[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ54462.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bxzB.bssp"
#ERROR : Can't open dsspfile "1cu1A.bssp"
#ERROR : Can't open dsspfile "2ekdF.bssp"
#ERROR : Can't open dsspfile "2ekdA.bssp"
#ERROR : Can't open dsspfile "1d9zA.bssp"
#ERROR : Can't open dsspfile "2dxcE.bssp"
#ERROR : Can't open dsspfile "1d9xA.bssp"
#ERROR : Can't open dsspfile "3e0jC.bssp"
#ERROR : Can't open dsspfile "2bmfB.bssp"
#ERROR : Can't open dsspfile "2dxcB.bssp"
#ERROR : Can't open dsspfile "2dxcH.bssp"
#ERROR : Can't open dsspfile "3eitA.bssp"
#ERROR : Can't open dsspfile "2cevA.bssp"
#ERROR : Can't open dsspfile "3bbeA.bssp"
#ERROR : Can't open dsspfile "1cevA.bssp"
#ERROR : Can't open dsspfile "3eiqD.bssp"
#ERROR : Can't open dsspfile "2db3A.bssp"
#ERROR : Can't open dsspfile "3dinA.bssp"
#ERROR : Can't open dsspfile "3dkpA.bssp"
#ERROR : Can't open dsspfile "3eiqA.bssp"
#ERROR : Can't open dsspfile "3ddeA.bssp"
#ERROR : Can't open dsspfile "3dmqA.bssp"
#ERROR : Can't open dsspfile "3borA.bssp"
#ERROR : Can't open dsspfile "1b47A.bssp"
#ERROR : Can't open dsspfile "3berA.bssp"
#ERROR : Can't open dsspfile "3dl8A.bssp"
#ERROR : Can't open dsspfile "2b99A.bssp"
#ERROR : Can't open dsspfile "3cpeA.bssp"
#ERROR : Can't open dsspfile "3eaqA.bssp"
#ERROR : Can't open dsspfile "3ddeB.bssp"
#ERROR : Can't open dsspfile "3eaqB.bssp"
#ERROR : Can't open dsspfile "1dhsA.bssp"
#ERROR : Can't open dsspfile "2d7dA.bssp"
#ERROR : Can't open dsspfile "3dwlD.bssp"
#ERROR : Can't open dsspfile "1d2mA.bssp"
#ERROR : Can't open dsspfile "3b6eA.bssp"
#ERROR : Can't open dsspfile "2b2nA.bssp"
#ERROR : Can't open dsspfile "1a1vA.bssp"
#ERROR : Can't open dsspfile "3dddA.bssp"
#ERROR : Can't open dsspfile "2b2nB.bssp"
#ERROR : Can't open dsspfile "2bhrA.bssp"
#ERROR : Can't open dsspfile "3earA.bssp"
#ERROR : Can't open dsspfile "1c4oA.bssp"
#ERROR : Can't open dsspfile "3easA.bssp"
#ERROR : Can't open dsspfile "2b98C.bssp"
#ERROR : Can't open dsspfile "149lA.bssp"
#ERROR : Can't open dsspfile "3crvA.bssp"
#ERROR : Can't open dsspfile "1ef0A.bssp"
#ERROR : Can't open dsspfile "3e0jE.bssp"
#ERROR : Can't open dsspfile "2csdA.bssp"
#ERROR : Can't open dsspfile "2c5uA.bssp"
#ERROR : Can't open dsspfile "1e2bA.bssp"
#ERROR : Can't open dsspfile "2bhrB.bssp"
#ERROR : Can't open dsspfile "1dydA.bssp"
#ERROR : Can't open dsspfile "1d2zB.bssp"
#ERROR : Can't open dsspfile "1a16A.bssp"
#ERROR : Can't open dsspfile "3bxzA.bssp"
#ERROR : Can't open dsspfile "2bmfA.bssp"
#ERROR : Can't open dsspfile "3cdrA.bssp"
#ERROR : Can't open dsspfile "2bwsA.bssp"
#ERROR : Can't open dsspfile "2dgdA.bssp"
#ERROR : Can't open dsspfile "2bwwA.bssp"
#ERROR : Can't open dsspfile "1dfaA.bssp"
#ERROR : Can't open dsspfile "1d9wA.bssp"
#ERROR : Can't open dsspfile "3buwB.bssp"
#ERROR : Can't open dsspfile "1d9zA.bssp"
#ERROR : Can't open dsspfile "1d9xA.bssp"
#ERROR : Can't open dsspfile "1d2mA.bssp"

## Summary of PDB Search
:1210
    2e-48  12%  3bxzB  [x.x.x] PREPROTEIN TRANSLOCASE SUBUNIT SECA
    3e-47  10%  1cu1A  [c.37.1 - c.37.1 - b.47.1] PROTEIN (PROTEASE/HELICASE NS3)
    6e-44  18%  2ekdF  [x.x.x] HYPOTHETICAL PROTEIN PH0250
    7e-39  18%  2ekdA  [x.x.x] HYPOTHETICAL PROTEIN PH0250
    4e-37  22%  1d9zA  [c.37.1 - c.37.1] EXCINUCLEASE UVRABC COMPONENT UVRB
    3e-34  14%  2dxcE  [x.x.x] THIOCYANATE HYDROLASE SUBUNIT BETA
    5e-34  21%  1d9xA  [c.37.1 - c.37.1] EXCINUCLEASE UVRABC COMPONENT UVRB
    1e-33  12%  3e0jC  [x.x.x] DNA POLYMERASE SUBUNIT DELTA-2
    4e-33  12%  2bmfB  [x.x.x] RNA HELICASE
    1e-31  14%  2dxcB  [x.x.x] THIOCYANATE HYDROLASE SUBUNIT BETA
    5e-31  14%  2dxcH  [x.x.x] THIOCYANATE HYDROLASE SUBUNIT BETA
    2e-30   9%  3eitA  [x.x.x] PUTATIVE ATP/GTP BINDING PROTEIN
    5e-28  11%  2cevA  [c.42.1] PROTEIN (ARGINASE)
    6e-28   8%  3bbeA  [x.x.x] RIBOSOME BIOGENESIS PROTEIN NEP1-LIKE
    1e-27  11%  1cevA  [c.42.1] PROTEIN (ARGINASE)
    2e-27  14%  3eiqD  [x.x.x] EUKARYOTIC INITIATION FACTOR 4A-I
    2e-25  16%  2db3A  [x.x.x] ATP-DEPENDENT RNA HELICASE VASA
    4e-25  10%  3dinA  [x.x.x] PROTEIN TRANSLOCASE SUBUNIT SECA
    8e-24  13%  3dkpA  [x.x.x] PROBABLE ATP-DEPENDENT RNA HELICASE DDX52
    2e-23  13%  3eiqA  [x.x.x] EUKARYOTIC INITIATION FACTOR 4A-I
    1e-21  13%  3ddeA  [x.x.x] TENA/THI-4 PROTEIN, DOMAIN OF UNKNOWN FUNCTION
    2e-21  15%  3dmqA  [x.x.x] RNA POLYMERASE-ASSOCIATED PROTEIN RAPA
    6e-21  16%  3borA  [x.x.x] HUMAN INITIATION FACTOR 4A-II
    2e-19   9%  1b47A  [a.48.1 - a.39.1 - d.93.1] CBL
    2e-19  15%  3berA  [x.x.x] PROBABLE ATP-DEPENDENT RNA HELICASE DDX47
    3e-19  14%  3dl8A  [x.x.x] PROTEIN TRANSLOCASE SUBUNIT SECA
    1e-18  15%  2b99A  [x.x.x] RIBOFLAVIN SYNTHASE
    2e-18   7%  3cpeA  [x.x.x] DNA PACKAGING PROTEIN GP17
    2e-18  16%  3eaqA  [x.x.x] HEAT RESISTANT RNA DEPENDENT ATPASE
    2e-17  16%  3ddeB  [x.x.x] TENA/THI-4 PROTEIN, DOMAIN OF UNKNOWN FUNCTION
    5e-17  20%  3eaqB  [x.x.x] HEAT RESISTANT RNA DEPENDENT ATPASE
    6e-17  11%  1dhsA  [c.31.1 (1rlzA)] DEOXYHYPUSINE SYNTHASE
    1e-16  14%  2d7dA  [x.x.x] UVRABC SYSTEM PROTEIN B
    2e-16   9%  3dwlD  [x.x.x] ACTIN-RELATED PROTEIN 2/3 COMPLEX SUBUNIT 2
    3e-16  19%  1d2mA  [c.37.1 - c.37.1] EXCINUCLEASE ABC SUBUNIT B
    5e-16  22%  3b6eA  [x.x.x] INTERFERON-INDUCED HELICASE C DOMAIN-CONTAINING
    4e-14  24%  2b2nA  [x.x.x] TRANSCRIPTION-REPAIR COUPLING FACTOR
    4e-14   9%  1a1vA  [c.37.1 - c.37.1] PROTEIN (NS3 PROTEIN)
    6e-14  14%  3dddA  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    5e-13  23%  2b2nB  [x.x.x] TRANSCRIPTION-REPAIR COUPLING FACTOR
    1e-12   5%  2bhrA  [x.x.x] RNA HELICASE
    2e-12  24%  3earA  [x.x.x] HERA
    9e-12  17%  1c4oA  [c.37.1 - c.37.1] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB
    5e-11  22%  3easA  [x.x.x] HERA
    2e-10  12%  2b98C  [x.x.x] RIBOFLAVIN SYNTHASE
    2e-10  10%  149lA  [x.x.x] T4 LYSOZYME
    2e-09  10%  3crvA  [x.x.x] XPD/RAD3 RELATED DNA HELICASE
    3e-09  13%  1ef0A  [b.86.1 - d.95.2 - d.95.2] PI-SCEI ENDONUCLEASE
    1e-08  16%  3e0jE  [x.x.x] DNA POLYMERASE SUBUNIT DELTA-2
    1e-08  12%  2csdA  [x.x.x] TOPOISOMERASE V
    4e-08   7%  2c5uA  [x.x.x] RNA LIGASE
    7e-08  10%  1e2bA  [x.x.x] ENZYME IIB-CELLOBIOSE
    4e-07  10%  2bhrB  [x.x.x] RNA HELICASE
    1e-06  11%  1dydA  [x.x.x] T4 LYSOZYME
    2e-06  19%  1d2zB  [a.77.1] DEATH DOMAIN OF TUBE
    2e-06   7%  1a16A  [x.x.x] AMINOPEPTIDASE P
    2e-06  11%  3bxzA  [x.x.x] PREPROTEIN TRANSLOCASE SUBUNIT SECA
    4e-06  15%  2bmfA  [x.x.x] RNA HELICASE
    4e-05   9%  3cdrA  [x.x.x] LYSOZYME
    1e-04   8%  2bwsA  [x.x.x] XAA-PRO AMINOPEPTIDASE P
    1e-04   7%  2dgdA  [x.x.x] 223AA LONG HYPOTHETICAL ARYLMALONATE
    1e-04   8%  2bwwA  [x.x.x] AMINOPEPTIDASE P
    1e-04  14%  1dfaA  [b.86.1 - d.95.2 - d.95.2] PI-SCEI ENDONUCLEASE
    5e-04   9%  1d9wA  [d.2.1] PROTEIN (LYSOZYME)
    8e-04  14%  3buwB  [a.48.1 - a.39.1 - d.93.1 (2cblA)] E3 UBIQUITIN-PROTEIN
    6e-09  26%  1d9zA  [c.37.1 - c.37.1] EXCINUCLEASE UVRABC COMPONENT UVRB(query 647->728)
    5e-10  24%  1d9xA  [c.37.1 - c.37.1] EXCINUCLEASE UVRABC COMPONENT UVRB(query 647->728)
    3e-09  22%  1d2mA  [c.37.1 - c.37.1] EXCINUCLEASE ABC SUBUNIT B(query 653->815)
:1210

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxALKRAIETARNGHDPLLDLVAPPSVRPLIVAGLAA
3bxzB           ----------------------------------------------------------------------
1cu1A           ----------------------------------------------------------------------
2ekdF           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------
1d9zA           -----------------------------------AIAKLVDGLRRGVKHQTLLGATGTGKTFTISNVIA
2dxcE           ----------------------------------------------------------------------
1d9xA           -----------------------------------AIAKLVDGLRRGVKHQTLLGATGTGKTFTISNVIA
3e0jC           ----------------------------------------------------------------------
2bmfB           ----------------------------------------------------------------------
2dxcB           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------
3eitA           ----------------------------------------------------------------------
2cevA           ----------------------------------------------------------------------
3bbeA           ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
3eiqD           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
3dinA           ----------------------------------------------------------------------
3dkpA           ----------------------------------------------------------------------
3eiqA           ----------------------------------------------------------------------
3ddeA           ----------------------------------------------------------------------
3dmqA           ----------------------------------------------------------------------
3borA           ----------------------------------------------------------------------
1b47A           ----------------------------------------------------------------------
3berA           ----------------------------------------------------------------------
3dl8A           ----------------------------------------------------------------------
2b99A           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3ddeB           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3dwlD           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
3b6eA           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
1a1vA           ----------------------------------------------------------------------
3dddA           ----------------------------------------------------------------------
2b2nB           ----------------------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
2b98C           ----------------------------------------------------------------------
149lA           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
1ef0A           ----------------------------------------------------------------------
3e0jE           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
2c5uA           ----------------------------------------------------------------------
1e2bA           ----------------------------------------------------------------------
2bhrB           ----------------------------------------------------------------------
1dydA           ----------------------------------------------------------------------
1d2zB           -----------------------------------------------------MSIIPKGMDVQACSGAG
1a16A           ----------------------------------------------------------------------
3bxzA           ----------------------------------------------------------------------
2bmfA           ----------------------------------------------------------------------
