[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ54441.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3ceqB.bssp"
#ERROR : Can't open dsspfile "3edtB.bssp"
#ERROR : Can't open dsspfile "3ceqA.bssp"
#ERROR : Can't open dsspfile "3edtD.bssp"
#ERROR : Can't open dsspfile "3edtH.bssp"
#ERROR : Can't open dsspfile "1ddbA.bssp"
#ERROR : Can't open dsspfile "2a5yC.bssp"
#ERROR : Can't open dsspfile "2a5yB.bssp"
#ERROR : Can't open dsspfile "2btpA.bssp"
#ERROR : Can't open dsspfile "3e6yB.bssp"
#ERROR : Can't open dsspfile "3c3oA.bssp"
#ERROR : Can't open dsspfile "2c63A.bssp"
#ERROR : Can't open dsspfile "2bq0B.bssp"
#ERROR : Can't open dsspfile "2b05E.bssp"
#ERROR : Can't open dsspfile "2c1nA.bssp"
#ERROR : Can't open dsspfile "1a38A.bssp"
#ERROR : Can't open dsspfile "3cvlA.bssp"
#ERROR : Can't open dsspfile "3ck7D.bssp"
#ERROR : Can't open dsspfile "2btpB.bssp"
#ERROR : Can't open dsspfile "3dsuA.bssp"
#ERROR : Can't open dsspfile "2c23A.bssp"
#ERROR : Can't open dsspfile "2b05A.bssp"
#ERROR : Can't open dsspfile "3efzD.bssp"
#ERROR : Can't open dsspfile "3e6yA.bssp"
#ERROR : Can't open dsspfile "3dsvA.bssp"
#ERROR : Can't open dsspfile "3draA.bssp"
#ERROR : Can't open dsspfile "3ckbB.bssp"
#ERROR : Can't open dsspfile "3e33A.bssp"
#ERROR : Can't open dsspfile "3cvnA.bssp"
#ERROR : Can't open dsspfile "2cfuA.bssp"
#ERROR : Can't open dsspfile "2axvA.bssp"
#ERROR : Can't open dsspfile "2bedA.bssp"
#ERROR : Can't open dsspfile "2bq0A.bssp"
#ERROR : Can't open dsspfile "2c08A.bssp"
#ERROR : Can't open dsspfile "3cv0A.bssp"
#ERROR : Can't open dsspfile "2axzB.bssp"
#ERROR : Can't open dsspfile "2axuE.bssp"
#ERROR : Can't open dsspfile "2aw6B.bssp"
#ERROR : Can't open dsspfile "2cfzA.bssp"
#ERROR : Can't open dsspfile "2c74B.bssp"
#ERROR : Can't open dsspfile "2cg3A.bssp"
#ERROR : Can't open dsspfile "3dswA.bssp"
#ERROR : Can't open dsspfile "2c0mA.bssp"
#ERROR : Can't open dsspfile "2axuL.bssp"
#ERROR : Can't open dsspfile "2axuB.bssp"
#ERROR : Can't open dsspfile "2c0mC.bssp"
#ERROR : Can't open dsspfile "2c74A.bssp"
#ERROR : Can't open dsspfile "3dsxA.bssp"
#ERROR : Can't open dsspfile "2c1nA.bssp"
#ERROR : Can't open dsspfile "2c74B.bssp"

## Summary of PDB Search
:1523
    5e-23  18%  3ceqB  [x.x.x] KINESIN LIGHT CHAIN 2
    6e-21  18%  3edtB  [x.x.x] KINESIN LIGHT CHAIN 2
    2e-20  17%  3ceqA  [x.x.x] KINESIN LIGHT CHAIN 2
    2e-16  19%  3edtD  [x.x.x] KINESIN LIGHT CHAIN 2
    4e-16  18%  3edtH  [x.x.x] KINESIN LIGHT CHAIN 2
    2e-14   9%  1ddbA  [f.1.4] PROTEIN (BID)
    1e-09  10%  2a5yC  [x.x.x] CED-4
    2e-09  13%  2a5yB  [x.x.x] CED-4
    3e-09   9%  2btpA  [x.x.x] 14-3-3 PROTEIN TAU
    9e-09  10%  3e6yB  [x.x.x] 14-3-3-LIKE PROTEIN C
    1e-08   9%  3c3oA  [x.x.x] PROGRAMMED CELL DEATH 6-INTERACTING PROTEIN
    2e-08   8%  2c63A  [x.x.x] 14-3-3 PROTEIN ETA
    1e-07   9%  2bq0B  [x.x.x] 14-3-3 BETA/ALPHA
    2e-07  11%  2b05E  [x.x.x] 14-3-3 PROTEIN GAMMA
    2e-07  16%  2c1nA  [x.x.x] 14-3-3 PROTEIN ZETA/DELTA
    4e-07   9%  1a38A  [a.118.7] 14-3-3 PROTEIN ZETA
    7e-07  12%  3cvlA  [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
    2e-06  13%  3ck7D  [x.x.x] SUSD
    2e-06   9%  2btpB  [x.x.x] 14-3-3 PROTEIN TAU
    2e-06   6%  3dsuA  [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
    4e-06   8%  2c23A  [x.x.x] 14-3-3 BETA/ALPHA
    6e-06   9%  2b05A  [x.x.x] 14-3-3 PROTEIN GAMMA
    6e-06  15%  3efzD  [x.x.x] 14-3-3 PROTEIN
    7e-06  10%  3e6yA  [x.x.x] 14-3-3-LIKE PROTEIN C
    9e-06  12%  3dsvA  [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
    2e-05   7%  3draA  [x.x.x] PROTEIN
    3e-05   8%  3ckbB  [x.x.x] SUSD
    4e-05   7%  3e33A  [a.118.6 (1d8dA)] PROTEIN
    5e-05  13%  3cvnA  [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR
    5e-05   8%  2cfuA  [x.x.x] SDSA1
    5e-05   4%  2axvA  [x.x.x] PRGX
    6e-05   9%  2bedA  [x.x.x] PROTEIN
    7e-05   8%  2bq0A  [x.x.x] 14-3-3 BETA/ALPHA
    8e-05   8%  2c08A  [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2
    8e-05  11%  3cv0A  [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
    9e-05   4%  2axzB  [x.x.x] PRGX
    1e-04   2%  2axuE  [x.x.x] PRGX
    1e-04   8%  2aw6B  [x.x.x] PRGX
    1e-04   7%  2cfzA  [x.x.x] SDSA1
    2e-04  13%  2c74B  [x.x.x] 14-3-3 PROTEIN ETA
    2e-04  12%  2cg3A  [x.x.x] SDSA1
    2e-04   8%  3dswA  [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
    2e-04  13%  2c0mA  [x.x.x] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
    3e-04   2%  2axuL  [x.x.x] PRGX
    3e-04   2%  2axuB  [x.x.x] PRGX
    4e-04  21%  2c0mC  [x.x.x] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
    4e-04  13%  2c74A  [x.x.x] 14-3-3 PROTEIN ETA
    8e-04   9%  3dsxA  [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
    1e-04   9%  2c1nA  [x.x.x] 14-3-3 PROTEIN ZETA/DELTA(query 1355->1522)
    0.001  20%  2c74B  [x.x.x] 14-3-3 PROTEIN ETA(query 1356->1417)
:1523

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3ceqB           ----------------------------------------------------------------------
3edtB           ----------------------------------------------------------------------
3ceqA           ----------------------------------------------------------------------
3edtD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
1ddbA           ----------------------------------------------------------------------
2a5yC           ----------------------------------------------------------------------
2a5yB           ----------------------------------------------------------------------
2btpA           ----------------------------------------------------------------------
3e6yB           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
2bq0B           ----------------------------------------------------------------------
2b05E           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
1a38A           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
2btpB           ----------------------------------------------------------------------
3dsuA           ----------------------------------------------------------------------
2c23A           ----------------------------------------------------------------------
2b05A           ----------------------------------------------------------------------
3efzD           ----------------------------------------------------------------------
3e6yA           ----------------------------------------------------------------------
3dsvA           ----------------------------------------------------------------------
3draA           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
3e33A           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
2bq0A           ----------------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
3cv0A           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
3dswA           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2axuL           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c74A           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3ceqB           ----------------------------------------------------------------------
3edtB           ----------------------------------------------------------------------
3ceqA           ----------------------------------------------------------------------
3edtD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
1ddbA           ----------------------------------------------------------------------
2a5yC           ----------------------------------------------------------------------
2a5yB           ----------------------------------------------------------------------
2btpA           ----------------------------------------------------------------------
3e6yB           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
2bq0B           ----------------------------------------------------------------------
2b05E           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
