[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ54436.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cjpA.bssp"
#ERROR : Can't open dsspfile "3e2vB.bssp"
#ERROR : Can't open dsspfile "3bq6B.bssp"
#ERROR : Can't open dsspfile "1bf6A.bssp"
#ERROR : Can't open dsspfile "3bq5A.bssp"
#ERROR : Can't open dsspfile "3bq6A.bssp"
#ERROR : Can't open dsspfile "3bq5B.bssp"
#ERROR : Can't open dsspfile "3e2vA.bssp"
#ERROR : Can't open dsspfile "1dpmA.bssp"
#ERROR : Can't open dsspfile "2dvtC.bssp"
#ERROR : Can't open dsspfile "2dvtA.bssp"
#ERROR : Can't open dsspfile "3e3hA.bssp"
#ERROR : Can't open dsspfile "2dvtB.bssp"
#ERROR : Can't open dsspfile "2dvuC.bssp"
#ERROR : Can't open dsspfile "3c86A.bssp"
#ERROR : Can't open dsspfile "2a3lA.bssp"
#ERROR : Can't open dsspfile "2d2gA.bssp"
#ERROR : Can't open dsspfile "2eg6B.bssp"
#ERROR : Can't open dsspfile "1a4mA.bssp"
#ERROR : Can't open dsspfile "2dvtD.bssp"

## Summary of PDB Search
:306
    5e-18  10%  3cjpA  [x.x.x] PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY
    2e-16  17%  3e2vB  [x.x.x] 3'-5'-EXONUCLEASE
    2e-15   8%  3bq6B  [x.x.x] 5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE-
    2e-13  14%  1bf6A  [c.1.9] PHOSPHOTRIESTERASE HOMOLOGY PROTEIN
    1e-11   9%  3bq5A  [x.x.x] 5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE-
    2e-11   9%  3bq6A  [x.x.x] 5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE-
    6e-11   8%  3bq5B  [x.x.x] 5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE-
    2e-10  17%  3e2vA  [x.x.x] 3'-5'-EXONUCLEASE
    2e-09  17%  1dpmA  [c.1.9] PHOSPHOTRIESTERASE
    2e-08  12%  2dvtC  [x.x.x] THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE
    1e-07  12%  2dvtA  [x.x.x] THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE
    3e-07  14%  3e3hA  [x.x.x] PARATHION HYDROLASE
    1e-06  12%  2dvtB  [x.x.x] THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE
    1e-06  12%  2dvuC  [x.x.x] THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE
    6e-06  15%  3c86A  [x.x.x] PHOSPHOTRIESTERASE
    9e-06   8%  2a3lA  [x.x.x] AMP DEAMINASE
    1e-05  14%  2d2gA  [x.x.x] PHOSPHOTRIESTERASE
    4e-05  11%  2eg6B  [x.x.x] DIHYDROOROTASE
    1e-04  10%  1a4mA  [c.1.9] ADENOSINE DEAMINASE
    1e-04  10%  2dvtD  [x.x.x] THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE
:306

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDCHTHMDMQGGDVAEIVAKAASVGVTPIIQVGCDVAG
3cjpA           --------------------------------------------VKKEMKKLNDVVNGKTNSMIDVRRNS
3e2vB           ---------------------------------DIGLNLTDHPADYVKLLERAAQRHVKNALVTGSSIAE
3bq6B           ----------------------------------YHYLVPEIETEEFYLLENKPLEDYLFFKSKGIETAP