3cdrA           ----------------------------------------------------------------------
2bwsA           ----------------------------------------------------------------------
2dgdA           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------------------
1dfaA           ----------------------------------------------------------------------
1d9wA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DAPVGAGRPVLALTATEREAADLNSALGSLLPADSVALFPAWETLPHERLSPRSDTVGQRLAVLRRLTHP
3bxzB           ----------------------------------------------------------------------
1cu1A           ----------------------------------------------------------------------
2ekdF           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------
1d9zA           QV----NKPTLVIAHNKTLAGQLYSELKEFFPHNAVEYFVSYDYYQPEAYVPQTDTYIEKDAKIDKLRHS
2dxcE           ----------------------------------------------------------------------
1d9xA           QV----NKPTLVIAHNKTLAGQLYSELKEFFPHNAVEYFVSYDYYQPEAYVPQTDTYIEKDAKIDKLRHS
3e0jC           ----------------------------------------------------------------------
2bmfB           ----------------------------------------------------------------------
2dxcB           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------
3eitA           ----------------------------------------------------------------------
2cevA           ----------------------------------------------------------------------
3bbeA           ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
3eiqD           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
3dinA           ----------------------------------------------------------------------
3dkpA           ----------------------------------------------------------------------
3eiqA           ----------------------------------------------------------------------
3ddeA           ----------------------------------------------------------------------
3dmqA           ----------------------------------------------------------------------
3borA           ----------------------------------------------------------------------
1b47A           ----------------------------------------------------------------------
3berA           ----------------------------------------------------------------------
3dl8A           ----------------------------------------------------------------------
2b99A           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3ddeB           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3dwlD           ----------------------------------------------------------------------
1d2mA           --------------------------------NAVEYFISYYDYYQPEAYVPGKDLYASINPEIERLRHS
3b6eA           ----------------------------------------------------------------------
2b2nA           ------AGPVVLIAPDMQNALRLHDEISQFTD-QMVMNLADWETLPYDSFSPHQDIISSRLSTLYQL---
1a1vA           ----------------------------------------------------------------------
3dddA           ----------------------------------------------------------------------
2b2nB           ------AGPVVLIAPDMQNALRLHDEISQFTD-QMVMNLADWETLPYDSFSPHQDIISSRLSTLYQL---
2bhrA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
2b98C           ----------------------------------------------------------------------
149lA           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
1ef0A           ----------------------------------------------------------------------
3e0jE           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
2c5uA           ----------------------------------------------------------------------
1e2bA           ----------------------------------------------------------------------
2bhrB           ----------------------------------------------------------------------
1dydA           ----------------------------------------------------------------------
1d2zB           CLNFPAEIKKGF-KYTAQDVFQIDEAANRLPPDQSKSMIDEWKTSGKL---NERPTVGVLLQLLVQAELF
1a16A           ----------------------------------------------------------------------
3bxzA           ----------------------------------------------------------------------
2bmfA           ----------------------------------------------------------------------
3cdrA           ----------------------------------------------------------------------
2bwsA           ----------------------------------------------------------------------
2dgdA           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------------------
1dfaA           ----------------------------------------------------------------------
1d9wA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DPDDPLTAPLRVVVAPIRSVLQPLVSGLGDLQPVRVREGDSVALDELVQSLVDIGYSRVDLVEKRGDIAV
3bxzB           ----------------------------------------------------------------------
1cu1A           ----------------------------------------------------------------------
2ekdF           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------
1d9zA           ATSALFERRDVIIVASVSCIYGLGSPEEYRELVVSLRVGMEIERNALLRRLVDIQYDRNDIF--RGTFRV
2dxcE           ----------------------------------------------------------------------
1d9xA           ATSALFERRDVIIVASVSCIYGLGSPEEYRELVVSLRVGMEIERNALLRRLVDIQYDRNDIF--RGTFRV
3e0jC           ----------------------------------------------------------------------
2bmfB           ----------------------------------------------------------------------
2dxcB           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------
3eitA           ----------------------------------------------------------------------
2cevA           ----------------------------------------------------------------------
3bbeA           ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
3eiqD           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
3dinA           ----------------------------------------------------------------------
3dkpA           ----------------------------------------------------------------------
3eiqA           ----------------------------------------------------------------------
3ddeA           ----------------------------------------------------------------------
3dmqA           ----------------------------------------------------------------------
3borA           ----------------------------------------------------------------------
1b47A           ----------------------------------------------------------------------
3berA           ----------------------------------------------------------------------
3dl8A           ----------------------------------------------------------------------
2b99A           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3ddeB           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3dwlD           ----------------------------------------------------------------------
1d2mA           TTRSLLTRRDVIVVASVSAIYGLGDPRE-------YRARNLVVREVLLERLLELGYQRNDIDLSPGRFRA
3b6eA           ----------------------------------------------------------------------
2b2nA           -----PTMQRGVLIVPVNTLMQRVCPHSFLHGALVMKKGQRLSRDALRTQLDSAGYRHVDQVMEHGEYAT
1a1vA           ----------------------------------------------------------------------
3dddA           ----------------------------------------------------------------------
2b2nB           -----PTMQRGVLIVPVNTLMQRVCPHSFLHGHLVMKKGQRLSRDALRTQLDSAGYRHVDQVMEHGEYAT
2bhrA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
2b98C           ----------------------------------------------------------------------
149lA           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
1ef0A           ----------------------------GSIECIEIEVGNKVKLPRGRETMYSVVQKSQHRAHKSDSSRE
3e0jE           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
2c5uA           ----------------------------------------------------------------------
1e2bA           ----------------------------------------------------------------------
2bhrB           ----------------------------------------------------------------------
1dydA           ----------------------------------------------------------------------
1d2zB           SAADFVALDFLNESTPARPVDGP-----------------------------------------------
1a16A           ----------------------------------------------------------------------
3bxzA           ----------------------------------------------------------------------
2bmfA           ----------------------------------------------------------------------
3cdrA           ----------------------------------------------------------------------
2bwsA           ----------------------------------------------------------------------
2dgdA           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------------------
1dfaA           ----------------------------GSIECIEIEVGNKVGKDGRPREVIKLPRGRETMYSVVQKSQH
1d9wA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RGGILDVFPPTEEHPLRLEFWGDTVEEIRYFQVADQRSISKPGAAEAGLFAPPCRELLLTDTVRKXXXXX
3bxzB           ----------------------------------------------------------------------
1cu1A           ----------------------------------------------------------------------
2ekdF           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------
1d9zA           RGDVVEIFPASDEHCIRVEFFGDEIE--REVDALTGKVLGE--REHVAIF--PASHFVTREEKMR-----
2dxcE           ----------------------------------------------------------------------
1d9xA           RGDVVEIFPASDEHCIRVEFFGDEIE--AEVDALTGKVLGE----REHVAIFPASHFVTREEKMR-----
3e0jC           ----------------------------------------------------------------------
2bmfB           ----------------------------------------------------------------------
2dxcB           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------
3eitA           ----------------------------------------------------------------------
2cevA           ----------------------------------------------------------------------
3bbeA           ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
3eiqD           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
3dinA           ----------------------------------------------------------------------
3dkpA           ----------------------------------------------------------------------
3eiqA           ----------------------------------------------------------------------
3ddeA           ----------------------------------------------------------------------
3dmqA           ----------------------------------------------------------------------
3borA           ----------------------------------------------------------------------
1b47A           ----------------------------------------------------------------------
3berA           ----------------------------------------------------------------------
3dl8A           ----------------------------------------------------------------------