1a38A           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
2btpB           ----------------------------------------------------------------------
3dsuA           ----------------------------------------------------------------------
2c23A           ----------------------------------------------------------------------
2b05A           ----------------------------------------------------------------------
3efzD           ----------------------------------------------------------------------
3e6yA           ----------------------------------------------------------------------
3dsvA           ----------------------------------------------------------------------
3draA           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
3e33A           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
2bq0A           ----------------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
3cv0A           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
3dswA           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2axuL           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c74A           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3ceqB           ----------------------------------------------------------------------
3edtB           ----------------------------------------------------------------------
3ceqA           ----------------------------------------------------------------------
3edtD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
1ddbA           ----------------------------------------------------------------------
2a5yC           ----------------------------------------------------------------------
2a5yB           ----------------------------------------------------------------------
2btpA           ----------------------------------------------------------------------
3e6yB           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
2bq0B           ----------------------------------------------------------------------
2b05E           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
1a38A           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
2btpB           ----------------------------------------------------------------------
3dsuA           ----------------------------------------------------------------------
2c23A           ----------------------------------------------------------------------
2b05A           ----------------------------------------------------------------------
3efzD           ----------------------------------------------------------------------
3e6yA           ----------------------------------------------------------------------
3dsvA           ----------------------------------------------------------------------
3draA           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
3e33A           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
2bq0A           ----------------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
3cv0A           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
3dswA           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2axuL           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c74A           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3ceqB           ----------------------------------------------------------------------
3edtB           ----------------------------------------------------------------------
3ceqA           ----------------------------------------------------------------------
3edtD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
1ddbA           ----------------------------------------------------------------------
2a5yC           ----------------------------------------------------------------------
2a5yB           ----------------------------------------------------------------------
2btpA           ----------------------------------------------------------------------
3e6yB           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
2bq0B           ----------------------------------------------------------------------
2b05E           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
1a38A           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
2btpB           ----------------------------------------------------------------------
3dsuA           ----------------------------------------------------------------------
2c23A           ----------------------------------------------------------------------
2b05A           ----------------------------------------------------------------------
3efzD           ----------------------------------------------------------------------
3e6yA           ----------------------------------------------------------------------
3dsvA           ----------------------------------------------------------------------
3draA           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
3e33A           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
2bq0A           ----------------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
3cv0A           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
3dswA           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2axuL           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c74A           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3ceqB           ----------------------------------------------------------------------
3edtB           ----------------------------------------------------------------------
3ceqA           ----------------------------------------------------------------------
3edtD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
1ddbA           ----------------------------------------------------------------------
2a5yC           ----------------------------------------------------------------------
2a5yB           ----------------------------------------------------------------------
2btpA           ----------------------------------------------------------------------
3e6yB           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
2bq0B           ----------------------------------------------------------------------
2b05E           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
1a38A           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
2btpB           ----------------------------------------------------------------------
3dsuA           ----------------------------------------------------------------------
2c23A           ----------------------------------------------------------------------
2b05A           ----------------------------------------------------------------------
3efzD           ----------------------------------------------------------------------
3e6yA           ----------------------------------------------------------------------
3dsvA           ----------------------------------------------------------------------
3draA           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
3e33A           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
2bq0A           ----------------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
3cv0A           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
3dswA           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2axuL           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c74A           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3ceqB           ----------------------------------------------------------------------
3edtB           ----------------------------------------------------------------------
3ceqA           ----------------------------------------------------------------------
3edtD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
1ddbA           ----------------------------------------------------------------------
2a5yC           ----------------------------------------------------------------------
