[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ54538.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dbsA.bssp"
#ERROR : Can't open dsspfile "3dk6A.bssp"
#ERROR : Can't open dsspfile "3c5iA.bssp"
#ERROR : Can't open dsspfile "2c47C.bssp"
#ERROR : Can't open dsspfile "2bmcF.bssp"
#ERROR : Can't open dsspfile "2e2bA.bssp"
#ERROR : Can't open dsspfile "2bmcA.bssp"
#ERROR : Can't open dsspfile "3csfA.bssp"
#ERROR : Can't open dsspfile "3dxnA.bssp"
#ERROR : Can't open dsspfile "3bceA.bssp"
#ERROR : Can't open dsspfile "3c0iA.bssp"
#ERROR : Can't open dsspfile "3byvA.bssp"
#ERROR : Can't open dsspfile "3e87A.bssp"
#ERROR : Can't open dsspfile "2c3jA.bssp"
#ERROR : Can't open dsspfile "1cdkA.bssp"
#ERROR : Can't open dsspfile "3c0gA.bssp"
#ERROR : Can't open dsspfile "3ei1A.bssp"
#ERROR : Can't open dsspfile "2chwA.bssp"
#ERROR : Can't open dsspfile "1cmkE.bssp"
#ERROR : Can't open dsspfile "3dkfA.bssp"
#ERROR : Can't open dsspfile "2brmA.bssp"
#ERROR : Can't open dsspfile "2dwbA.bssp"
#ERROR : Can't open dsspfile "2ckpB.bssp"
#ERROR : Can't open dsspfile "3blrA.bssp"
#ERROR : Can't open dsspfile "3ckwA.bssp"
#ERROR : Can't open dsspfile "3bhhC.bssp"
#ERROR : Can't open dsspfile "2cgxA.bssp"
#ERROR : Can't open dsspfile "2ckoB.bssp"
#ERROR : Can't open dsspfile "2e2bB.bssp"
#ERROR : Can't open dsspfile "3c5iD.bssp"
#ERROR : Can't open dsspfile "3bhhD.bssp"
#ERROR : Can't open dsspfile "3e5aA.bssp"
#ERROR : Can't open dsspfile "3dxpA.bssp"
#ERROR : Can't open dsspfile "1e7uA.bssp"
#ERROR : Can't open dsspfile "1e7vA.bssp"
#ERROR : Can't open dsspfile "3bhhB.bssp"
#ERROR : Can't open dsspfile "3comB.bssp"
#ERROR : Can't open dsspfile "1apmE.bssp"
#ERROR : Can't open dsspfile "2c47A.bssp"
#ERROR : Can't open dsspfile "3c4yB.bssp"
#ERROR : Can't open dsspfile "2advA.bssp"
#ERROR : Can't open dsspfile "3c9wA.bssp"
#ERROR : Can't open dsspfile "2a1sB.bssp"
#ERROR : Can't open dsspfile "3csvA.bssp"
#ERROR : Can't open dsspfile "2bfxB.bssp"
#ERROR : Can't open dsspfile "3dk7B.bssp"
#ERROR : Can't open dsspfile "3bboU.bssp"
#ERROR : Can't open dsspfile "3c5yE.bssp"
#ERROR : Can't open dsspfile "1b5dA.bssp"
#ERROR : Can't open dsspfile "1e8xA.bssp"
#ERROR : Can't open dsspfile "3c5yA.bssp"
#ERROR : Can't open dsspfile "2bvaA.bssp"
#ERROR : Can't open dsspfile "2eb3A.bssp"
#ERROR : Can't open dsspfile "1b5eA.bssp"
#ERROR : Can't open dsspfile "2bkkA.bssp"
#ERROR : Can't open dsspfile "1e8wA.bssp"
#ERROR : Can't open dsspfile "2bmcB.bssp"
#ERROR : Can't open dsspfile "3c5yB.bssp"
#ERROR : Can't open dsspfile "3dlxA.bssp"
#ERROR : Can't open dsspfile "3dkoA.bssp"
#ERROR : Can't open dsspfile "3dajA.bssp"
#ERROR : Can't open dsspfile "3dfaA.bssp"
#ERROR : Can't open dsspfile "2bkkC.bssp"
#ERROR : Can't open dsspfile "3c5yL.bssp"
#ERROR : Can't open dsspfile "3dy7A.bssp"
#ERROR : Can't open dsspfile "3dndA.bssp"
#ERROR : Can't open dsspfile "3cs9D.bssp"
#ERROR : Can't open dsspfile "1e8zA.bssp"
#ERROR : Can't open dsspfile "3cqzH.bssp"
#ERROR : Can't open dsspfile "3da6A.bssp"
#ERROR : Can't open dsspfile "3dk6B.bssp"
#ERROR : Can't open dsspfile "2a19C.bssp"
#ERROR : Can't open dsspfile "3a5cA.bssp"
#ERROR : Can't open dsspfile "3dlxC.bssp"
#ERROR : Can't open dsspfile "3ck8A.bssp"
#ERROR : Can't open dsspfile "3cg2A.bssp"
#ERROR : Can't open dsspfile "3cuqA.bssp"
#ERROR : Can't open dsspfile "248lA.bssp"
#ERROR : Can't open dsspfile "3c5yF.bssp"
#ERROR : Can't open dsspfile "2dlaC.bssp"
#ERROR : Can't open dsspfile "1a0eA.bssp"
#ERROR : Can't open dsspfile "2ckoA.bssp"
#ERROR : Can't open dsspfile "2dq7X.bssp"
#ERROR : Can't open dsspfile "3e8cE.bssp"
#ERROR : Can't open dsspfile "2b5mA.bssp"
#ERROR : Can't open dsspfile "3dqwA.bssp"
#ERROR : Can't open dsspfile "2chxA.bssp"
#ERROR : Can't open dsspfile "2ckqA.bssp"
#ERROR : Can't open dsspfile "3e3pA.bssp"
#ERROR : Can't open dsspfile "3ckcA.bssp"
#ERROR : Can't open dsspfile "3cq9D.bssp"
#ERROR : Can't open dsspfile "1bygA.bssp"
#ERROR : Can't open dsspfile "3daeA.bssp"
#ERROR : Can't open dsspfile "3daeB.bssp"
#ERROR : Can't open dsspfile "3dkgA.bssp"
#ERROR : Can't open dsspfile "3dplC.bssp"
#ERROR : Can't open dsspfile "2ae4A.bssp"
#ERROR : Can't open dsspfile "3dlxB.bssp"
#ERROR : Can't open dsspfile "3cq9B.bssp"
#ERROR : Can't open dsspfile "1a35A.bssp"
#ERROR : Can't open dsspfile "3bdeB.bssp"
#ERROR : Can't open dsspfile "3dyhA.bssp"
#ERROR : Can't open dsspfile "3cokA.bssp"
#ERROR : Can't open dsspfile "2amuA.bssp"
#ERROR : Can't open dsspfile "3dyhB.bssp"
#ERROR : Can't open dsspfile "3bdeA.bssp"