2b99A           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3ddeB           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3dwlD           ----------------------------------------------------------------------
1d2mA           KGEVLEIFPAYETEPIRVELGFVLFPATHYLSPEGLEEILK-----------------------------
3b6eA           ----------------------------------------------------------------------
2b2nA           RGALLDLFPMGSELPYRLDFFDDEIDSLRVFDVDSQRTLEEVEAINLLPAHEFPTDKAAIELFRSQWRDT
1a1vA           ----------------------------------------------------------------------
3dddA           ----------------------------------------------------------------------
2b2nB           RGALLDLFPMGSELPYRLDFFDDEIDSLRVFDVDSQRTLEEVEAINLLPAHEFPTDKAAIELFRSQWRDT
2bhrA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
2b98C           ----------------------------------------------------------------------
149lA           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
1ef0A           VPELLKFTCATHELVVRTPRSVRVITFEMGQKKAPDGRIVE-----------------------------
3e0jE           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
2c5uA           ----------------------------------------------------------------------
1e2bA           ----------------------------------------------------------------------
2bhrB           ----------------------------------------------------------------------
1dydA           ----------------------------------------------------------------------
1d2zB           ----------------------------------------------------------------------
1a16A           ----------------------------------------------------------------------
3bxzA           ----------------------------------------------------------------------
2bmfA           ----------------------------------------------------------------------
3cdrA           ----------------------------------------------------------------------
2bwsA           ----------------------------------------------------------------------
2dgdA           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------------------
1dfaA           RAHKSDSSREVPELLFTCNATHELVVRTPRSVRRLSRTI-------------------------------
1d9wA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           XXXXXXXXDILTKLADGVAVEGMEAFAPVLADRMEXXXXXXPPGTHIVGCDPERIRTRAQELVATSQEFL
3bxzB           ----------------------------------------------------------------------
1cu1A           ----------------------------------------------------------------------
2ekdF           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
2dxcE           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
3e0jC           ----------------------------------------------------------------------
2bmfB           ----------------------------------------------------------------------
2dxcB           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------
3eitA           ----------------------------------------------------------------------
2cevA           ----------------------------------------------------------------------
3bbeA           ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
3eiqD           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
3dinA           ----------------------------------------------------------------------
3dkpA           ----------------------------------------------------------------------
3eiqA           ----------------------------------------------------------------------
3ddeA           ----------------------------------------------------------------------
3dmqA           ----------------------------------------------------------------------
3borA           ----------------------------------------------------------------------
1b47A           ----------------------------------------------------------------------
3berA           ----------------------------------------------------------------------
3dl8A           ----------------------------------------------------------------------
2b99A           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3ddeB           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3dwlD           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
3b6eA           ----------------------------------------------------------------------
2b2nA           FEVKRDPEHIYQQVSKGTLPAGIEYWQPLFSEPLPPLFSYFPANTLLV--NTGDLETSAERFQADTLARF
1a1vA           ----------------------------------------------------------------------
3dddA           ----------------------------------------------------------------------
2b2nB           FEVKRDPEHIYQQVSKGTLPAGIEYWQPLFFSEPLPPLFSYFPANTLL-VNTGDLETSAERFQADTLARF
2bhrA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
2b98C           ----------------------------------------------------------------------
149lA           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
1ef0A           ----------------------------------------------------------------------
3e0jE           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
2c5uA           ----------------------------------------------------------------------
1e2bA           ----------------------------------------------------------------------
2bhrB           ----------------------------------------------------------------------
1dydA           ----------------------------------------------------------------------
1d2zB           ----------------------------------------------------------------------
1a16A           ----------------------------------------------------------------------
3bxzA           ----------------------------------------------------------------------
2bmfA           ----------------------------------------------------------------------
3cdrA           ----------------------------------------------------------------------
2bwsA           ----------------------------------------------------------------------
2dgdA           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------------------
1dfaA           ----------------------------------------------------------------------
1d9wA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           EAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bxzB           ----------------------------------------------------------------------
1cu1A           ----------------------------------------------------------------------
2ekdF           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
2dxcE           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
3e0jC           ----------------------------------------------------------------------
2bmfB           ----------------------------------------------------------------------
2dxcB           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------
3eitA           ----------------------------------------------------------------------
2cevA           ----------------------------------------------------------------------
3bbeA           ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
3eiqD           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
3dinA           ----------------------------------------------------------------------
3dkpA           ----------------------------------------------------------------------
3eiqA           ----------------------------------------------------------------------
3ddeA           ----------------------------------------------------------------------
3dmqA           ----------------------------------------------------------------------
3borA           ----------------------------------------------------------------------
1b47A           ----------------------------------------------------------------------
3berA           ----------------------------------------------------------------------
3dl8A           ----------------------------------------------------------------------
2b99A           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3ddeB           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3dwlD           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
3b6eA           ----------------------------------------------------------------------
2b2nA           EN--------------------------------------------------------------------
1a1vA           ----------------------------------------------------------------------
3dddA           ----------------------------------------------------------------------
2b2nB           EN--------------------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
2b98C           ----------------------------------------------------------------------
149lA           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
1ef0A           ----------------------------------------------------------------------
3e0jE           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
2c5uA           ----------------------------------------------------------------------
1e2bA           ----------------------------------------------------------------------
2bhrB           ----------------------------------------------------------------------
1dydA           ----------------------------------------------------------------------
1d2zB           ----------------------------------------------------------------------
1a16A           ----------------------------------------------------------------------
3bxzA           ----------------------------------------------------------------------
2bmfA           ----------------------------------------------------------------------
3cdrA           ----------------------------------------------------------------------
2bwsA           ----------------------------------------------------------------------
2dgdA           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------------------
1dfaA           ----------------------------------------------------------------------
1d9wA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bxzB           ----------------------------------------------------------------------
1cu1A           ----------------------------------------------------------------------
2ekdF           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
2dxcE           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
3e0jC           ----------------------------------------------------------------------
2bmfB           ----------------------------------------------------------------------
2dxcB           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------
3eitA           ----------------------------------------------------------------------
2cevA           ----------------------------------------------------------------------
3bbeA           ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
3eiqD           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
3dinA           ----------------------------------------------------------------------