2a5yB           ----------------------------------------------------------------------
2btpA           ----------------------------------------------------------------------
3e6yB           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
2bq0B           ----------------------------------------------------------------------
2b05E           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
1a38A           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
2btpB           ----------------------------------------------------------------------
3dsuA           ----------------------------------------------------------------------
2c23A           ----------------------------------------------------------------------
2b05A           ----------------------------------------------------------------------
3efzD           ----------------------------------------------------------------------
3e6yA           ----------------------------------------------------------------------
3dsvA           ----------------------------------------------------------------------
3draA           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
3e33A           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
2bq0A           ----------------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
3cv0A           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
3dswA           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2axuL           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c74A           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3ceqB           ----------------------------------------------------------------------
3edtB           ----------------------------------------------------------------------
3ceqA           ----------------------------------------------------------------------
3edtD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
1ddbA           ----------------------------------------------------------------------
2a5yC           ----------------------------------------------------------------------
2a5yB           ----------------------------------------------------------------------
2btpA           ----------------------------------------------------------------------
3e6yB           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
2bq0B           ----------------------------------------------------------------------
2b05E           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
1a38A           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
2btpB           ----------------------------------------------------------------------
3dsuA           ----------------------------------------------------------------------
2c23A           ----------------------------------------------------------------------
2b05A           ----------------------------------------------------------------------
3efzD           ----------------------------------------------------------------------
3e6yA           ----------------------------------------------------------------------
3dsvA           ----------------------------------------------------------------------
3draA           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
3e33A           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
2bq0A           ----------------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
3cv0A           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
3dswA           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2axuL           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c74A           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3ceqB           ----------------------------------------------------------------------
3edtB           ----------------------------------------------------------------------
3ceqA           ----------------------------------------------------------------------
3edtD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
1ddbA           ----------------------------------------------------------------------
2a5yC           ----------------------------------------------------------------------
2a5yB           ----------------------------------------------------------------------
2btpA           ----------------------------------------------------------------------
3e6yB           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
2bq0B           ----------------------------------------------------------------------
2b05E           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
1a38A           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
2btpB           ----------------------------------------------------------------------
3dsuA           ----------------------------------------------------------------------
2c23A           ----------------------------------------------------------------------
2b05A           ----------------------------------------------------------------------
3efzD           ----------------------------------------------------------------------
3e6yA           ----------------------------------------------------------------------
3dsvA           ----------------------------------------------------------------------
3draA           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
3e33A           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
2bq0A           ----------------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
3cv0A           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
3dswA           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2axuL           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c74A           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3ceqB           ----------------------------------------------------------------------
3edtB           ----------------------------------------------------------------------
3ceqA           ----------------------------------------------------------------------
3edtD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
1ddbA           ----------------------------------------------------------------------
2a5yC           ----------------------------------------------------------------------
2a5yB           ----------------------------------------------------------------------
2btpA           ----------------------------------------------------------------------
3e6yB           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
2bq0B           ----------------------------------------------------------------------
2b05E           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
1a38A           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
2btpB           ----------------------------------------------------------------------
3dsuA           ----------------------------------------------------------------------
2c23A           ----------------------------------------------------------------------
2b05A           ----------------------------------------------------------------------
3efzD           ----------------------------------------------------------------------
3e6yA           ----------------------------------------------------------------------
3dsvA           ----------------------------------------------------------------------
3draA           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
3e33A           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
2bq0A           ----------------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
3cv0A           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
3dswA           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2axuL           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c74A           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxP
3ceqB           ----------------------------------------------------------------------