#ERROR : Can't open dsspfile "2b8uA.bssp"

## Summary of PDB Search
:490
    2e-31   9%  3dbsA  [x.x.x] PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE
    8e-23  19%  3dk6A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-22   7%  3c5iA  [x.x.x] CHOLINE KINASE
    1e-19  12%  2c47C  [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
    2e-19  18%  2bmcF  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    7e-19  21%  2e2bA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    8e-19  18%  2bmcA  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    1e-18   5%  3csfA  [x.x.x] PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE
    1e-18  15%  3dxnA  [x.x.x] CALMODULIN-LIKE DOMAIN PROTEIN KINASE ISOFORM 3
    2e-18  20%  3bceA  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    8e-18  24%  3c0iA  [x.x.x] PERIPHERAL PLASMA MEMBRANE PROTEIN CASK[MASQUE :
    1e-17  11%  3byvA  [x.x.x] RHOPTRY KINASE
    2e-17  21%  3e87A  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    2e-17  17%  2c3jA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    6e-17  22%  1cdkA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    1e-16  24%  3c0gA  [x.x.x] PERIPHERAL PLASMA MEMBRANE PROTEIN CASK[MASQUE :
    4e-16   8%  3ei1A  [x.x.x] DNA DAMAGE-BINDING PROTEIN 1
    5e-16   7%  2chwA  [x.x.x] PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE
    1e-14  19%  1cmkE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    1e-14  14%  3dkfA  [x.x.x] MET PROTO-ONCOGENE
    2e-14   7%  2brmA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-14  20%  2dwbA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    4e-14  11%  2ckpB  [x.x.x] CHOLINE KINASE ALPHA
    5e-14  19%  3blrA  [x.x.x] CELL DIVISION PROTEIN KINASE 9
    7e-14  27%  3ckwA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 24
    8e-14  23%  3bhhC  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    1e-13  15%  2cgxA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-13  11%  2ckoB  [x.x.x] CHOLINE KINASE ALPHA
    4e-13  17%  2e2bB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-13   7%  3c5iD  [x.x.x] CHOLINE KINASE
    5e-13  23%  3bhhD  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    6e-13  22%  3e5aA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    7e-13   9%  3dxpA  [x.x.x] PUTATIVE ACYL-COA DEHYDROGENASE
    8e-13  11%  1e7uA  [d.15.1 - b.7.1 - a.118.1 - d.144.1] PHOSPHATIDYLINOSITOL
    1e-12  11%  1e7vA  [d.15.1 - b.7.1 - a.118.1 - d.144.1] PHOSPHATIDYLINOSITOL
    1e-12  23%  3bhhB  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    2e-12  22%  3comB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 4
    3e-12  16%  1apmE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    3e-12  15%  2c47A  [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
    3e-12  25%  3c4yB  [x.x.x] RHODOPSIN KINASE
    4e-12   9%  2advA  [x.x.x] GLUTARYL 7- AMINOCEPHALOSPORANIC ACID ACYLASE
    4e-12  17%  3c9wA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    5e-12   6%  2a1sB  [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN
    1e-11  23%  3csvA  [x.x.x] AMINOGLYCOSIDE PHOSPHOTRANSFERASE
    2e-11  21%  2bfxB  [x.x.x] LOC398457 PROTEIN
    2e-11  19%  3dk7B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-11  12%  3bboU  [x.x.x] RIBOSOMAL PROTEIN L22
    6e-11  10%  3c5yE  [x.x.x] RIBOSE/GALACTOSE ISOMERASE
    6e-11   6%  1b5dA  [d.117.1] PROTEIN (DEOXYCYTIDYLATE HYDROXYMETHYLASE)
    9e-11   9%  1e8xA  [d.15.1 - b.7.1 - a.118.1 - d.144.1] PHOSPHATIDYLINOSITOL
    1e-10  11%  3c5yA  [x.x.x] RIBOSE/GALACTOSE ISOMERASE
    1e-10  30%  2bvaA  [x.x.x] P21-ACTIVATED KINASE 4
    1e-10  15%  2eb3A  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    1e-10   6%  1b5eA  [d.117.1] PROTEIN (DEOXYCYTIDYLATE HYDROXYMETHYLASE)
    2e-10  14%  2bkkA  [x.x.x] AMINOGLYCOSIDE 3'-PHOSPHOTRANSFERASE
    3e-10  11%  1e8wA  [d.15.1 - b.7.1 - a.118.1 - d.144.1] PHOSPHATIDYLINOSITOL
    3e-10  20%  2bmcB  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    3e-10  11%  3c5yB  [x.x.x] RIBOSE/GALACTOSE ISOMERASE
    3e-10  14%  3dlxA  [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1
    8e-10  16%  3dkoA  [x.x.x] EPHRIN TYPE-A RECEPTOR 7
    1e-09  24%  3dajA  [x.x.x] SERINE/THREONINE KINASE 6
    1e-09  16%  3dfaA  [x.x.x] CALCIUM-DEPENDENT PROTEIN KINASE CGD3_920
    2e-09   9%  2bkkC  [x.x.x] AMINOGLYCOSIDE 3'-PHOSPHOTRANSFERASE
    2e-09  11%  3c5yL  [x.x.x] RIBOSE/GALACTOSE ISOMERASE