3dkpA           ----------------------------------------------------------------------
3eiqA           ----------------------------------------------------------------------
3ddeA           ----------------------------------------------------------------------
3dmqA           ----------------------------------------------------------------------
3borA           ----------------------------------------------------------------------
1b47A           ----------------------------------------------------------------------
3berA           ----------------------------------------------------------------------
3dl8A           ----------------------------------------------------------------------
2b99A           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3ddeB           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3dwlD           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
3b6eA           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
1a1vA           ----------------------------------------------------------------------
3dddA           ----------------------------------------------------------------------
2b2nB           ----------------------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
2b98C           ----------------------------------------------------------------------
149lA           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
1ef0A           ----------------------------------------------------------------------
3e0jE           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
2c5uA           ----------------------------------------------------------------------
1e2bA           ----------------------------------------------------------------------
2bhrB           ----------------------------------------------------------------------
1dydA           ----------------------------------------------------------------------
1d2zB           ----------------------------------------------------------------------
1a16A           ----------------------------------------------------------------------
3bxzA           ----------------------------------------------------------------------
2bmfA           ----------------------------------------------------------------------
3cdrA           ----------------------------------------------------------------------
2bwsA           ----------------------------------------------------------------------
2dgdA           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------------------
1dfaA           ----------------------------------------------------------------------
1d9wA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQHGIGRYVEMVSRTIQGATRE
3bxzB           ----------------------------------------------------------------------
1cu1A           ----------------------------------------------------------------------
2ekdF           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
2dxcE           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
3e0jC           ----------------------------------------------------------------------
2bmfB           ----------------------------------------------------------------------
2dxcB           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------
3eitA           ----------------------------------------------------------------------
2cevA           ----------------------------------------------------------------------
3bbeA           ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
3eiqD           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
3dinA           ----------------------------------------------------------------------
3dkpA           ----------------------------------------------------------------------
3eiqA           ----------------------------------------------------------------------
3ddeA           ----------------------------------------------------------------------
3dmqA           -------------------------------------------------ELGLGTVVAVDARTVTGENRL
3borA           ----------------------------------------------------------------------
1b47A           ----------------------------------------------------------------------
3berA           ----------------------------------------------------------------------
3dl8A           ----------------------------------------------------------------------
2b99A           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3ddeB           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3dwlD           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
3b6eA           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
1a1vA           ----------------------------------------------------------------------
3dddA           ----------------------------------------------------------------------
2b2nB           ----------------------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
2b98C           ----------------------------------------------------------------------
149lA           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
1ef0A           ----------------------------------------------------------------------
3e0jE           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
2c5uA           ----------------------------------------------------------------------
1e2bA           ----------------------------------------------------------------------
2bhrB           ----------------------------------------------------------------------
1dydA           ----------------------------------------------------------------------
1d2zB           ----------------------------------------------------------------------
1a16A           ----------------------------------------------------------------------
3bxzA           ----------------------------------------------------------------------
2bmfA           ----------------------------------------------------------------------
3cdrA           ----------------------------------------------------------------------
2bwsA           ----------------------------------------------------------------------
2dgdA           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------------------
1dfaA           ----------------------------------------------------------------------
1d9wA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           YLVIEYAPSKRGQPGDRLFVPTDQLDEVTRYVGGDSPTLSKMGGSDWXXXXXXXXXXXXEIAGDLIRLYS
3bxzB           -------------------------------------------GSRNDRTLRRMRKVVNIIEPEMEKLSD
1cu1A           -------------------------------------------------------------SGHAVGIFR
2ekdF           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
2dxcE           -------------------------------------------------------------------IRE
1d9xA           ----------------------------------------------------------------------
3e0jC           ----------------------------------------------------------------------
2bmfB           ----------------------------------------------------------------------
2dxcB           -------------------------------------------------------------------IRE
2dxcH           ------------------------------------------------------------------SIRE
3eitA           ---------------------------------------------------------------VTLRKAT
2cevA           ----------------------------------------------------------------------
3bbeA           ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
3eiqD           ----------------------------------------------------------------------
2db3A           -----------------------------------------------------------NIPVKVTGSDV
3dinA           -----------------------------------------------------------RLSMVLKEKVN
3dkpA           -----------------------------------------------------------HVQGTDLPDPI
3eiqA           ----------------------------------------------------------------------
3ddeA           ----------------------------------------------------------------------
3dmqA           YARSDSPVTRVFNPGDTIVEEVKEENGLLTYIGTGVALREVFLDSKLVFSKPQDRLFAGQIDRDRFALRY
3borA           ----------------------------------------------------------------------
1b47A           ----------------------------------------------------------------------
3berA           ---------------------------------------------------------------EASQPIV
3dl8A           ---------------------------------------NKMFDPTKRTLNRYEKIANDAIRGDYENLSD
2b99A           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3ddeB           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3dwlD           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
3b6eA           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
1a1vA           ----------------------------------------------------------------------
3dddA           ----------------------------------------------------------------------
2b2nB           ----------------------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
2b98C           ----------------------------------------------------------------------
149lA           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
1ef0A           ----------------------------------------------------------------------
3e0jE           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
2c5uA           ----------------------------------------------------------------------
1e2bA           ----------------------------------------------------------------------
2bhrB           ----------------------------------------------------------------------
1dydA           ----------------------------------------------------------------------
1d2zB           ----------------------------------------------------------------------
1a16A           ----------------------------------------------------------------------
3bxzA           ----------------------------------------------------------------------
2bmfA           ----------------------------------------------------------------------
3cdrA           ----------------------------------------------------------------------
2bwsA           ----------------------------------------------------------------------
2dgdA           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------------------
1dfaA           ----------------------------------------------------------------------
1d9wA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           ARHASPGHAFSPDTPWQRELEDAFPYVETPDQLAAIEEVKRDMEKPVPMDRLICGDVGYGKTEVAVRAAF
3bxzB           EELKGKTAEFRARLEKGEVLENLIPEAFRHFDVQLLGGMVLNE------RCIAEMRTGEGKTLTATLPAY
1cu1A           -AAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSF-----QVAHLHAPTGSGKSTKVPAAYA
2ekdF           ---------------------------KFFKLFRVGETVLVEYSGTSRAELLLYYIVNNSKLPIVVDDIY
2ekdA           ---------------------------KFFKLFRVGETVLVEYSGTSRAELLLYYIVNNSKLPIVVDDIY