1bf6A           ---------------------------------HEHLHIDLSGFFICQEMNDLMTRGVRNVIEMTNRYMG
3bq5A           ---------------------------------NTNYHYLVLENKPLEDYLFFKSKGIETAPWVI----G
3bq6A           --------------------------------------------KPLEDYLFFKSKGIETAPWVI----G
3bq5B           --------------------------------------------KPLEDYLFFKSKGIETAPWVIGPFTF
3e2vA           ---------------------------------DIGLNLTDPMFDYVKLLERAAQRHVKNALVTGSSIAE
1dpmA           ----------------------------------------------------------------------
2dvtC           ----------------------------------------------------------------------
2dvtA           ----------------------------------------------------------------------
3e3hA           ----------------------------------------------------------------------
2dvtB           ----------------------------------------------------------------------
2dvuC           ----------------------------------------------------------------------
3c86A           ----------------------------------------------------------------------
2a3lA           ----------------------------------------------------------------------
2d2gA           ----------------------------------------------------------------------
2eg6B           ---------------------------------DWHLHLRD--GDMLKTVVPYTSEIYGPVTTVEAAVAY
1a4mA           ----------------------------------------------------------------------
2dvtD           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SRWAVQAAAEHDTVWAAVALHPNEAPRIVHGVPEDEATXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVCA
3cjpA           IKELTNVIQAYPSRYVGFGNVPVGLS--------ENDTNSYIEENIVNN-----------------KLVG
3e2vB           SQSAIELVSSPLKLYHTIGVHPCCVNEFAEAYNESYAKVISNPSFAQGKLKELYDLMNQQAKPHDTSFRS
3bq6B           WVIGPFTFLYNGEWIRRPNQMEKLLESLVSVYKEVFEKLVENGC----------------------KEIL
1bf6A           RNAQFVMRETGINVVACTGYYQDAFFPEHVATRSVQELAQEMVDEIEQGIDGTEL-----------KAGI
3bq5A           PFTFLYLSKRNGEWIRRPNQMEKLLESLVSVYKEVFEKLVENGC----------------------KEIL
3bq6A           PFTFLYLSKRNGEWIRRPNQMEKLLESLVSVYKEVFEKLVENGC----------------------KEIL
3bq5B           LYLSK-RNGEWIRRPNQMEKLLESLVSVYKEVFEKLV-------------------------ENGCKEIL
3e2vA           SQSAIELVSSVLKLYHTIGVHPCCVNEFAEAYNESYAKVISNPSFAQGKLKELYDLMNQQAKPHDTSFRS
1dpmA           ------------------------------------------------------------------IQYG
2dvtC           ------------------------------------------------------------------GFVG
2dvtA           ------------------------------------------------------------------GFVG
3e3hA           ------------------------------------------------------------------IQYG
2dvtB           ------------------------------------------------------------------GFVG