    2e-09  21%  3dy7A  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    2e-09  25%  3dndA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    3e-09  21%  3cs9D  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-09  12%  1e8zA  [d.15.1 - b.7.1 - a.118.1 - d.144.1] PHOSPHATIDYLINOSITOL
    5e-09  11%  3cqzH  [x.x.x] DNA-DIRECTED RNA POLYMERASES I, II, AND III
    7e-09  21%  3da6A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    9e-09  18%  3dk6B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    1e-08  16%  2a19C  [x.x.x] INTERFERON-INDUCED, DOUBLE-STRANDED RNA-
    1e-08  12%  3a5cA  [x.x.x] V-TYPE ATP SYNTHASE ALPHA CHAIN
    3e-08  18%  3dlxC  [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1
    4e-08  11%  3ck8A  [x.x.x] SUSD
    4e-08  25%  3cg2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-08   9%  3cuqA  [x.x.x] VACUOLAR-SORTING PROTEIN SNF8
    7e-08   8%  248lA  [x.x.x] T4 LYSOZYME
    8e-08  10%  3c5yF  [x.x.x] RIBOSE/GALACTOSE ISOMERASE
    8e-08   7%  2dlaC  [x.x.x] 397AA LONG HYPOTHETICAL PROTEIN
    1e-07   9%  1a0eA  [c.1.15] XYLOSE ISOMERASE
    1e-07   9%  2ckoA  [x.x.x] CHOLINE KINASE ALPHA
    2e-07  19%  2dq7X  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE FYN
    2e-07  23%  3e8cE  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    3e-07  10%  2b5mA  [x.x.x] DAMAGE-SPECIFIC DNA BINDING PROTEIN 1
    5e-07  19%  3dqwA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    5e-07   9%  2chxA  [x.x.x] PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE
    8e-07   5%  2ckqA  [x.x.x] CHOLINE KINASE ALPHA
    1e-06  17%  3e3pA  [x.x.x] PROTEIN KINASE, PUTATIVE GLYCOGEN SYNTHASE
    2e-06  13%  3ckcA  [x.x.x] SUSD
    3e-06   8%  3cq9D  [x.x.x] UNCHARACTERIZED PROTEIN LP_1622
    3e-06  17%  1bygA  [d.144.1] PROTEIN (C-TERMINAL SRC KINASE)
    5e-06  18%  3daeA  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    5e-06  18%  3daeB  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    6e-06  20%  3dkgA  [x.x.x] MET PROTO-ONCOGENE
    9e-06  19%  3dplC  [x.x.x] CULLIN-5
    2e-05  10%  2ae4A  [x.x.x] GLUTARYL 7-AMINOCEPHALOSPORANIC ACID ACYLASE
    6e-05  19%  3dlxB  [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1
    1e-04   6%  3cq9B  [x.x.x] UNCHARACTERIZED PROTEIN LP_1622
    1e-04   8%  1a35A  [e.15.1 - d.163.1] PROTEIN (DNA TOPOISOMERASE I)
    2e-04  10%  3bdeB  [x.x.x] MLL5499 PROTEIN
    4e-04   8%  3dyhA  [x.x.x] FARNESYL PYROPHOSPHATE SYNTHASE
    5e-04  11%  3cokA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PLK4
    5e-04  14%  2amuA  [x.x.x] PUTATIVE SUPEROXIDE REDUCTASE
    5e-04  11%  3dyhB  [x.x.x] FARNESYL PYROPHOSPHATE SYNTHASE
    6e-04  10%  3bdeA  [x.x.x] MLL5499 PROTEIN
    7e-04  11%  2b8uA  [a.26.1 (1iarA)] INTERLEUKIN-4
:490

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPDGARVAVKTLHRDA
3dbsA           --------------------------------------------------------RQDMLILQILRIME
3dk6A           ----------------------------------------------------------------------
3c5iA           ----------------------------------------------------------------------
2c47C           --------------------------------------------------------TNEYVAIKLEPIKS
2bmcF           ------------------------------------------------------------LALKVLFKAQ
2e2bA           -------------------------------------------------------KYSLTVAVKTLME--
2bmcA           -------------------------------------------------------QSKFILALKVLFKAQ
3csfA           ---------------------------------------------------------QDMLILQILRIME
3dxnA           --------------------------------------------------------TGAERAIKIIKKSS
3bceA           ---------------------------------------------------------GETVKIPVAIKIL
3c0iA           ---------------------------------------------------------GQQFAVKIVDVAK
3byvA           --------------------------------------------------------------LRLRLLRG
3e87A           --------------------------------------------------------TGRYYAMKILRKEV
2c3jA           --------------------------------------------------------TEEAVAVKIVDMK-
1cdkA           ---------------------------------------------------------GNHFAMKILDKQK
3c0gA           ---------------------------------------------------------GQQFAVKIVDVAK
3ei1A           -------------------------------------------------------AKNTRLEIYVVTAEG
2chwA           --------------------------------------------------------RQDMLILQILRIMS
1cmkE           ---------------------------------------------------------GNHFAMKILDKQK