1d9zA           ----------------------------------------------------------------------
2dxcE           EVHRHLGTVALMQPALHQQTHAPAPTEITHTLFRAYTRVPHDV-GGEADVPIEYHEKEEEIWELNTFATC
1d9xA           ----------------------------------------------------------------------
3e0jC           -------------------------------------------------HHGMFSEQAAQRAHTLLSPPS
2bmfB           ----------------------------EDNPEIEDDIFRK------KRLTIMDLHPGAGKTKRYLPAIV
2dxcB           EVHRHLGTVALMQPALHQQTHAPAPTEITHTLFRAYTRVPHDV-GGEADVPIEYHEKEEEIWELNTFATC
2dxcH           EVHRHLGTVALMQPALHQQTHAPAPTEITHTLFRAYTRVPHDV-GGEADVPIEYHEFATCECLAWRGVWT
3eitA           LASLQSLSGESSNRVWNDRYDTLLIARDPREIKNAIEKSVTDFGGLENYKELTGGADPFALTPVGLSANN
2cevA           -----------------------------------------------------------GVIERLERLHY
3bbeA           ----------------------------------------------------------------------
1cevA           -----------------------------------------------------------GVIERLERLHY
3eiqD           -EIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKG------YDVIAQAQSGTGKTATSILQQI
2db3A           PQPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISS------GRDLMACAQTGSGKTAAFLLPIL
3dinA           SFEDADEHLFEAFALVREAARRTLG--MRPFDVQVMGGIALHE------GKVAEMKTGEGKTLAATMPIY
3dkpA           ATFQQLDQEYKINSRLLQNILDAGFQMPTPIQMQAIPVMLH------GRELLASAPTGSGKTLAFSMQLK
3eiqA           -EIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYD------VIAQAQSGTGKTATFAISIL
3ddeA           ----------------------------------------------------------------------
3dmqA           RARKYSSEQFRPYSGLRGQRTSLIPH-----QLNIA----HDVGRRHAPRVLLADEVGLGKTIEAGILHQ
3borA           -------DDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYD---VIAQAQSGTGKTATFAISILQQL
1b47A           ---------------------------------------------------------VDKKMVEKCWKLM
3berA           EEEETKTKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRD------IIGLAETGSGKTGAFALPIL
3dl8A           DALKHKTIEFKERLEKGATTDDLLVEAMFPFKVQLMGGVAL------HDGNIAEMKTGEGKTLTSTLPVY
2b99A           ----------------------------------------------------------------------
3cpeA           --RDDIVYFAETYCAITHIDYGVIKVQLRDYQRDMLKIMSSKR------MTVCNLSRQLGKTTVVAIFLA
3eaqA           ----------------------------------------------------------------------
3ddeB           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1dhsA           ------------------------PAGALAAVLKHSSTLPPES------TQVRGYDFNRGVNYRALLEAF
2d7dA           ------------------RFELVSKYQPQGDQPKAIEKLVKGIQEGK-KHQTLLGATGTGKTFTVSNLIK
3dwlD           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
3b6eA           ------------EENVAARASPEPELQLRPYQMEVAQPALEGK------NIIICLPTGSGKTRVAVYIAK
2b2nA           ----------------------------------------------------------------------
1a1vA           ------------------------------------------------QVAHLHAPTGSGKSTKVP---A
3dddA           ----------------------------------------------------------------------
2b2nB           ----------------------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
1c4oA           ------------------------GPSPKGDQPKAIAGLVEA------LRDGERFVTLLGATGTGKTMAK
3easA           ----------------------------------------------------------------------
2b98C           ----------------------------------------------------------------------
149lA           ----------------------------------------------------------------------
3crvA           -------------------------VKLRDWQEKLKDKVIEGLRN--NFLVALNAPTGSGKTLF---SLL
1ef0A           ----------------------------------------------------------------------
3e0jE           --------------------------------------------------QAAQRAHTLLSPPSANNATF
2csdA           ---------------------------DVALCLARAFDGSISMIATTPYRTLKCPDLTLEEAKSVNRT--
2c5uA           -------------------------------NNLELCKDSQRK------FFYSDDVSASGRTYRIFSYNY
1e2bA           -------SSAGMSTSLLVSKMRAQAEKYVPVIIEAFPETLAGEK------GQNADVVLLGPQIAYMLPEI
2bhrB           ----------------------------EDNPEIEDDIFRKKR------LTIMDLHPGAGKTKRYLPAIV
1dydA           ----------------------------------------------------------------------
1d2zB           ----------------------------------------------------------------------
1a16A           ----------------------------------------------------------------------
3bxzA           ----------------------------------------------------------------------
2bmfA           ----------------------------------------------------------------------
3cdrA           ----------------------------------------------------------------------
2bwsA           ----------------------------------------------------------------------
2dgdA           ---------------------------------------------------------IKDVVIPEESVYE
2bwwA           ----------------------------------------------------------------------
1dfaA           ----------------------------------------------------------------------
1d9wA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
1d9zA           ----------------EGRFQLVAPYEPQGDQPQAIAKLVDGLRRGVK-HQTLLGATGTGKTFTI--SNV
1d9xA           ----------------EGRFQLVAPYEPQGDQPQAIAKLVDGLRRG-VKHQTLLGATGTGKTFTI--SNV
1d2mA           ----------------------YRGPSPKGDQPKAIAGLVEALRDG-ERFVTLLGATGTGKTVTMAKVIE


                         .         .         .         .         +         .         .:770
query           KAVQDGKQVAVLVPTTLLVQQHLSTFTERYASFPVTVRPLSRFQSDAEIERIREGMRTGEVDVVIGTHRL
3bxzB           LNALTGKGVHVVTVNDYLAQRDAENNRPLFEFLGLTVGINLPGMPAPAKREAYAADITYGTNNEYGFDYL
1cu1A           ---AQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPV-------------TYSTYGKF
2ekdF           YEFYTRLKVAGFDVAPLENVQVIKGGTKDIGRVIGRLNISKYVISEQEYEIVSQLKDYPVINPVLGLHKL
2ekdA           YEFYTRLKVAGFDVAPLENVQVIKGGTKDIGRVIGRLNISKYVISEQEYEIVSQLKDYPVINPVLGLHKL
1d9zA           ----------------------------------------------------------------------
2dxcE           ECLAWRKQNCDVGQTVYLGMPYYGRWLLTAARILVDKQFVTLTELHNKIVEMRERVASGQGLGEYLP---
1d9xA           ----------------------------------------------------------------------
3e0jC           ANNATFARV-PVATYTNSSQPFRLIYATRLIQMPFLENRAQQHWGSGVGVKKLCELQPEEKCCVVGTLFK
2bmfB           REAKRGLRTLILAPTRVVAAEMEEALRG-------------LPIRYQTGREIVDLMCHATFTMRLLSPIR
2dxcB           ECLAWRKQNCDVGQTVYLGMPYYGRWLLTAARILVDKQFVTLTELHNKIVEMRERVASGQGLGEYLP---
2dxcH           AEERRRKQNCDVGQTVYLGMPYYGRWLLTAARILVDKQFVTLTELHNKIVEMRERVASG-----QGLGEY
3eitA           IFKLTEKDVPIDPTSIE--YLENTSFAEHVNTLDSHKNYVVIVNDGRLGHKFLIDLPARTAYIIQLGGGA
2cevA           DIEDLGDIPIGKAERLHEQGDSRLRNLKAVAE---ANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAG
3bbeA           ----------------------------------------------------------SALELIPEEIKN
1cevA           DIEDLGDIPIGKAERLHEQGDSRLRNLKAVAE---ANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAG
3eiqD           ELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNRAEVQKLQMEAPHGRVFDMLNRRYL
2db3A           SKLLERPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLDFV
3dinA           LNALIGKGVHLVTVNDYLARRDALWMGPVYLFLGLRVGVINSLGKSYEVVWKNPDLARKAIEENWSVWPD
3dkpA           QPANKGFRALIISPTRELASQIHRELIKISEGTGFRIHMIVAAKKFGPKSSKKFDILVTTPNRLIYLLKQ
3eiqA           QQIELDTQALVLAPTRELAQQIQKVVMALGDYMGASCHA---CIGGTNVRAEVQKLQMEAPHIIVGRRYL
3ddeA           -----------------------------------------------------HEVLDGKATKYTETYHY
3dmqA           QLLSGAAERVLIIVPETLQHQWLVELRRFNLRFALFDDERYAEAQHDAYNPFDTEQLVICSLDFARRSKQ
3borA           EIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGEAPHIVV------GTPGRVFDMLNRRYL
1b47A           DKCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKK-TKQTISLFKEG
3berA           NALLERLFALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGGIDSMSQSLALAKKPHIIIATRLIDHLE
3dl8A           LNALTGKGVHVVTVNEYLASRDAEQMGKIFEFLGLTVGNLNSMSKDEKREAYAADITYSTNNELGFDMVL
2b99A           ----------------------------------------------------------------------
3cpeA           HFVCFNKDKAILAHKGSMSAEVLDRTKQAIELLPDFLQPGIVEWNK---GSIELDNGSSIGAYASSPDAV
3eaqA           ----------------------------------------------------------------------
3ddeB           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1dhsA           -GTTGFQATNFGRAVQQVNAMIEKKLEPLTSCTIFLGYT-SNLISSGIRETIRYLVQHNMVDVLVTTAGG
2d7dA           ---EVNKPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEIDK
3dwlD           -----------------------------YNNIFIYELLTERFSSENQVVTDFDG-----VTFHISTPTK
1d2mA           ----------------------------------------------------------------------
3b6eA           DHLDKKKKVIVLVNKVLLVEQLFRKEFQPFLKKWYRVIGLSGLK---ISFPEVVKSCDIIISTAQILENS
2b2nA           ----------------------------------------------------------------------
1a1vA           AYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFL---ADGGSGGAY
3dddA           ------------------------------AYNFPGPRESVKSSFEISLEVQPDGCLLAFLKEPVGGCIF
2b2nB           ----------------------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
1c4oA           VIEALGRPALVLAPNKILAAQLAAEFRELFPENAVEYFISYYDYYQPEAYVPGKDLYIEKDVIVVASVSA
3easA           ----------------------------------------------------------------------
2b98C           ----------------------------------------------------------------------
149lA           ----------------------------------------------------------------------
3crvA           VSLEVKPKVLFVVRTHNEFYPIYRDLTKIREKRNITFSFLVGKPSSCLYAEKGAESEDIPCKYCELKGSI
1ef0A           ----------------------------------------------------------------------
3e0jE           ARVPVATYT--------NSSQPFRLYATRLIQMPFLENRAQQHWGSVGVKKLCELQPE-EKCCVVGTLFK
2csdA           ----LATLIDEHGLSPDAADELIEHFESIAGILATDLEEIERMEGRLSEEAYRA-------AVEIQLAEL
2c5uA           LPDALECRGIFEDGEPVRIASRPEKFFNLNENPFTNIDLNDVDY---ILTKEDGSLVSTYLDGDEILFKS
1e2bA           QRL-LPNKPVEVIDSLLYGKVD------------------------------------------------
2bhrB           REAIKRGLTLILAPTRVVAAEMEEALRGLPIRYQREIVDLMCHATFTMRLLSPIRVPNYN-------LII
1dydA           ----------------------------------------------------------------------
1d2zB           ----------------------------------------------------------------------
1a16A           ----------------------------------------------------------------------
3bxzA           ----------------------------------------------------------------------
2bmfA           ----------------------------------------------------------------------
3cdrA           ----------------------------------------------------------------------
2bwsA           ----------------------------------------------------------------------
2dgdA           LLKKLNVRKLWIGTPYIKERTL--EEVEWWRNKGFEIVGYDGLGK---IRGIDISNTPIFTIYRLVKRHL
2bwwA           ----------------------------------------------------------------------
1dfaA           ----------------------------------------------------------------------
1d9wA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