3edtB           ----------------------------------------------------------------------
3ceqA           ----------------------------------------------------------------------
3edtD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
1ddbA           ----------------------------------------------------------------------
2a5yC           ----------------------------------------------------------------------
2a5yB           ---------------------------------------------------------------------V
2btpA           ----------------------------------------------------------------------
3e6yB           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
2bq0B           ----------------------------------------------------------------------
2b05E           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
1a38A           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
2btpB           ----------------------------------------------------------------------
3dsuA           ----------------------------------------------------------------------
2c23A           ----------------------------------------------------------------------
2b05A           ----------------------------------------------------------------------
3efzD           ----------------------------------------------------------------------
3e6yA           ----------------------------------------------------------------------
3dsvA           ----------------------------------------------------------------------
3draA           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
3e33A           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
2bq0A           ----------------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
3cv0A           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
3dswA           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2axuL           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c74A           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           PRNALFTGRDDLILRLREQLRSSSEEGRMTPSVLKGMPGIGKTQLATEYLYRFRDEYDLVWWVRGGQTHQ
3ceqB           ----------------------------------------------------------------------
3edtB           ----------------------------------------------------------------------
3ceqA           ----------------------------------------------------------------------
3edtD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
1ddbA           ----------------------------------------------------------------------
2a5yC           PKQMTCYIREYHVDRVIKKLEMCDLDSFFLFLH--GRAGSGKSVIASQALSKSLIGINYDSIVWLKDSGT
2a5yB           PKQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLH-GRAGSGKSVIASQALSKSDQLYDSIVWLKDSGTAP
2btpA           ----------------------------------------------------------------------
3e6yB           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
2bq0B           ----------------------------------------------------------------------
2b05E           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
1a38A           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
2btpB           ----------------------------------------------------------------------
3dsuA           ----------------------------------------------------------------------
2c23A           ----------------------------------------------------------------------
2b05A           ----------------------------------------------------------------------
3efzD           ----------------------------------------------------------------------
3e6yA           ----------------------------------------------------------------------
3dsvA           ----------------------------------------------------------------------
3draA           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
3e33A           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
2bq0A           ----------------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
3cv0A           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
3dswA           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2axuL           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c74A           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           IHEAYTLLAQELDVFRDNTSINSTIHSVREALRRGKPRSRWLLIFDDVRQPDDIMRYLPIAGPGHVIITT
3ceqB           ----------------------------------------------------------------------
3edtB           ----------------------------------------------------------------------
3ceqA           ----------------------------------------------------------------------
3edtD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
1ddbA           ----------------------------------------------------------------------
2a5yC           APKSTFDLFTDILKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLDDVVQEETIRWAQELRLRCLVT
2a5yB           KSTFDLFTDILLMKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFDVVQEETIRWAQELRRCLVTT
2btpA           ----------------------------------------------------------------------
3e6yB           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
2bq0B           ----------------------------------------------------------------------
2b05E           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
1a38A           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
2btpB           ----------------------------------------------------------------------
3dsuA           ----------------------------------------------------------------------
2c23A           ----------------------------------------------------------------------
2b05A           ----------------------------------------------------------------------
3efzD           ----------------------------------------------------------------------
3e6yA           ----------------------------------------------------------------------
3dsvA           ----------------------------------------------------------------------
3draA           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
3e33A           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
2bq0A           ----------------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
3cv0A           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
3dswA           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2axuL           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c74A           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           RNLTWPEGGYFKTLPVEVFSLQESVALLSKCGLVGFSKHXXXXXXXXXGHMPIALRQAAAWMNDSATTIA
3ceqB           ----------------------------------------------------------------------
3edtB           ----------------------------------------------------------------------
3ceqA           ----------------------------------------------------------------------
3edtD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
1ddbA           ----------------------------------------------------------------------
2a5yC           VEISNAASQTCEFIEVTSLEIDECYDFLEAYGVGEKEEDVLNKTIELSSGNPATLMMFFKSCEP--KTFE
2a5yB           RDVEISNSQTCEFIEVTSLEIDECYDFLEAY---------------------------------------
2btpA           ----------------------------------------------------------------------
3e6yB           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
2bq0B           ----------------------------------------------------------------------
2b05E           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
1a38A           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
2btpB           ----------------------------------------------------------------------
3dsuA           ----------------------------------------------------------------------
2c23A           ----------------------------------------------------------------------
2b05A           ----------------------------------------------------------------------
3efzD           ----------------------------------------------------------------------