3dkfA           --------------------------------------------------------KKIHCAVKSLNRIT
2brmA           ---------------------------------------------------------EEAVAVKIVDMCP
2dwbA           -------------------------------------------------------QSKFILALKVLFKAQ
2ckpB           ----------------------------------------------------------------------
3blrA           -------------------------------------------------------KTGQKVALKKVLMEN
3ckwA           --------------------------------------------------------TQKVVAIKIIDLEE
3bhhC           -------------------------------------------------------CTGHEYAAKIINTKK
2cgxA           ----------------------------------------------------------------------
2ckoB           ----------------------------------------------------------------------
2e2bB           --------------------------------------------------------------WKKYSLTV
3c5iD           ----------------------------------------------------------------------
3bhhD           -------------------------------------------------------CTGHEYAAKIINTKK
3e5aA           -------------------------------------------------------------ALKVLFKAQ
3dxpA           ----------------------------------------------------------------------
1e7uA           ------------------------------------------------------------LILQILRIME
1e7vA           ---------------------------------------------------------QDMLILQILRIME
3bhhB           ----------------------------------------------------------------------
3comB           --------------------------------------------------------TGQIVAIKQVPVES
1apmE           ----------------------------------------------------------------------
2c47A           ----------------------------------------------------------------------
3c4yB           -------------------------------------------------------ATGKLYACKKLNKKR
2advA           ----------------------------------------------------------------------
3c9wA           ----------------------------------------------------------------------
2a1sB           ----------------------------------------------------------------------
3csvA           ----------------------------------------------------------------------
2bfxB           ---------------------------------------------------------KFIMALKVLFKSQ
3dk7B           -----------------------------------------------------------KYSLTVAVKTL
3bboU           ----------------------------------------------------------------------
3c5yE           ----------------------------------------------------------------------
1b5dA           ----------------------------------------------------------------------
1e8xA           --------------------------------------------------------RQDMLILQILRIMS
3c5yA           ----------------------------------------------------------------------
2bvaA           ----------------------------------------------------------------------
2eb3A           --------------------------------------------------------EGEKVKIPVAIKEL
1b5eA           ----------------------------------------------------------------------
2bkkA           ----------------------------------------------------------------------
1e8wA           ----------------------------------------------------------------------
2bmcB           ---------------------------------------------------------KFILALKVLFKAQ
3c5yB           ----------------------------------------------------------------------
3dlxA           ----------------------------------------------------------------------
3dkoA           ----------------------------------------------------------------------
3dajA           ----------------------------------------------------------------------
3dfaA           ---------------------------------------------------------QQEYAVKVINKAS
2bkkC           ----------------------------------------------------------------------
3c5yL           ----------------------------------------------------------------------
3dy7A           -------------------------------------------------------PSGLVMARKLIHLE-
3dndA           ----------------------------------------------------------------------
3cs9D           ------------------------------------------------------------VAVKTLKEDT
1e8zA           ----------------------------------------------------------------------
3cqzH           ----------------------------------------------------------------------
3da6A           ----------------------------------------------------------------------
3dk6B           ----------------------------------------------------------------------