1d9zA           IA-QVNKPTLVIAHNKTLAGQLYSELKE------------------------------------------
1d9xA           IA-QVNKPTLVIAHNKTLAGQLYSELKE------------------------------------------
1d2mA           ---ALGRPALVLAPNKILAAQLAAEFRELFPENAVEYFISYYDYY--QPEAYVPGK-----DLYIEKDA-


                         .         .         *         .         .         .         .:840
query           LSPETQFKDLGLVIIDEEQRFGVEHKEALKRLRTQVDVLSMSATPIPRTLEMGLTGIREMTTILTPPEER
3bxzB           RDNMAFSPESILIDEARTPLIILASITFQNYFRLYEKLAGMTGTADTEAFEFSSIYKLDTVVVPTNRPMI
1cu1A           LADGGCSGGAYDIIICDECHSTDST--------TILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPN
2ekdF           ILLGNTFENINVVKVSNY----VGREERIAFYFVNRNVIEKHSSPILDLLEEVVTSILEIT---------
2ekdA           ILLGNTFENINVVKVSNYVG----REERIAFYFVNRNVIEKHSSPILDLLEEVVTSILEIT---------
1d9zA           --------------------------------QKINQIIYVSATPGPYELEHSPGVVEQIIRPTGLLDPT
2dxcE           ----------------------------------------------------------------------
1d9xA           --------------------------------QKINQIIYVSATPGPYELEHSPGVVEQIIRPTGLLDPT
3e0jC           AMSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLD
2bmfB           VPNYNLIIMDEAHFTDPASIAARGYISTRVEMGEAAGIFMTATPPGSRDPFPQSNAPIMDEEREIPERSW
2dxcB           ----------------------------------------------------------------------
2dxcH           LPPKAK----------------------------------------------------------------
3eitA           LPAVRVEDWIS----RRGSDPVSLDELNQLLSKDFSKPDDVQTRLLASILQIDKDPHKVDIKKLHLDGKL
2cevA           VA--KHYERLGVIWYDAHGDVNTAETSASLGFGHPALTQIGGYSPKIKPEHVVLIGVRSLDEGEKKFIRE
3bbeA           KIRKSRVYKYDILDSNYHYKAMEKLKDKEMRGRPDIINILDSPINHEKKLNIYIHTYDDKVLKINPETRL
1cevA           VAK--HYERLGVIWYDAHGDVNTAETSASLGFGHPALTQIGGYSPKIKPEHVVLIGVRSLDEGEKKFIRE
3eiqD           SPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKRDPIRILVKKEELTL
2db3A           DRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFV
3dinA           GF-NGEVLKEESMNKEAVEAFQVELKEITRKEAYLCDVTYGTNNEFGFDYLR-------DNLVLDYNDKV
3dkpA           DPPGIDLASVEWLVVDESDKLFELASIFLACTSHKVRRAMFSATFAYDVEQWCKLNLDNVISV-------
3eiqA           SPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRIKKEELTL
3ddeA           TKHNAKNQALVGIGKDLPGKYLSFCFH---------HAHEEAGHELALSDIASIGFDREDVLSSKPLPAT
3dmqA           RLEHLCEAEWDLLVVDEAHHLVWSEDAPSREYQAVPGVLLLTATPEQLGESH------------------
3borA           SPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRIL------
1b47A           KERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKSFR
3berA           NTKGFNLRALKYLVMDEADRFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKNPVKCAV-----
3dl8A           YKEQMVQRPLHFAVIDEVDSILIDEARTPLII------------------------------IPTNRPVV
2b99A           ----------------------------------------------------------------------
3cpeA           RGNSFAMIYIEDCAFIPNFHDSWLAIQPVISSGRRSKIIITTTPNGLNHFYDIWTAAVEGKSGFEPYTAI
3eaqA           ----------------------------------------------------------------------
3ddeB           ---------------------------------------------------ASIGFDREDVLSSKPLPAT
3eaqB           ----------------------------------------------------------------------
1dhsA           VE-EDLIKCLAPTYLGEFSLRGKELRENGINRIGNLLVPNENYCKFEDWLMPILDQMVMEQNTEGVKWTP
2d7dA           LRHSATSALFDVIIIASVSCIYGLGSPEEYREMVVSLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFR
3dwlD           ILISELVNYGTLDLLKQNFSILIDLQQLPADEEKEQLAMSISMLKRNVLAAPFHRAFTKQAELAPMLDKQ
1d2mA           -------------------------------------------------------------IIRPTGLLD
3b6eA           LLNGVQLSDFSLIIIDECVYNNIRHYLMQKLKNNRLKKENKPVIPLPQILGL------------------
2b2nA           ----------------------------------------------------------------------
1a1vA           DIIICDECHSTDATSILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSTTGEIPFYGKAI
3dddA           FYNKQAWIGLG---VKKAYQRRGIGTEVFRRLRRKVDTIRLDASSQGYGLYKKFKFVDEYRTVRYELERP
2b2nB           ----------------------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
1c4oA           IYGEYRARNLVGFVLFPATHYGLE--EILKEIEKEL----------------------------------
3easA           ----------------------------------------------------------------------
2b98C           ----------------------------------------------------------------------
149lA           ----------------------------------------------------------------------
3crvA           VEVKTLSLVKKLKKDGLQDKFCPYYSLLNSLYKADVIALTYPYFFIDRYREFIDIDLREYMIVIDEAHNL
1ef0A           ----------------------------------------------------------------------
3e0jE           AMSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLV-----EDYCFADLAPQKP
2csdA           TKKEGVGRKTAERLLRA-----FGNPERVKQLAREFEIEKLASVEVGERVLRSLVPGYASLISIRGIDRE
2c5uA           KGSIKSEQALANGILNINHHRLFTANFEFVAPTNRIVLAYQEKIILLNVRENETGEYISYDDIYKDATLR
1e2bA           ----------------------------------------------------------------------
2bhrB           MDEAHFTDPASIAARGYISTRVEMGEAAGIFMTATPPGSRDPFPQSNAPIMDEEREIPERSWNSGHEWVT
1dydA           ----------------------------------------------------------------------
1d2zB           ----------------------------------------------------------------------
1a16A           ----------------------------------------------------------------------
3bxzA           ----------------------------------------------------------------------
2bmfA           ----------------------------------------------------------------------
3cdrA           ----------------------------------------------------------------------
2bwsA           ----------------------------------------------------------------------
2dgdA           NEVLKAIACTALSTYEAVQYDLDPVVSENAAAWEALNKLKIKAK--------------------------
2bwwA           ----------------------------------------------------------------------
1dfaA           ----------------------------------------------------------------------
1d9wA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
1d2mA           ------------SINPEIERLRHSTTRSLLTRRDVIVVASVSAIY-------------------------


                         +         .         .         .         .         *         .:910
query           HPVLTFVGPYDEKQIAAAIRRELMREGQVFFVHNRVASIERAAATVSRLVPEARVAWAHGQMNEHQLERV
3bxzB           RKDLPDLVYMTEAEKIQAIIEDIKERTAKGQPVLVGTISIEKSELVSNELTKAKHNVLNAKFHANEAAIV
1cu1A           IEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGL--GINAVAYYRGLDVSVIPTI
2ekdF           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------
1d9zA           IDVRPTKGQIDD--LIGEIRERVERNERTLVTTLTKKMAEDLTDYLKEAGI--KVAYLHSEIKTLERIEI
2dxcE           ----------------------------------------------------------------------
1d9xA           IDVRPTKGQIDD--LIGEIRERVERNERTLVTTLTKKMAEDLTDYLKEAGI--KVAYLHSEIKTLERIEI
3e0jC           TDR-------------------------------------------------------------------
2bmfB           NSGHEWVTDFKGKTVWFVPSIKAGNDIAACLRKNGKKVIQLSRKTFDSEYIKTRTNDWDFVVTTDISEM-
2dxcB           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------
3eitA           RFASHEYDFRQF--QRNAQYVAGL----------------------------------------------
2cevA           KGIKIYVDRLGMTRVMEETIAYLKERTDGVHLSLDVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEV
3bbeA           PRNYFFLGVMEKVLKGERNHLIKMEEKTLEDLLNELTHPKLLKEYDTFIIGGFPYGKLKINKEKVFGDIK
1cevA           KGIKIYVDRLGMTRVMEETIAYLKERTDGVHLSLDLDGLDPSDAPGVGTP-------VIGGLTYRESHLA
3eiqD           EGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKM-------HARDFTVSAMDMDQ
2db3A           AIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSEQADGTKRGADFLASFLSEKPTTSIHGDRLQSQREQA
3dinA           QRGHFYA------IVDEADSVLIDEARTPLIISGPSKESPSVYRRFAQIA--------------------
3dkpA           ----------------------------------------------------------------------
3eiqA           EGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWL-------TEKMHARDFTVSAMMDQK
3ddeA           ETLIAYLYWI------SATGNPVQRLGYSYWAENVYGYIDPVLKAIQSTTPQSKFFIAHSKIDAKHAEEV
3dmqA           ------------------------------------------------------AVFHEGSIIERDRAAA
3borA           ----------------------------------------------------------------------
1b47A           QALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSHPGYMAFLTYDEVKAR
3berA           ----------------------------------------------------------------------
3dl8A           RDDRPDLIYRTMEGKFKAVAEDVAQRYMTGQPVLVGTVAVETSELISKLLKNKGIPHQVLNAKNHEREAQ
2b99A           --VGIVDTTFARVDMASIAIKKLKELSNIKIIRKTVPGIKDLPVACKKLLEEEGIVMALGMPGKAEKDKV
3cpeA           WSVKERLYNDEDIFDDGWQWSIQTINGSSLAQFRQEHTAAFEGTSGTLISGMKLAVMDFIEVTPDDHGFH
3eaqA           -TYEEEAVPAPVRGRLEVLSDLLASPDRAMVFTRTKAETEEIAQGLLRLGHPAQALH--GDLSQGERERV
3ddeB           ETLIAYLYWI------SATGNPVQRLGYSYWAENVYGYIDPVLKAIQSLTPQSKFFIAHSKIDAKHAEEV
3eaqB           -TYEEEAVPAPVRGRLEVLSDLLASPDRAMVFTRTKAETEEIAQGLLR--LGHPAQALHGDLSQGERERV
1dhsA           SKMIARLGKEINNPE------SVYYWAQKNHIPVFSPALTDGSLGDMIFFHSYKNPGLVLDIVEDLRLIN
2d7dA           V---------------------------------------------------------------------
3dwlD           ATSQELMAIHYRDEETIVLWPEHDRVTVVFSTKFR-----EETDRIFGKVFLQEFVDARRTAPQVLFSYR
1d2mA           PLVRVKPTENQILDLMEGIRERAARGERTLVTVLTVRMAEELTSFLVEHGI--RARYLHHELDAFKRQAL
3b6eA           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
1a1vA           PLEVIKGGRHLIFCHSKKKCDELAAKLVALGIN-----------------------AVAYYRGLDVSVIP
3dddA           IK------RVEGVVEVNKIPNWVKEIDKKAFGDDRIRVLEAYRRGARLLCAENEGFGLVYRGKIGP--LV
2b2nB           ----------------------------------------------------------------------
2bhrA           ----------------------------------------------------------EYRLRGEARKTF
3earA           ----EEAVPAPVRGRLEVLSDLLASPDRAMVFTRTKAETEEIAQGLLRLGH--PAQALHGDLSQGERERV
1c4oA           ------------LDLMEGIRERAARGERTLVTVLTVRMAEELTSFLVEHGI--RARYLHHELDAFKRQAL
3easA           ----------PVRGRLEVLSDLLASPDRAMVFTRTKAETEEIAQGLLRLGHPAQALH--GDLSQGERERV
2b98C           --VGIVDTTFARVDMASIAIKKLKELSPRKTVPGIKDLPVACKKLLEEEGCDIVMALGMPGKAEKD----
149lA           -----------------------------------------------------SLNAAKSELDKAIGRNC
3crvA           DKVNELEERSLSEITIQMAIKQSKS----EESRRILSKLLNQLREV------------VLPDEKYIKVEN
1ef0A           ----------------------------------------------------------------------
3e0jE           APPLD-----------------------------------------------------------------
2csdA           RAERLLKKYGGYSKVREAGVEELREDGLTDAQIRELKGL-------------------------------
2c5uA           PYLVERYEIDSPKWIEEAKNAENIEGYVAVKDGSHFKIKSDWYVSLHSTKSLDNPEKLFKTIIDGASDDL
1e2bA           ----------------------------------------------------------------------
2bhrB           DFKGKTVWFVPSIKAGNDIAACLRKNGKKVIQLS------------RKTFDSEYIKTRTNDWDFV----V
1dydA           ------------------------------------------------------LNAAKSELDKAIGRNC
1d2zB           ----------------------------------------------------------------------
1a16A           ----------------------------------------------------------SRQEFQRRRQAL