2dvuC           ------------------------------------------------------------------GFVG
3c86A           ------------------------------------------------------------------IQHG
2a3lA           ----------------------------------------------------------------------
2d2gA           ----------------------------------------------------------------------
2eg6B           RQRILDAVPAGHDFTPLMTCYLTDSLDPNELERGFNEGVFTAALYPANHGVTSVDAIMPVLERMEKIGMP
1a4mA           ----------------------------------------------------------------------
2dvtD           ------------------------------------------------------------------GFVG


                         +         .         .         .         .         *         .:210
query           IGETGLDCYRTGPEGFDIQERSFRAHIAIAQRHGKALMIHDRDAHEDVLRVLEDAGAPERVVFHCFSGDA
3cjpA           IGELTPASGQ--------IKSLKPIFKYSMDSGSLPIWIHAFNPLVLQDELCKAFPKVPVILGHMGGSNW
3e2vB           IGEIGLDYDRFHYSSKEMQKVFFEEQLLNDKLSSYPLFLHMRSACDDFVQILERFVPDRKLVVHSFTGSA
3bq6B           VNEPAFVCDLE-----KAHWDLILNVYRELS--EFPLTVFTYYDSVSDYEACVSLPVKRHFDFVSNEENL
1bf6A           IAEIGTSEGKITPL----EEKVFIAAALAHNQTGRPISTHTSFSTMGLLQAHGVDLSRVTVGHCDLKDNL
3bq5A           VNEPAFVCDLEK----AHWDLILNVYRELS---EFPLTVFTYYDSVSDYEACVSLPVRLHFDFVSNEENL
3bq6A           VNEPAFVCDL--EKAHWDLILNVYRELS-----EFPLTVFTYYDSVSDYEACVSLPVKRLFDFVSNEENL
3bq5B           VNEPAFVCDLE-----KAHWDLILNVYRELSEFP--LTVFTYYDSVSDYEACVSLPVLHFDFVSNEENLK
3e2vA           IGEIGLDYDRFHYSSKEMQKVFFEEQCLNDKLSSYPLFLHMRSACDDFVQILERFVVDRKLVVHSFTGSA
1dpmA           IEDTGIRAGITTGKATPFQELVLKAAARASLATGVPVTTHTQRDGEQQAAIFESEGLSPSCIGHSDDTDD
2dvtC           ALVNGFSQEGDGQTPLYYDLPQYRPFWGEVEKLDVPFYLHPRNPLPQDSRIYDGHPWLLGILGHMGEGLP
2dvtA           ALVNGFSQEGDGQTPLYYDLPQYRPFWGEVEKLDVPFYLHPRNPLPQDSRIYDGHPWLLGILGHMGEGLP
3e3hA           IEDTGIRAGIIVATTGKAQELVLKAAARASLATGVPVTTHTAAQQAAIFESEGLSPSRVCIGHSDDTDDL
2dvtB           ALVNGFSQEGDGQTPLYYDLPQYRPFWGEVEKLDVPFYLHPRNPLPQDSRIYDGHPWLLGILGHMGEGLP
2dvuC           ALVNGFSQEGDGQTPLYYDLPQYRPFWGEVEKLDVPFYLHPRNPLPQDSRIYDGHPWLNIILGHMGEGLP
3c86A           IEDTGIRAGIIVATTGKAQELVLKAAARASLATGVPVTTHTSASQRDGEQQAAIFPSRVCIGHSDDTDDL
2a3lA           --------------------------RESKGMTTITLRPHSGEAGD--IDHLAATFLHSIAHGINLRKSP
2d2gA           ------IKVATTGKATPFQELVLKAAARASLATGVPVTTHTSASQRDGEQQAAISPSRVCIGHSDDTDDL
2eg6B           LLVHGEVTHADIDIFDREARFIESVMEPLRQRLTALKVVFEHITTKDAADYVRDGNERTITPQHLMFNRN
1a4mA           ----------------------HVEAYEGAVKNGIHRTVHEVGSPEVVREAVDILKTERVGHGYHTIEDE
2dvtD           ALVNGFSQEGDGQTPLYYDLPQYRPFWGEVEKLDVPFYLHPRNPLPQDSRIYDGHPWLLGPTWAFAQETA


                         .         .         .         +         .         .         .:280