3e6yA           ----------------------------------------------------------------------
3dsvA           ----------------------------------------------------------------------
3draA           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
3e33A           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
2bq0A           ----------------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
3cv0A           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
3dswA           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2axuL           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c74A           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           EYLEFYRDKQAQLAPMFAPADPDYPETVITALNVSLDRLAVTNPAALQLLQVCSFFSTAPIPRSLFRHAQ
3ceqB           ----------------------------------------------------------------------
3edtB           ----------------------------------------------------------------------
3ceqA           ----------------------------------------------------------------------
3edtD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
1ddbA           ----------------------------------------------------------------------
2a5yC           KMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVL---SDEDRSALAFAVVM-----PPGVDIPVK
2a5yB           ----------------------------------------------------------------------
2btpA           ----------------------------------------------------------------------
3e6yB           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
2bq0B           ----------------------------------------------------------------------
2b05E           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
1a38A           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
2btpB           ----------------------------------------------------------------------
3dsuA           ----------------------------------------------------------------------
2c23A           ----------------------------------------------------------------------
2b05A           ----------------------------------------------------------------------
3efzD           ----------------------------------------------------------------------
3e6yA           ----------------------------------------------------------------------
3dsvA           ----------------------------------------------------------------------
3draA           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
3e33A           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
2bq0A           ----------------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
3cv0A           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
3dswA           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2axuL           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c74A           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           DVXXXXXXXXXXQEPNKLHRAFSDIGRYGLAVLNHRTRTVQVHRLVQQALRVPLTADDQEQRRHCAHLxx
3ceqB           ----------------------------------------------------------------------
3edtB           ----------------------------------------------------------------------
3ceqA           ----------------------------------------------------------------------
3edtD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
1ddbA           ----------------------------------------------------------------------
2a5yC           LWSCVIDDEVADRLKRLSKRGALLSGKR------MPVLTFKIDHIIHMFLKHVVDAQTIANGISILEQ--
2a5yB           ----------------------------------------------------------------------
2btpA           ----------------------------------------------------------------------
3e6yB           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
2bq0B           ----------------------------------------------------------------------
2b05E           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
1a38A           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
2btpB           ----------------------------------------------------------------------
3dsuA           ----------------------------------------------------------------------
2c23A           ----------------------------------------------------------------------
2b05A           ----------------------------------------------------------------------
3efzD           ----------------------------------------------------------------------
3e6yA           ----------------------------------------------------------------------
3dsvA           ----------------------------------------------------------------------
3draA           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
3e33A           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
2bq0A           ----------------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
3cv0A           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
3dswA           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2axuL           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c74A           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxxWATEAWDCTDSWVRRLVLQEIYVTDLRGEHSDSKQLAEATLSVWRE
3ceqB           ----------------------------------------------------------------------
3edtB           ----------------------------------------------------------------------
3ceqA           ----------------------------------------------------------------------
3edtD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
1ddbA           ----------------------------------------------------------------------
2a5yC           ----------------------------------------------------------------------
2a5yB           ----------------------------------------------------------------------
2btpA           ----------------------------------------------------------------------
3e6yB           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
2bq0B           ----------------------------------------------------------------------
2b05E           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------KLAEQMAACMKS
1a38A           ----------------------------------------------------------------------
3cvlA           -----------------------------------------------------------LAEAALAF--E
3ck7D           ----------------------------------------------------------------------
2btpB           ----------------------------------------------------------------------
3dsuA           ----------------------------------------------------------------------
2c23A           ----------------------------------------------------------------------
2b05A           ----------------------------------------------------------------------
3efzD           ----------------------------------------------------------------------
3e6yA           ----------------------------------------------------------------------
3dsvA           ----------------------------------------------------------RLKEAKRLEREQ
3draA           ------------------------------------------------DSKYDYSDITPVDINTEEPQIC
3ckbB           ------------------------------------------------ELPTDECLWAWQKNQDIPQ--L
3e33A           ----------------------------------------------------------------------
3cvnA           -----------------------------------------------------------LAEAALAF--E
2cfuA           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
2bq0A           ----------------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
3cv0A           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2c74B           ------------------------YLKMKGDYYRYLAE---VASGE--KKNSVVEASEAAYKEAFEISKE
2cg3A           -------------------------------------------------------------------EDS
3dswA           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2axuL           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c74A           ------------------------YLKMKGDYYRYLAE---VASGE--KKNSVVEASEAAYKEAFEISKE
3dsxA           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           KLGKTAPETLRAELYLVRALRNLGERKRAYELCERVLRILTEQHGPDSEEALEASLEFVRDLRYAGRFHD