3bxzA           -------------------------------------------------IATNMAGRGTDIVLGGSWQAE
2bmfA           ----------------------------------------------------------VIQLSRKTFDSE
3cdrA           -----------------------------------------------------SLNAAKSELDKAIGRNC
2bwsA           ----------------------------------------------------------SRQEFQRRRQAL
2dgdA           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------SRQEFQRRRQAL
1dfaA           ----------------------------------------------------------------------
1d9wA           -----------------------------------------------------SLNAAKSELDKAIGRNC
3buwB           -----------------------------------------------------THPGYMAFLTYDEVKAR
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           MVDFWEKKFDVLVCTTIVESGLDVPNANTLIVDRADTYGLAQLHQLRGRVGRGRERAYAYFLYPPDKPLT
3bxzB           AQAGYPAAVTIATNMAGRGTDIVLGGSWQAEVAALENPTAEQIEKIKADWQVRHDAVLEAGGLHIERHRR
1cu1A           GDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPIETTTVPQDAVSRSQRRPGERPSGMFDSSVL
2ekdF           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------
1d9zA           IRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFRSLIQTIGRAARNANGHVIMYADTITKSME
2dxcE           ----------------------------------------------------------------------
1d9xA           IRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFRSLIQTIGRAARNANGHVIMYADTITKSME
3e0jC           ----------------------------------------------------------------------
2bmfB           --GANFKAERVIDPRRCMKPVILTDGEERVILAGPMPVTHSSAAQRRGRVGRNPKNENDQYIYGEPLEND
2dxcB           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------
3eitA           ----------------------------------------------------------------------
2cevA           NPILDERNKTASVAVALMGS--------------------------------------------------
3bbeA           EISIYNKGLMAWTVCGIICYSLS-----------------------------------------------
1cevA           MEML--AEAQIITSAEFVERNKTASVAVALMGS-------------------------------------
3eiqD           KERDVIMREFVLITTDLLARGIDVQQVSLVINYDLPT-NRENYIHRIGRGGRFGRKGVAINMVTEDKRTL
2db3A           LRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVIGRTGRVGNNGR-ATSFFDPEKDRAIA
3dinA           ----------------------------------------------------------------------
3dkpA           ----------------------------------------------------------------------
3eiqA           ERDVIMREFRSGVLITTDLLAIDVQQVSLVINYDLPTNRENYIHRIGRGVAINMVTEEDKRTLRDIETFY
3ddeA           N-----------ELHEVCKTQEDVD----SVVAVENSLVLT--ARILDDVW----KEYQLFQSGASDRYA
3dmqA           WFAEEDTGAQVLLCSEIGSEGRNFQFASHVFDLPFNPDLLEQRIGRLDRIGQAH-DIQIHVPYLEKTAQ-
3borA           ----------------------------------------------------------------------
1b47A           LQKFIHKPGSYIFCTRLGQWAIGYVTADGNIL--QTIPHNKPLFQALIDGFREGFYLFPDG---------
3berA           ----------------------------------------------------------------------
3dl8A           IIEEAGQKGAVTIATNMAGRGTDVKELGGLAVVGTERESRRIDNQLRGRSGRQGDPGITQFYLSMDELMR
2b99A           C----AHEASLGLMLAQLMTNKHIIE---VFVHEDEAKDDKELDWLAKRRAEEHAEN-VYYLLFKPEYLT
3cpeA           QFKKPEPDRKYIATLDCSEGRGQDYHALHIIDVHSNTISHLILPDIVMRYLVEYNECPVYIELNSTGVLY
3eaqA           LGAFRQGEVRVLVATDVAARGLDIPQVDLVVHYRLP-DRAEAYQHRSGRTGRAGGRVVLLYGPRERRDVE
3ddeB           N-----------ELHEVCKTQEDVDS----VVAVENSLVLTA--RILDDVW----KEYQLFQSGASD---
3eaqB           LGAFRQGEVRVLVATDVAARGLDIPQVDLVVHYRLPDRAEAYQHR-SGRTGRAGRGGRVVLLYGPRERRD
1dhsA           TQAIFAKCTGMIIL------GGGVVKHHIANANLMR--NGADYAVYINTAQEFDGSDSGARPD--EAVSW
2d7dA           ----------------------------------------------------------------------
3dwlD           DPPLEIRDIQFGVTFVLFERHFTPQNREDCISHIQVF---RNTLHFHIKASKAYMHQRMRKRVADFQKVL
1d2mA           IRDLRLGHYDCLVGINLLREGLDIPEVSLVAILDADKEGERSLIQTIGRAARNARGEVWLYADRVSEAMQ
3b6eA           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
1a1vA           TSGDVVVVATDALFTGDFDSVIDCNTVT-QTVDFSLDPTFTIETTTLPQDAVSRTQRRG------RTGRG
3dddA           ADSPRVAEKILLKAFQLGAREIIIPEVNKDALELIKIFKPSQVTS-CRRLGSKIEEKVDI----------
2b2nB           ----------------------------------------------------------------------
2bhrA           VDLMRRGDLPVWLAYRVAAEGINYADRRWCFDGVKNN-QILEENVEVEIWTKEGERKKLKPRWLDAR---
3earA           LGAFRQGEVRVLVATDVAARGLDIPQVDLVVHYRLPDRAEAYQHR-SGRTGRGGRVVLLYGPRERRD---
1c4oA           IRDLRLGHYDCLVGINLLREGLDIPEVSLVAILDADLRSERSLIQTIGRAARNARGEVWLYADRVSEAMQ
3easA           LGAFRQGEVRVLVATDVAARGLDIPQVDLVVHYRLPDRAEAYQHR-SGRTGRARGGRVVLLYGPRERRDV
2b98C           --KVCAHEASLGLMLAQLMTNKHII---EVFVHEDEAKDDKELDWLAKRRAEEHAEN-VYYLLFKPEYLT
149lA           NGVITKDEAEKLFNQDVDAAVRGILRNAKLKPDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRW
3crvA           VPKLSKEELEILADD-------------------------------------------------------
1ef0A           ----------------------------------------------------------------------
3e0jE           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
2c5uA           KAYADD-------EYSYRKIEAFETTYL-KYLDRALFLVLDCHNKHCGKDRKTYAEAQGVAKGAGDHLF-
1e2bA           ----------------------------------------------------------------------
2bhrB           TTDISEMGANFKAERVIDPRRCMVILEERVILAGPMPVTHSSAAQRRGRVGRNPKNENDQYIYMG-----
1dydA           NGVITKDEAEKLFNQDVDAAVRGILRNAKLKPDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRW
1d2zB           ----------------------------------------------------------------------
1a16A           VEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTA
3bxzA           V-AALENPTAEQIEKIKADWQVRHDAVLEAGGLHIIGTERRIDNQLRGRSGRQGDAGSSRFYLSMEDAL-
2bmfA           YIKTRTNDWDFVVTTDISEMGANFKAEERVILAGPMPVTHSSAAQRRGRVGRNPKNENDQYIYMGEPLEN
3cdrA           NGVITKDEAEKLFNQDVILRNAKLKPV-YDSLDAVRQCALINMVFQMGETGVAGFTNSLRMLQQKR----
2bwsA           VEQMQPGSAALIFAAPEVTRSADSEY--------------------------------------------
2dgdA           ----------------------------------------------------------------------
2bwwA           VEQMQPGSAALIFAAPEVTRSADSEY--------------------------------------------
1dfaA           ----------------------------------------------------------------------
1d9wA           NGVITKDEAEKLFNQDVILRNAKLKPVYDSLAVRRCA--LINMVFQMGETGVAGFTNSLRMLQQDR----
3buwB           LQKFIHKPGSYIFRLSCTRLGIGYVTADGNIL--QTIPHNKPLFQALIDGFRGF---YLFPD--------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           ETAHERLATVAQHTESGAGMYVAMKDLEIRGAGNILGTEQSGSIAGVGFDLYVRMVGEAVRELKGDQSAA
3bxzB           IDNQLRGRSGRQGDAGSSRFYLSMEDALMR----------------------------------------
1cu1A           CECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQ--AGDNFPY
2ekdF           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------
1d9zA           IAETKRRRAIQEEYNRKHGIVPRTVKKEIRD---------------------------------------
2dxcE           ----------------------------------------------------------------------
1d9xA           IAETKRRRAIQEEYNRKHGIVPRTVKKEIRD---------------------------------------
3e0jC           ----------------------------------------------------------------------
2bmfB           EDHWKEAKMLLDNINTPEGIIPSMFEPEREKVDAIDGEYRL-------RGEARKTFVDLMRRGDLPVWLA
2dxcB           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------
3eitA           ----------------------------------------------------------------------
2cevA           ----------------------------------------------------------------------
3bbeA           ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
3eiqD           RDIETFY---------------------------------------------------------------
2db3A           ADLVKIL---------------------------------------------------------------
3dinA           ----------------------------------------------------------------------
3dkpA           ----------------------------------------------------------------------
3eiqA           NTSIEEM---------------------------------------------------------------
3ddeA           ----------------------------------------------------------------------
3dmqA           ----SVLVRWYHEGLDAFEHTCPTGRTIYDSVYNDLINYLASPDQTEGFDDLIKNCREQHEALKAQLEQG
3borA           ----------------------------------------------------------------------
1b47A           ----------------------------------------------------------------------
3berA           ----------------------------------------------------------------------
3dl8A           RFGAERTMAMLDRFGMDDSTPIQSKMVSRAVESSQKRVEGNNFDSRKQLLQYDDVLRQQREVIYKQRFEV
2b99A           RMAGKGL---------------------------------------------------------------
3cpeA           MDLEYEGVICDSYTDLGMKQTKRTKAVGCSTLKDLI---EKDKLIIHHRATIQEFRTFSEKGVSWAAEEG
3eaqA           ALERAVGRRFKRVNPPTPEEVLEAKWRHLLARLARVPEKDYRLYQDFAGRLFAEGRVEVVAAL-------
3ddeB           ----------------------------------------------------------------------
3eaqB           VEALERAVGRRFKRVNPPTPEEVLEAKWRHLLARLARVPEK------DYRLYQDFAGRLFAEGRVEVVAA
1dhsA           GKIRVDAQPVKVYAD--ASLVFPLLVAETFAQK-------------------------------------
2d7dA           ----------------------------------------------------------------------
3dwlD           NRAKPD----------------------------------------------------------------
1d2mA           RAIEETN---------------------------------------------------------------
3b6eA           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
1a1vA           KPGIYRFVAPGERP---SGMFDSSVLCECYDAGAWYELTPAETTVRLRAYMNTPGLPVCQDHLEFWEGVF
3dddA           ----------------------------------------------------------------------
2b2nB           ----------------------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
3earA           VEALERAV--------------------------------------------------------------
1c4oA           RAIEETN---------------------------------------------------------------
3easA           EALERAVG--------------------------------------------------------------
2b98C           RMAGKGLR--------------------------------------------------------------
149lA           DEAAVNLAKSRWYNQTP----NRAKRVITTFRTGTWD---------------------------------
3crvA           ----------------------------------------------------------------------
1ef0A           ----------------------------------------------------------------------
3e0jE           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
2c5uA           ----------------------------------------------------------------------
1e2bA           ----------------------------------------------------------------------
2bhrB           ----------------------------------------------------------------------
1dydA           DEAALNL---------------------------------------------------------------
1d2zB           ----------------------------------------------------------------------
1a16A           EIWFGRRLGQDAA---------------------------------------------------------
3bxzA           ----------------------------------------------------------------------