2a19C           ----------------------------------------------------------------------
3a5cA           ----------------------------------------------------------------------
3dlxC           ----------------------------------------------------------------------
3ck8A           ---------------------------------------------------------DITQYNFFLDQTE
3cg2A           ----------------------------------------------------------------------
3cuqA           ----------------------------------------------------------------------
248lA           ----------------------------------------------------------------------
3c5yF           ----------------------------------------------------------------------
2dlaC           ------------------------------------------------------------IMLDPFSEKA
1a0eA           ----------------------------------------------------------------------
2ckoA           ----------------------------------------------------------------------
2dq7X           ----------------------------------------------------------------------
3e8cE           ----------------------------------------------------------------------
2b5mA           ----------------------------------------------------------------------
3dqwA           ----------------------------------------------------------------------
2chxA           ----------------------------------------------------------------------
2ckqA           ----------------------------------------------------------------------
3e3pA           ----------------------------------------------------------------------
3ckcA           ----------------------------------------------------------------------
3cq9D           ----------------------------------------------------------------------
1bygA           ----------------------------------------------------------------------
3daeA           ----------------------------------------------------------------------
3daeB           ----------------------------------------------------------------------
3dkgA           -------------------------------------------------------DKKIHCAVKSLNRIT
3dplC           ----------------------------------------------------------------------
2ae4A           ----------------------------------------------------------------------
3dlxB           ----------------------------------------------------------------------
3cq9B           ----------------------------------------------------------------------
1a35A           ----------------------------------------------------------------------
3bdeB           -------------------------------------------------------GVTHFEQLRQISPKI
3dyhA           -------------------------------------------------------------PMQMFMQVY
3cokA           ----------------------------------------------------------------------
2amuA           ------------------------------------------------------------KHVPVIEAPE
3dyhB           -------------------------------------------------------------PMQMFMQV-
3bdeA           --------------------------------------------------------VTHFEQLRQISPKI
2b8uA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LDLPGLREQLAEEVEMARRVARFCTAQVLAADLDADPPYVVSEYVEGPSLQAVVRERGPLRGASLERLAV
3dbsA           IWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLNHWLKEKSPTEEKFRF
3dk6A           ------VEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRNRQEVSAVVLLYMAT
3c5iA           ------------------------------------------------------------------KFMK
2c47C           R-----APQLHLEYRFYKQLSATEGVPQVYYFGPGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAI
2bmcF           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYIT
2e2bA           ------VEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLLRECNRQEVNAVVLLYMAT
2bmcA           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYIT
3csfA           SIWETESLDLLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTGFKDEVLNHWLKEKSPTEEKFQAA
3dxnA           VTTTSNSGALLDEVAVLKQLDHPNIMKLYEFFEDKRNYYLVMEVYRGGELFDEIILRQKFSEVDAAVIMK
3bceA           NETPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCV
3c0iA           FSSPGLSTDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVAS
3byvA           IKNQKQAKVHLRFIFPFDLVKDPQKKKMIRVMWVLSRFFLYPRMQSNLQTFGEVLLSKSLVHHARLQLTL
3e87A           IIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGA
2c3jA           ------RENIKKEICINKMLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
1cdkA           VVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAA
3c0gA           FSSPGLSTDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVAS
3ei1A           LR-PVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDITRAHGNVQDRIGRPSET
2chwA           IWETESLDLCLLPYGCISTGDEIVKDATTIAKIQQSTVGNTGAFKDEVLNHWLKEKSPTEEKFQAAVERF
1cmkE           VVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGR----FSEPHAR
3dkfA           DIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGL
2brmA           ENIKKEICINKMLNHE-NVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGV
2dwbA           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYIT
2ckpB           ----------------------------------------------------------------------
3blrA           EKE---GFPITALREIKILQLLKHENVVNLIEICRTSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQ
3ckwA           I------EDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEP-GPLDETQIATILR
3bhhC           LS-ARDHQKLEREARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQ
2cgxA           -------ENIKKEICINKMLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
2ckoB           ---------------------------------TMEKYLKEVLRIKFTEESRIKKLHKLLSNLPLELENL
2e2bB           AVKTLEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRNRQEVNAVVLLYMAT
3c5iD           -----------------------------------EKWKNQLFKYKNIEKYNCDIHKYIKESDKFIKFMK
3bhhD           LS-ARDHQKLEREARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQ
3e5aA           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYIT
3dxpA           ----------------------------------------------------------------------
1e7uA           SIWETESLDLCLLPYGCISTGDKIVKDATTIAKIQQSTVGNTGAFKDEVLSHWLKEKCPIEEKFQAAVER
1e7vA           SIWETESLDLCLLPYGCIGMIEIVKDATTIAK-IQQSTVGNTGAFKDEVLSHWLKEKCPIEEKFQAVERF
3bhhB           ------HQKLEREARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQ
3comB           DLQEIIKE-----ISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRKTLTEDEIATILQ
1apmE           ----------------------------------------------------------------------
2c47A           -----------------------------------KYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAI
3c4yB           LKKRKGYQGAMVEKKILAKVHSRFIVSLAYAFETKTDLCLVMTIMNGGDIRYHIYNVDEDNPGFQEPRAI
2advA           ---------------------------------DAPSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWG
3c9wA           --------------------------------------------------------------------LY
2a1sB           -------PFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDIPEDQKKFIDQ
3csvA           ----------------------------------------------------------------------
2bfxB           LEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFME
3dk7B           ME----VEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIIIEFMTYGNLLDYLRECNRQEVSAVVLLAT
3bboU           --------------------------------------RRVIDQIRGRSYAETLMILELMPYRACYPIFK
3c5yE           ------------------------------------------------------------------KIAL
1b5dA           ------------------------------------------WYKSKSLFVKDIPGETPKIWQQVASSKG
1e8xA           IWETESLDLCLLPYGCISTMIEIVKDATTIAKIQQSTVGNTGAFKDEVLSHWLKEKCPIEEKFQAAVERF
3c5yA           ------------------------------------------------------------------KIAL
2bvaA           --------------------------------------------------------HTRMNEEQIAAVCL
2eb3A           REAPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCV
1b5eA           ------------------------------------------WYKSKSLFVKDIPGETPKIWQQVASSKG
2bkkA           --------------------------------------IDISDCPYTNSLDSRLAELDYLLNNKDPRELY
1e8wA           --------------------------------------------------------------------RF
2bmcB           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYIT
3c5yB           ------------------------------------------------------------------KIAL
3dlxA           ----------------------------------------------------------------------
3dkoA           --------------------------HLEGVVTRGKPVMIVIEFMENGALDAFLRKHDGQFTVIQLVG--
3dajA           ----------------------------------------------------------------------
3dfaA           AKNKDTSTIL-REVELLKKLDHPNIMKLFEILEDSSSFYIVGELYTGELFDEIIKRK-RFSEHDAARIIK
2bkkC           -----------LYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDSENWEEDTPFKDPRELY
3c5yL           ------------------------------------------------------------------KIAL
3dy7A           -IKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSI
3dndA           ---------------------------------DNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAA
3cs9D           ME----VEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRERQEVNAVVLLYMAT
1e8zA           ----------------------------------------------------------------------
3cqzH           ----------------------------------------------------------------------
3da6A           ------AKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLLMDANLCQVIQMELDHERMSYLLY
3dk6B           -------------------------------------------------------NRQEVSAVVLLYMAT
2a19C           ----------------------------------------------------------------------
3a5cA           ---------------------------------EMTDVLVEFPELTDPKTGGPLMHRTVLIANTSNMPVA
3dlxC           ----------------------------------------------------------------------
3ck8A           GMTDAETLRQRAEIRFLRALHYWYFLDLFGAPFKEHFSNDLPVEKKGTELYTYIQNE--LNEI---EADM
3cg2A           ----------------------------------------------------------------------
3cuqA           ------FKTNLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIE
248lA           -------FEMLRIDEGLRLKIYKDTEGYYTAGAGLTKSPSLNAAKSELDKAIGRNTNGVIAEKLFNQDVD
3c5yF           ------------------------------------------------------------------KIAL
2dlaC           KE---LLKGFGSINDFMDAIPKIVSIERIRVVKNEKLIDKFLDQDNVMDLAQFYALLGSYSPYGIELELV
1a0eA           ----------------------------------------------------------------------
2ckoA           --------------------------------------LKEVLRIKFTEESRIKKLHKLLSNLPLELENL
2dq7X           ----------------------------------------------------------------------
3e8cE           ---------------------------------DNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAA
2b5mA           ---------------------------------TAKYNACILEYKQSGESDIITRAHGNVQDRIGRPSET
3dqwA           ----------------------------------------------------------------------
2chxA           ----------------------------------------------------------------------
2ckqA           ----------------------------------------------------------------------
3e3pA           ----------------------------------------------------------------------
3ckcA           ----------------------------------------------------------------------
3cq9D           ------PDEVHLYGATGGRLDHLLANWLVLDPVF-RQWAPQIKLIDKQNSVRFFLPGDYQDKRYLAFVPL
1bygA           ----------------------------------------------------------------------
3daeA           ----------------------------------------------------------------------
3daeB           ----------------------------------------------------------------------
3dkgA           D--IGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGRNFIRNETHNPTVKDLIGFGL
3dplC           ----------------------------------------------------------------------
2ae4A           ----PIAAYKPRSNEILWDGYGV----PHIYGVDAPSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWG
3dlxB           ----------------------------------------------------------------------
3cq9B           -----------ATGGRLDHLLANWLVLDPVFRQWAPQIKLIDKQNSVRFFLPGDYQITKEADKRYLAFVP
1a35A           --------------------------------------IQGSIKYIMLNPSSRIKGEKDWQKYETARRLK
3bdeB           DYHFGFSEFADQAAYTRYNDHPDHVAFVRDRWVPEVEKFLEIDYVPL-----------------------
3dyhA           DEI----QMFLLEELELKFDMDPNRVRYLRKMMDTTCLGGKYNRGLTVIDVAESLLSLGARRKRVLHDAC
3cokA           ----------------------------------------------------------------------
2amuA           KVKKD--EKVQIVVTVGKEIPHPNTTKVFFQPDGDPYVYEVGEFNAHGESVQGPNIGAVYTEPTVTTVRS
3dyhB           --YDEIQMFLLEELELKFRYLRKMMDTTCLGGKYNRGLTVIDVAESLLSLD------DGARRKRVLHDAC
3bdeA           DYHFGFSEFADQAAYTRYNDHPDHVAFVRDRWVPEVEKFLEIDYVPL-----------------------
2b8uA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GTLTALAAIHQAGIVHRDFKPANVLMAPGGPRVIDFGIARALEGTAILTSRIAGTPAYMAPEQITGGPLG
3dbsA           VYSCAGYCVATFVLGIGDRHNDNIMIETGNLFHIDFGHERVPFVLTPDFLFVMGTSGQKFQDICVKAYLA
3dk6A           QISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVDFGLSRLMTGDTTAHAGAKFPIKWTAPESLAYNKFS
3c5iA           VYSKSDNLANTIVFCHNDLQENNIITNCLRLIDFEYSGFNFLATDIANFFIETSIDYSVSSYPFFEIDKK
2c47C           QLITRMEYVHTKSENFLVGRPGQHAIHIIDFGLAYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQS
2bmcF           ELANALSYCHSKRVIHRDIKPENLLLSAGELKIADFGWSVTLDYLPPEMIEGRMHDEKVDLWSLGVLCYE
2e2bA           QISSAMEYLEKKNFIHRDLAARNCLVGENHLKVADFGLSRLTYTA---HAGAKFPIKWTAPESLAYNKFS
2bmcA           ELANALSYCHSKRVIHRDIKPENLLGSAGELKIADFGWSVTLDYLPPEMIEGRMHDEKVDLWSLGVLCYE
3csfA           VERFVYSCAGYCDNIMITETGNLFHIDFGHGERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLA
3dxnA           QVLSGTTYLHKHNIVHRDLKPENLLESKSDALIKIVDFGLSAHFERLGTAYYIAPEVLRKKYDEKCDVWS