3ceqB           ----------------------LVPRGSAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKE
3edtB           ----------------------LVPRGSAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKE
3ceqA           ----------------------LVPRGSAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKE
3edtD           ---------------------------------------------------------------------S
3edtH           ---------------------------------------------------------------------S
1ddbA           ----------------------------------------------------------------------
2a5yC           ----------------------------------------------------------------------
2a5yB           ----------------------------------------------------------------------
2btpA           ----------------------------------------------------------------------
3e6yB           ----------------------------------------------------------------------
3c3oA           ---KKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEG---ALETLLRYYD
2c63A           ----------------------------------------------------------------------
2bq0B           ----------------------------------------------------------------------
2b05E           ------------------------------------------------------------QLVQKARLAE
2c1nA           VTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSI----EQK----TEGAEKKQQMAREYREKIETED
1a38A           ----------NELVQKAKLAEQAERYDDMAACMKSVTEQ----GAELSNEERNLLSVAYKNVVGARRSSW
3cvlA           AVCQAAPEREEAWRSLGLTQAENEKDGLAIIALNHARML--------DPKDIAVHAALAVSHTNEHNANA
3ck7D           ----------------------------------------------------------------------
2btpB           ----------------------------------------------------------------------
3dsuA           ----------SATQAVFQKRQAGELDESVLELTSQILGAN-----PDFATLWNEVLQHLETEKSPEEAAL
2c23A           ----------------------------------------------------------------------
2b05A           ----------------------------------------------------------------------
3efzD           ----------------------------------------------------------------------
3e6yA           ----------------------------------------------------------------------
3dsvA           KL-KLYQSATQA---VFQKRQAGELDESVLELTSQILGA-----NPDFATLWNCRREVLQHLETEKSPEE
3draA           QI-LYDEDYKQIMGLLLALMKAEEYSERALHITELGI-----NELASHYTIW-----IYRFNILKNLPNR
3ckbB           TSISWSPSSQRTEWVYVRLGYDITQYNFFLDQTEGMTDA---ETLRQRAEIRLRALHYWYFLDLFGKAPF
3e33A           -----------------VLYRDRAEWADIDPVPQNDGPSP--------VVQIIYSEKFRDVYDYFRAVLQ
3cvnA           AVCQAAPEREEAWRSLGLTQAENEKDGLAIIALNHARML-----DPKDIAVHAA-----LAVSHTNEHNA
2cfuA           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2bedA           ------SPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYLQRDERSERRDAIELNAANYTVWHFRRVLLR
2bq0A           ----------------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
3cv0A           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2c74B           QMQPTHPIRLGLALFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLR-------
2cg3A           AGRYVEYGGAERLLEQARASYARGEYRWVVEVVNRLVFA-----EPDNRAARELQADA---LEQLGYQAE
3dswA           -----------QSATVFQKRQAGELDESVLELTSQILGA-----NPDFATLWCRREVLQHLETEKSPEES
2c0mA           -----------AVLLFEAAVQQDPKHMEAWQYLGTTQAENEQEL--LAISALRRCLELKPDNQTALMALA
2axuL           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c74A           QMQPTHPIRLGLALFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLR-------
3dsxA           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           SVELARDTRDRYRRILGPDDPETISASHVYAYALLLAGDHRRAADLFWEIYQTNEMILGPNNPSTLAAVD
3ceqB           AAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLS
3edtB           AAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLN
3ceqA           AAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLS
3edtD           AVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLN
3edtH           AVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLN
1ddbA           -----------------------------------------------------NGSGLGAKHITDLLVFG
2a5yC           ----------------------------------------------------------------------
2a5yB           ----------------------------------------------------------------------
2btpA           -----------GTENLY-FQSMEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYK
3e6yB           --------------------PTAREENVYMAKLAEQAERYEEMVEFMEKVSNSLGSEELTNVIGARRASW
3c3oA           QICSIEPKFPFSENQICLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDND--EGLKIAAKHYQ
2c63A           ----------------------------------------------------------------------
2bq0B           ------------------------------AKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYK
2b05E           QAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTS--------------
2c1nA           ICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRLAEVAKGIVDQSQQAYQISKKEMQPTHPIRLGLAL
1a38A           RVVSSIEQEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKV----FYLKMKGDYYRYLA
3cvlA           ALASLR--------------------------AWLLSQPQYEQLFFFAAPNEYRECRTLLHAALEMNPND
3ck7D           ----------------------------------------------------------------------
2btpB           ----------------------------------------------------------------------
3dsuA           VKAELGFLESCLRVNPKSYGTWHHRCWLLSRLPERELELCARFLEADERNFHCWDYRRFVAAQAAVAPAE
2c23A           ------------------------------AKLAEQAERYDDMAAAMKAVTEQGHELSN-------EERN
2b05A           ----------------------------------------------------------------------
3efzD           ----------------------------------------------------------------------
3e6yA           --------------------PTAREENVYMAKLAEQAERYEEMVEFMEKVSNSLGSEELTVEERNLLSVA
3dsvA           SAALVKAELGFLESCLRVNPKSYGTWHHRCWLLSRLPEPNWARELELCARFLE----ADERNFHCWVAAQ
3draA           NLYDELDWCEEIALD----NEKNYQIWNYRQLIIGQIMELNNNDFDPYREFDILEAMLSSDPKNHHVWSY
3ckbB           KEHFSNDLPVEKKGTELYTYIQNELNEIEADMYEPRQAPFGRADKAANWLLRARLYLNAGVYTGQTDYAK
3e33A           RDERSERAFKLTRDAIE-LNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVW-------H
3cvnA           NAALAS------LRAWLLSQPQYEQLGSVNLFFFAAPNEYRECRTLLHAALEMNPNDAQL----------
2cfuA           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2bedA           SLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKN--YHAWQHRQWVI
2bq0A           ------------------------------AKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYK
2c08A           ------------------------------GTKLDDDFKEERKVDVTSRAVEIT-----KTIEYLQPNPA
3cv0A           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
2cfzA           -------------------------------------LDQEWYDRGYHGSVSHN-----ARAVLNRYL--
2c74B           ----------------------------------------------------------------------
2cg3A           NAGW-------RNSYLSYELRH---GVPRDQGSADALAADTGLLFDYLGVRL--------DAGAAEGKAL
3dswA           AALVKAELGFLESCLRVNPKSYGTWHHRCWLLSRLPEPNWARELELCARFLE-----ADERNFHCWVAAQ
2c0mA           VSFTNESLQRQACEIL--RDWLRYTPAYAHLVTPDSLFLEVKELFLAAVRLD--------PTSIDPDVQC
2axuL           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c74A           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           GYAGSLMEAGDYFKALRYQEDNTERIYSLFGINHRGTLENMAALAAVLRRTGNLERAVKISGEVWRETKD
3ceqB           NLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKELTRAHEK
3edtB           NLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILRAHEK
3ceqA           NLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHE
3edtD           NLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLNNLALLCQNQGKAEEVEYYYRRALEIYAT
3edtH           NLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLNNLALLCQNQGKAEEVEYYYRRALEIYAT
1ddbA           FLQSSGCTRQELELGRELPVQAY------WEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIARHLA
2a5yC           ----------------------------------------------------------------------