2bmfA           DEDWKEAKMLLDNINTPEGIIPSMFEPEREKVDAIDGEYRL-------RGEARKTFVDLMRRGDLPVWLA
3cdrA           ----------------------------------------------------------------------
2bwsA           ----------------------------------------------------------------------
2dgdA           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------------------
1dfaA           ----------------------------------------------------------------------
1d9wA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           QEVETKVELPINAHIPHDYVPGERLRLEAYRRIAEVASEDDIAAIREELLDRYGEPPQPVDNLLAVARFR
3bxzB           ----------------------------------------------------------------------
1cu1A           LVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGP--TPLLYRLGAVQNEVTLTHPI-TKYIMAC----
2ekdF           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
2dxcE           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
3e0jC           ----------------------------------------------------------------------
2bmfB           YRVAAEGINYADRRWCFDGVKNNQILEENVEVEIWTKEGERKKLKPRWLDARIYSDPLALKEFKEFAAGR
2dxcB           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------
3eitA           ----------------------------------------------------------------------
2cevA           ----------------------------------------------------------------------
3bbeA           ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
3eiqD           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
3dinA           ----------------------------------------------------------------------
3dkpA           ----------------------------------------------------------------------
3eiqA           ----------------------------------------------------------------------
3ddeA           ----------------------------------------------------------------------
3dmqA           RDRLLEIHSNGGEKAQ-----------ALAESIEEQDDDTNLIAF-ANLFDIIGINQDDRGDNIVLTPSD
3borA           ----------------------------------------------------------------------
1b47A           ----------------------------------------------------------------------
3berA           ----------------------------------------------------------------------
3dl8A           IDSKSSLERAIAAYTPREELPEEWKLDGLVDLINTTYLDEGADEMLELIMDRIITKYNEKEEQFGKEQMR
2b99A           ----------------------------------------------------------------------
3cpeA           YHDDLVMSLVIFGWLSTQSKFID-----------------------------------------------
3eaqA           ----------------------------------------------------------------------
3ddeB           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3dwlD           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
3b6eA           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
1a1vA           TGLTHIDAHFLSQTGENFPYLVAYQATVCARAQAPPPSWDQMWK---CLIRLKPTLHGPTPLLYRLGAVQ
3dddA           ----------------------------------------------------------------------
2b2nB           ----------------------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
2b98C           ----------------------------------------------------------------------
149lA           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
1ef0A           ----------------------------------------------------------------------
3e0jE           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
2c5uA           ----------------------------------------------------------------------
1e2bA           ----------------------------------------------------------------------
2bhrB           ----------------------------------------------------------------------
1dydA           ----------------------------------------------------------------------
1d2zB           ----------------------------------------------------------------------
1a16A           ----------------------------------------------------------------------
3bxzA           ----------------------------------------------------------------------
2bmfA           YRVAEGINYADRRWCFDGVKNNQILEENVEVEIWTKEGERKKLKPRWLDARIYSDP--------------
3cdrA           ----------------------------------------------------------------------
2bwsA           ----------------------------------------------------------------------
2dgdA           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------------------
1dfaA           ----------------------------------------------------------------------
1d9wA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           VLARSAGLTDVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bxzB           ----------------------------------------------------------------------
1cu1A           ----------------------------------------------------------------------
2ekdF           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
2dxcE           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
3e0jC           ----------------------------------------------------------------------
2bmfB           ----------------------------------------------------------------------
2dxcB           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------
3eitA           ----------------------------------------------------------------------
2cevA           ----------------------------------------------------------------------
3bbeA           ----------------------------------------------------------------------
1cevA           ----------------------------------------------------------------------
3eiqD           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
3dinA           ----------------------------------------------------------------------
3dkpA           ----------------------------------------------------------------------
3eiqA           ----------------------------------------------------------------------
3ddeA           ----------------------------------------------------------------------
3dmqA           HLVP------------------------------------------------------------------
3borA           ----------------------------------------------------------------------
1b47A           ----------------------------------------------------------------------
3berA           ----------------------------------------------------------------------
3dl8A           EFEKVIVLRAV-----------------------------------------------------------
2b99A           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3ddeB           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3dwlD           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
3b6eA           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
1a1vA           ----------------------------------------------------------------------
3dddA           ----------------------------------------------------------------------
2b2nB           ----------------------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
2b98C           ----------------------------------------------------------------------
149lA           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
1ef0A           ----------------------------------------------------------------------
3e0jE           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
2c5uA           ----------------------------------------------------------------------
1e2bA           ----------------------------------------------------------------------
2bhrB           ----------------------------------------------------------------------
1dydA           ----------------------------------------------------------------------
1d2zB           ----------------------------------------------------------------------
1a16A           ----------------------------------------------------------------------
3bxzA           ----------------------------------------------------------------------
2bmfA           ----------------------------------------------------------------------
3cdrA           ----------------------------------------------------------------------
2bwsA           ----------------------------------------------------------------------
2dgdA           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------------------
1dfaA           ----------------------------------------------------------------------
1d9wA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           xxxxxxxxxxxxxxxxxxxx
3bxzB           --------------------
1cu1A           --------------------
2ekdF           --------------------
2ekdA           --------------------
1d9zA           --------------------
2dxcE           --------------------
1d9xA           --------------------
3e0jC           --------------------
2bmfB           --------------------
2dxcB           --------------------
2dxcH           --------------------
3eitA           --------------------
2cevA           --------------------
3bbeA           --------------------
1cevA           --------------------
3eiqD           --------------------
2db3A           --------------------
3dinA           --------------------
3dkpA           --------------------
3eiqA           --------------------
3ddeA           --------------------
3dmqA           --------------------
3borA           --------------------
1b47A           --------------------
3berA           --------------------
3dl8A           --------------------
2b99A           --------------------
3cpeA           --------------------
3eaqA           --------------------
3ddeB           --------------------
3eaqB           --------------------
1dhsA           --------------------
2d7dA           --------------------
3dwlD           --------------------
1d2mA           --------------------
3b6eA           --------------------
2b2nA           --------------------
1a1vA           --------------------
3dddA           --------------------
2b2nB           --------------------
2bhrA           --------------------
3earA           --------------------
1c4oA           --------------------
3easA           --------------------
2b98C           --------------------
149lA           --------------------
3crvA           --------------------
1ef0A           --------------------
3e0jE           --------------------
2csdA           --------------------
2c5uA           --------------------
1e2bA           --------------------
2bhrB           --------------------
1dydA           --------------------
1d2zB           --------------------
1a16A           --------------------
3bxzA           --------------------
2bmfA           --------------------
3cdrA           --------------------
2bwsA           --------------------
2dgdA           --------------------
2bwwA           --------------------
1dfaA           --------------------
1d9wA           --------------------
3buwB           --------------------
1d9zA           --------------------
1d9xA           --------------------
1d2mA           --------------------