYRQALISTLPGT--VHQVPYCHEDTDPYYDLSP
2bcdA           DRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLF----------------------
3d03A           MDPIACENGHRLLALVERFPSLTRIFCGHNHSLTMTQYRQALISTLPGDLSPASCLMHRQVSYQHSLAHY
2bq8X           AEHGPTHCLVKQLRPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGDPSKRHQRKVPNGYLRFHYGTE
3e7bA           DVQGWGENDAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLF----------------------
3e0jA           LRVRPTAPDTYKTDPFIFPECPHVYFCGNTPSFGSKIIRGPEDQT-------------------------
3e0jE           VRHISPTAPDTKTDPFIFPECPHVYFCGNTPSFGS-KIIRGPEDQTVL----------------------
3dsdA           EVSEARGEDYFEIGLGDLPEGYLYYALGHIHKRYETSYSGSPVV-YPGSLERWDFGDYEVRYEWDGIKFK
3c8gD           ----------------------------------------------------------------------
3ejxD           ----------------------------------------------------------------------
3e0jC           LEIISPTAPDTKTDPFIFPECPHVYFCGNTPSFGS-KIIRGPEDQTVLLVTVPDFS-ATQTACLVNLRSL


                         .         *         .         .         .         .         +:350
query           LGTSPYAPVRFCCRPEAALLDLIPRx
3d03B           QWVSYQHSLAHYAGPWLYDENISCP-
3c9fA           --------------------------
2cv9A           PQPFRAAQGKA---------------
3c9fB           --------------------------
2dxnA           AS------------------------
2bcdA           --------------------------
3d03A           AGPWLY-DENISCPTEE---------
2bq8X           DSLGGFAYVEI---------------
3e7bA           --------------------------
3e0jA           --------------------------
3e0jE           --------------------------
3dsdA           ERYG----------------------
3c8gD           --------------------------
3ejxD           --------------------------
3e0jC           --------------------------