2a5yB           ----------------------------------------------------------------------
2btpA           NVVGGRRSAWRVISSIEQKTKKLQLIKDYREKVESELRSIC---TTVLELLDKYLIANAT----NPESKV
3e6yB           RIISSIEQKEESRGNEEHVNSIREYRSKIENELSKICDGILKLLDAKLIPSAA-----------SGDSKV
3c3oA           FASGAFLHIKETVLSALSREPTVDGTLSLIMLAQAQEVFFLKAFGDAFKQCQYKDTLPKEVFPVLAAKHC
2c63A           --ARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKK
2bq0B           NVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICN---DVLELLDKYLIPNATQPESKV
2b05E           ----ADGNEKKIEMVRAYREKIEKELE------------AVCQDVLSLLDNYLIKNCS----ETQYESKV
2c1nA           NFSVFYYEINSPEKACSAKTAFDEAIAELDTLS-------------------------------------
1a38A           EVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLLNFSVFYYEILNSPEKACS-----------
3cvlA           AQL---HASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPG
3ck7D           ---GSFDQQGVFVKGYALGVTDEGES------GFYRTTFNCNELPTDECLWAWQKNQDIPQLTSISWSPS
2btpB           -----AEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTKKLQLIKD
3dsuA           -------ELAFTDSLITRNFSNYSSWHYRSCLLPQLHP---------RLPENVLLKELELVQNAFFTDQS
2c23A           LLSVAYKNVVGARRSSWRVISSIEQKKKQQMGKEYREKIEAELCNDVLELLDKYLIPNAT----QPESKV
2b05A           --AERYDDMAAAMKVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGN--EKKIEMVR
3efzD           ------------------------------------------------------------------GARA
3e6yA           YKNVIGARASWRIISSIEQKEESRGNEEHVNSIREYRSKIENELSKICDGILKLLDAKLIPSAASGDSKV
3dsvA           AAVAPAEELAFTDSLITRNFSNYSSWH------------YRSCLLPQLHPQNVLLKELELVQN-AFFTDP
3draA           RKWLVDTFDLHNDAKELSFVDKVIDTDL-KNNSAWSHRFFLLFSKKHLATDNTIDEELNYVKDKIVKCPQ
3ckbB           AEEYASKVIGSAYKLCTNYSELFMADNDENENAMQEIILPIRQDGVKTRNYGGSTYLVCGTRVAGMPRMG
3e33A           HRRVLVEWLKDPSQELEF--------IADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVR
3cvnA           ------HASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPG
2cfuA           -GYYDGNPATLDPLSPED--------SAGRYVEYMGGAERLLEQARASYARGEYRWVVEVVNRLVFAEPD
2axvA           ----------------------------------------------------------------------
2bedA           QEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYL
2bq0A           NVVGARRSSWRVISSIEQKTERNQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPE------SKV
2c08A           SQAEALLAELKFGRELGDDCNFGPALGEVGEA-RELSEVKDSLDEV-------KQNFIDPLQNLHDKDLR
3cv0A           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
2cfzA           -GYYDGNPATLDPLSPEDSAGRYVE--------YMGGAERLLEQARASYARGEYRWVVEVVNRLVFAEPD
2c74B           ----------------------------------------------------------------------
2cg3A           SINLRLPDIGENYLLELKNSHLNNLRGVQSEDAGQTVSIDRADLNRLLLKEVSAVRLVF-----------
3dswA           AAVAPAEELAFTDSLITRNFSNYSSWH------------YRSCLLPQLHPQNVLLKELELVQNAF-FTDP
2c0mA           GLGVLFNLSGEYDKAVDCFT----AALSVRPNDY----LLWNKLGATLANGNQSEEAVAA----YRRALE
2axuL           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
2c0mC           ----------------------------------------------------------------------
2c74A           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
2c74B           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:1400
query           RFGEDSMIXXXXXXXXXXXLRSVNRYHEALDLVEKAYRRCAELLGEDHPHVAAINVNRAVVLRQMGRTEE
3ceqB           EFGSVNGDNKPIWMHAEEREESKDKRRDSAPY--GEYGSWYKACKVDSPTVNTTLRSLGALYRRQGKLEA
3edtB           EFGSV--------------NGDNKPIWMHAEEREESKDKRRDACKVDSPTVNTTLRSLGALYRRQGKLEA
3ceqA           --------------------KEFGSVNGDNKPIWMHAEEREESKACKSPTVNTTLRSLGALYRRQGKLEA
3edtD           RLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKCKVDSPTVNTTLRSLGALYRRQGKLEA
3edtH           RLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRARDACKVDSPTVNTTLRSLGALYRRQGKLEA
1ddbA           QIGDEMDIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVA-SH
2a5yC           ----------------------------------------------------------------------
2a5yB           ----------------------------------------------------------------------
2btpA           FYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQTHPIRLGLALNFSVFYYEILNNPEL
3e6yB           FYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQDIATTELAPTHPRLGLALNFSVFYYEILNSPDR
3c3oA           IMQANAEYHQSIL------AKQQKKFGEEIARLQHAAEL--------IKTVASRYDEYVNVKDFSDKINR
2c63A           LEKEKIEKELETVCNDVLSLLDKFLIKNCND----FQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEA
2bq0B           FYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPILGLALNFSVFYYEILNSPEK
2b05E           FYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPRLGLALNYSVFYYEIQNAPEQ
2c1nA           ----------------------------------------------------------------------
1a38A           ----------------------------------------------------------------------
3cvlA           --------YVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTPASREATRSMDFFRMLLNVMNRPDL
3ck7D           S--------QRTEWVYVRLGYDITQYNFFLDQTEGMTDA------ETLRQRAEIRFLRALHYWYFLDLFG
2btpB           YREKVESELRSICTTV---LELLDKYLIANATNPESKVFYLKM----KGDYFRYLAEVACGDDRKQTIDN
3dsuA           AWFYHRWLLGAGSGRCELSVEKSTVLQSELESCKELQELE-----PENKWCLLTIILLMRALDPLLYEKE
2c23A           FYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPILGLALNFSVFYYEILNSPEK
2b05A           AYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESK----VFYLKMKGDYYRYLAEVATGEKRATVVES
3efzD           FCIKLKGDLMRYKAEILKDEEKNQCIKQAVEFYEDAERSFLEKYPSDPLYLATILNYTILKYDLLGNPEG
3e6yA           FYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQDIATTELAPTHPRLGLALNFSVFYYEILNSPDR
3dsvA           NDQSAWFYHRWLLGAGSGRCELSVEKSTVLQSELESCKELQELE-PENKWCLLTIILLMRALDPLLYEKE
3draA           NPSTWNYLLGIH--------ERFDRSITQLEEFSLQFVDLEK----DQVTSSFALETLAKIYTQQKKYNE
3ckbB           TTN--------GWSCIFARAAMVQKFFSNLEDVPMLP--------ADVEIPTKGLDTDEQIDAFDAEHGI
3e33A           NN--SVWNQRHFVISNTTGYSDRAVLEREVQYTLEMI--------KLVPHNESAWNYLKGILQDRGLSRY
3cvnA           YV--------RVMYNMAVSYSNMSQYDLAAKQLVRAIY-MQVGGEASREATRSMWDFFRMLLNVMNRPDL
2cfuA           NRAARELQADA--------LEQLGYQAENAGWRNSYL--------SAAYELRHGVPRDQGSADALAAMDT
2axvA           -----------------------DKNIDSYLNAVNIIN-IFKIIG--KEDIHRSLVEELTKISAKEKFTP
2bedA           LSRYPNLLNQLLDLQPSHSDIYEDMLENQCDNKEDILNKALEL---CEILAKEKDTIRKEYWRYIGRSLQ
2bq0A           FYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPILGLALNFSVFYYEILNSPEK
2c08A           EIQHHLKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEI----AESSFNLLEDIEQVSQLSALVQA
3cv0A           -----------------------SQYDLAAKQLVRAIY-MQVGGTTSREATRSMWDFFRMLLNVMNRPDL
2axzB           -----------------------DKNIDSYLNAVNIINIFKII--GKEDIHRSLVEELTKISAKEKFTPP
2axuE           -----------------------DKNIDSYLNAVNIINIFKII---GKEDIHRSLVEELTKISAKEKFTP
2aw6B           -------------------NRNLKEAQYYINQFEHLKTIKNIS--INGYYDLEINYLKQIYQFLTDKNID
2cfzA           NRAARELQADAL--------EQLGYQAENAGWRNSYLSAA--------YELRHGVPRDQGSADALAAMDT
2c74B           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
3dswA           NDQSAWFYHRWLLGAGSGRCELSVEKSTVLQSELESCKELQELE-PENKWCLLTIILLMRALDPLLYEKE
2c0mA           LQPGYIRSRYNLGIS----CINLGAHREAV----EHFLEALNM----QRKSRGPRGEGGAMSENIWSTRL
2axuL           ------------------------KNIDSYLNAVNIINIFKII---GKEDIHRSLVEELTKISAKEKFTP
2axuB           -----------------------DKNIDSYLNAVNIINIFKII---GKEDIHRSLVEELTKISAKEKFTP
2c0mC           -------------------CINLGAHREAVEHFLEAQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDA
2c74A           ----------------------------------------------------------------------
3dsxA           -------------------------KSTVLQSELESCKELQELE-PENKWCLLTIILLMRALDPLLYEKE
2c1nA           ------------------------RYDDMAACMKSVT-------EQGAELSNEERNLLSVAYKNVVGARR
2c74B           -------------------------YKEAFEISKEQ-------MQPTHPIRLGLALNFSVFYEIQNAPEQ


                         .         .         .         .         +         .         .:1470
query           ARVIDERALQVLTDRLGEYHXXXXXXXXXXXXDFFGLDDVAESVRRDTETLARCRRALSERHPLTLLARR