query           AMAKLCADRGYYMSFAGNVTFGSAQQLRDXXXXXXXXXXXXXTDAPFLTPKPHRGRPNAPYLIPHTLRAL
3cjpA           MTAVELAKEIQNLYLDTSAYF--STFVLKIVINELPLKCIFGTDMPFGDL-------------QLSIEAI
3e2vB           IDLQKLLNLSPNIFIGVNGCSLRTEENLAVVKQIPTERLLLETDAPWCEIKRTHASFNEPCNMEQVAIVV
3bq6B           KNLEKHGFPEDKKLVAGVINGRQPWKRKVASLVEKLGASAISNSCPLFLPVTLELENNLP----------
1bf6A           DNILKMIDLGAYVQFDTIGKNSYIAMLHALRDRGLLNRVMLSMDITRRSHLKANGGYGYDYLLTTFIPQL
3bq5A           KNLEKHGFPEDKKLVAGVINGRQPWKVKVASLVEKLGASAISNSCPLFLPVTLELENNLP----------
3bq6A           KNLEKHGFPEDKKLVAGVINGRQPWKVKVASLVEKLGASAISNSCPLFLPVTLELENNLP----------
3bq5B           NLEKHGFPEDKKL-VAGVINGRQPWKVKVASLVEKLGASAISNSCPLF-HLPVTLELE------------
3e2vA           IDLQKLLNLSPNIFIGVNGCSLRTEENLAVVKQIPTERLLLETDAPWCEIKRTHASFNEPCNMEQVAIVV
1dpmA           LYLTALAARGYLIGLDHIPHSAIALLIKALIDQGYMKQILVSNDWLFGFSSYVVMDRVNPDGMAFRVIPF
2dvtC           YMMWRIDHRNAWVKLPPRYPAKRRFMDYFNENFHITTSGNFRTQTLIDAILEIGADTDWPFENIDHASDW
2dvtA           YMMWRIDHRNAWVKLPPRYPAKRRFMDYFNENFHITTSGNFRTQTLIDAILEIGADTDWPFENIDHASDW
3e3hA           SYLTALAARGYLIGLDRIPFSAIALLIKALIDQGYMKQILVSNDWLFGFSSMDVMDRVNPDGMAFIPLRV
2dvtB           YMMWRIDHRNAWVKLPPRYPAKRRFMDYFNENFHITTSGNFRTQTLIDAILEIGADTDWPFENIDHASDW
2dvuC           YMMWRIDHRNAWVKLPPRYPAKRRFMDYFNENFHITTSGNFRTQTLIDAILEIGADTDWPFENIDHASDW
3c86A           SYLTGLAARGYLVGLDRMPYSAIGLLIKALIDRGYKDRILVSHDWLFGFSSYVRINPDGMAFVPLRVIPF
2a3lA           VLQYLYYLAQIGLAMSPLSNNSLFLDYHRNPFPVFFLRGLNVS----LSTDDPLQIHLTKEPLVEEYSIA
2d2gA           SYLTGLAARGYLVGLDRMPYSTRALLIKALIDRGYKDRILVSHDWLYVTNIMDVMDRINPDGMAFVPIPF
2eg6B           HMLVG-GVRPHLYCLPILKRNIHQQALRELVASGFNRVFLGTDSAPHARHRKESSCGCAGCFNAPTALGS
1a4mA           ALYNRLLKENMHFEVCPWSSYLTGAWDPK-----TTHAVVRFKNDKANYSLNTDDPLIFKSTLDTDYQMT
2dvtD           VHALRLMASGLFDEHPR-----------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AELKGMAEDELAETVAANARRAFALP
3cjpA           KKM-SNDSYVANAVLGDNISRLLNI-
3e2vB           SEVKDVDLATLIDTTWKTTCKIF---
3bq6B           --------------------------
1bf6A           RQ-SGFSQADVDVMLRENPSQFF---
3bq5A           --------------------------
3bq6A           --------------------------
3bq5B           --------------------------
3e2vA           SEVKDVDLATLIDTTWKTTCKIFG--
1dpmA           LREKGVPQETLAGITVTNPARFLSP-
2dvtC           FNATSIAEADRVKIGRTNARRLFKLD
2dvtA           FNATSIAEADRVKIGRTNARRLFKL-
3e3hA           IPFKGVPQETLAGITVTNPARFLSPT
2dvtB           FNATSIAEADRVKIGRTNARRLFKL-
2dvuC           FNATSIAEADRVKIGRTNARRLFKLD
3c86A           LREKGVPPETLAGVTVANPARFLSP-
2a3lA           ASVWKLSACDLCE-IARNSVYQSGFS
2d2gA           LREKGVPPETLAGVTVANPARFLSP-
2eg6B           YAEEMNALQHFEAFCSVNGPQFYGLP
1a4mA           KKDMGFTEEEF-KRLNINAAKSSFLP
2dvtD           --------------------------