3ceqB           AHTLEDCASR------------------------------------------------------------
3edtB           AHTLEDCAS-------------------------------------------------------------
3ceqA           AHTLEDCASR------------------------------------------------------------
3edtD           AHTLEDCASR------------------------------------------------------------
3edtH           AHTLEDCASR------------------------------------------------------------
1ddbA           APSLLRDVFHTTVNFINQNL--------------------------------------------------
2a5yC           ----------------------------------------------------------------------
2a5yB           ----------------------------------------------------------------------
2btpA           ACTLAKTAFDEAIAELDTLN--------------------------------------------------
3e6yB           ACNLAKQAFDEAIAEEESYK--------------------------------------------------
3c3oA           ALAAAKKDNDFIYHDRVPDL--------------------------------------------------
2c63A           SEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDST
2bq0B           ACSLAKTAFDEAIAELDTLN--------------------------------------------------
2b05E           ACHLAKTAFDDAIAELDTLN--------------------------------------------------
2c1nA           ----------------------------------------------------------------------
1a38A           ----------------------------------------------------------------------
3cvlA           VELTYAQNVE------------------------------------------------------------
3ck7D           KAPFKEHFSN------------------------------------------------------------
2btpB           SQGAYQEAFDISKKEMQPTHPIRLGLA------LNFSVFYYEILNNPELACTLAKTAFDTSYKDSTLIMQ
3dsuA           TLQYFSTLKA------------------------------------------------------------
2c23A           ACSLAKTAFD------------------------------------------------------------
2b05A           SEKAYSEAHEISKEHMQPTH--------------------------------------------------
3efzD           AMKFANRAIQAAENSEQFSE--------------------------------------------------
3e6yA           ACNLAKQAFDEAIAELDTLG--------------------------------------------------
3dsvA           TLQYFSTLKA------------------------------------------------------------
3draA           SRTVYDLLKS------------------------------------------------------------
3ckbB           RTEDMIKAAGDDRALLYSGV--------------------------------------------------
3e33A           PNLLNQ----------------------------------------------------------------
3cvnA           VELTYAQNVE------------------------------------------------------------
2cfuA           GLLFDYLGVR------------------------------------------------------------
2axvA           PKEVTMYYENYV----------------------------------------------------------
2bedA           SK--------------------------------------------------------------------
2bq0A           ACSLAKTAFDEAIAELDTLN--------------------------------------------------
2c08A           QLEYHKQAVQILQQVTVRLE--------------------------------------------------
3cv0A           VELTYAQNVEPFAKEFGLQS--------------------------------------------------
2axzB           KEVTYYENYVAI----------------------------------------------------------
2axuE           PKEVTMYYENYV----------------------------------------------------------
2aw6B           SYLNAVNIIN-IFKIIGK----------------------------------------------------
2cfzA           GLLFDYLGVR------------------------------------------------------------
2c74B           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
3dswA           TLQYFSTLKA------------------------------------------------------------
2c0mA           ALSMLGQSDA------------------------------------------------------------
2axuL           PKEVTMYYEN------------------------------------------------------------
2axuB           PKEVTMYYENYV----------------------------------------------------------
2c0mC           YGAADARDLSTLLTMFG-----------------------------------------------------
2c74A           ----------------------------------------------------------------------
3dsxA           TLQYFSTLKA------------------------------------------------------------
2c1nA           SSWRVVSSIEQKTEGAEKKQ------QMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK
2c74B           ACLLAKQAFDDAIAELD-----------------------------------------------------


                         .         .         *         .         .         .         .:1540
query           NLVLGRKAMNEDVAEEIAAVERLYAEVMGDQHPATLSMRRRERGNADLHLNNx
3ceqB           -----------------------------------------------------
3edtB           -----------------------------------------------------
3ceqA           -----------------------------------------------------
3edtD           -----------------------------------------------------
3edtH           -----------------------------------------------------
1ddbA           -----------------------------------------------------
2a5yC           -----------------------------------------------------
2a5yB           -----------------------------------------------------
2btpA           -----------------------------------------------------
3e6yB           -----------------------------------------------------
3c3oA           -----------------------------------------------------
2c63A           LI---------------------------------------------------
2bq0B           -----------------------------------------------------
2b05E           -----------------------------------------------------
2c1nA           -----------------------------------------------------
1a38A           -----------------------------------------------------
3cvlA           -----------------------------------------------------
3ck7D           -----------------------------------------------------
2btpB           LL---------------------------------------------------
3dsuA           -----------------------------------------------------
2c23A           -----------------------------------------------------
2b05A           -----------------------------------------------------
3efzD           -----------------------------------------------------
3e6yA           -----------------------------------------------------
3dsvA           -----------------------------------------------------
3draA           -----------------------------------------------------
3ckbB           -----------------------------------------------------
3e33A           -----------------------------------------------------
3cvnA           -----------------------------------------------------
2cfuA           -----------------------------------------------------
2axvA           -----------------------------------------------------
2bedA           -----------------------------------------------------
2bq0A           -----------------------------------------------------
2c08A           -----------------------------------------------------
3cv0A           -----------------------------------------------------
2axzB           -----------------------------------------------------
2axuE           -----------------------------------------------------
2aw6B           -----------------------------------------------------
2cfzA           -----------------------------------------------------
2c74B           -----------------------------------------------------
2cg3A           -----------------------------------------------------
3dswA           -----------------------------------------------------
2c0mA           -----------------------------------------------------
2axuL           -----------------------------------------------------
2axuB           -----------------------------------------------------
2c0mC           -----------------------------------------------------
2c74A           -----------------------------------------------------
3dsxA           -----------------------------------------------------
2c1nA           MKGDYYRYLAEVAKGIVDQSQQAYQEEMQPTHPIRLGLALNFSVFYYEILNS-
2c74B           -----------------------------------------------------