3bceA           QIAKGMMYLEERRLVHRDLAARNVLVKSPNHKITDFGLARLLEGDEKEYNAGKMPIKWMALECIHYRKFT
3c0iA           HILEALRYCHDNNIIHRDVKPHCVLLASAPVKLGGFGVAIQLGESGLVAGGRVGTPHFMAPEVVKREPYG
3byvA           QVIRLLASLHHYGLVHTYLRPVDIVLDQRGVFLTGFEHLVRDGARVVSPPELEARRATISYHRDRRTLMT
3e87A           EIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKFCGTPEYLAPEVLEDNDYG
2c3jA           QLMAGVVYLHGIGITHRDIKPENLLLDERDNDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHA
1cdkA           QIVLTFEYLHSLDLIYRDLKPENLLIDQQG---YIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYN
3c0gA           HILEALRYCHDNNIIHRDVKPHCVLLASAPVKLGGFGVAIQLGESGLVAGGRVGTPHFMAPEVVKREPYG
3ei1A           GIIGIIDPECRMIGLRLYDGLFKVIPDRDNKELKAFNIRLEELIDVKFLYGCQAPTICFVYQDPQGRHVK
2chwA           VYSCAGYCVATFVLGIGDRHNDNIMITETGLFHIDFGHERVPFVLTGTSGKKTSPHFQKFQDICVKAYLA
1cmkE           FYAAQIVLTFEYLHSLDLIYRDLKPENLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYN
3dkfA           QVAKGMKFLASKKFVHRDLAARNCMLDEKFTVKVADFG--------LARDMYKLPVKWMALESLQTQKFT
2brmA           VYLHGIGITHRDIKPENLLLDERDNLKISDFGLAVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPV
2dwbA           ELANALSYCHSKRVIHRDIKPENLLLSAGELKIADFGWSV------HAPSSRTLCGTLDYLPPEIEGRHD
2ckpB           ---------SPVVFCHNDCQEGNILLLEQKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYSYEKYFFRANI
3blrA           MLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLDFGLARAFSLAPNRYNRVVTLWYRPPELLLGERDYG
3ckwA           EILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLAD--------------FFVGTPFWMAPEVIKQSAYD
3bhhC           QILEAVLHCHQMGVVHRDLKPENLLCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKEAYG
2cgxA           QLMAGVVYLHGIGITHRDIKPENLLDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHA
2ckoB           RSLLE-STPSPVVFCHNDCQEGNILLLEGRENLIDFEYSSYNYRGFDIGNHF-CEWMYDYSYEKYPFANI
2e2bB           QISSAMEYLEKKNFIHRDLAARNCLV----GENHLVKVADFGLSTYTAHAGAKFPIKWTAPESLAYNKFS
3c5iD           VYSKSDNLANTIVFCHNDLQENNIINTNKCLRLIDFEYSGFNFLATDIANFFISIDYSVSSYPFFEIDKK
3bhhD           QILEAVLHCHQMGVVHRDLKPENLLCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKEAYG
3e5aA           ELANALSYCHSKRVIHRDIKPENLLLGSAG--ELKIADFGWSVHAPSSRRTLCGTLDYLPPEMIEGRMHD
3dxpA           --IPQEDADLTSIVHGDYRLDNLFHPTEPRVLAVDWELSTLGHPGDFGYHCSWHIAPGQFRGIAGLDHAA
1e7uA           FVYCAGYCVATFVLGIGDRHNDNIMISEGNLFHIDFGHIN------KERVPFVLTPDFLFVMGTSGKTSL
1e7vA           VYSCAGYCVATFVLGIGDRHNDNMISETGNLFHIDFGHIN------KERVPFVLTPDFLFVMGTSGKTSL
3bhhB           QILEAVLHCHQMGVVHRDLKPENLLLASKCVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKEAYG
3comB           STLKGLEYLHFMRKIHRDIKAGNILLNTEG-HAKLADFGVAGQLTDMAKRNVIGTPFWMAPEVIQEIGYN
1apmE           ----QIVLTFEYLHSLDLIYRDLKPENLLIDQQGIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYN
2c47A           QLITRMEYVHTKSLIYRDVKPENFLIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQS
3c4yB           FYTSGLEHLHQRNIIYRDLKPENVLDDDGNVRISDLGLAVELKAGQTKTKGYAGTPGFMAPELLLGEEYD
2advA           PDYEQTTVWLLTNGVPERAQQWYAQQSPDFANLDAFAAG---------INAYAQQNPDDISPDVRQVLPV
3c9wA           QILRGLKYIHSANVLHRDLKPSNLLLTTCDLKICDFGLARVADPTRWYRAPEIMLNSKGYTKMLSNRPIF
2a1sB           VVEKIEDLLQSEENKNLDLEPCTGQRKLIYQTLSWKYPKGIHVET--LETEKKERYIVISKV--------
3csvA           -----SAQLEGDVFVHRDFHAQNLLWLPEREGLADFQDAKLGHRAYDLVSDARRDVPAQVEAQIDHYIQA
2bfxB           ELADALHYCHERKVIHRDIKPENLLMGYKGELKIADFGWSVHAPSLRRRMCG--TLDYLPPEMIEGKTHD
3dk7B           QISSAMEYLEKKNFIHRDLAARNCLVENHLVKVADFGLSRLMTGDTTAHAGAKFPIKWTAPESLAYNKFS
3bboU           LIYSAAAASHNKQFNKANLIISKAEVNKGITKKVKPR---------------------------------
3c5yE           II--ENSQAAKNAVVHEALTTVAEPL---GHKVFNYGYTAEDKASLTYVNGILLNSGAADFVVTGGTGGS
1b5dA           EINSNYGWAIWSEDNYAQYDMCLAELGQNPDRGIMIYTRPSMQFDYSDFMCTNTVQYLIRDKKINAVVNM
1e8xA           VYSCAGYCVATFVLGIGDRHNDNIISETGNLFHIDFGHVPFVLTPDFGTSGKKTSLHFQKFQDVCVKAYL
3c5yA           II--ENSQAAKNAVVHEALTTVAEPL---GHKVFNYGYTAEDKASLTYVNGLLAGILLADFVVTGGTGGS
2bvaA           AVLQALSVLHAQGVIHRDIKSDSILTHDGRVKLSDFGFCAQVEVP---RRKLVGTPYWMAPELISRLPYG
2eb3A           QIAKGMNYLEDRRLVHRDLAARN-----------VLVKTPQHVKITDFGRAKLVPIKWMALESILHRIYT
1b5eA           EINSNYGWAIWSEDNYAQYDMCLAELNPDSRRGIMIYTRPSMQFDYNKFMCTNTVQYLIRDKKINAVVNM
2bkkA           DFLKTEKPEEELVFSHGDLGDSNIFKDGKVSGFIDLGRSGRADKFCVRSIREDIGEEQYVELFFDLLGIK
1e8wA           VYSCAGYCVATFVLGIGDRHNDNIM-------ISETGNLFHIDFGNKERVPFVLTPDFLFVMGTSGKKTS
2bmcB           ELANALSYCHSKRVIHRDIKPENLLLGSAGELKIDFGWSVTLDYLPPEMIEGRMHDDLWSLGVLCYEFLV
3c5yB           II--ENSQAAKNAVVHEALTTVAEPL---GHKVFNYGYTAEDKASLTYVNGLLAGILLNDFVVTGGTGGS
3dlxA           -------------------------------FYTDPVEAVKDIPVLVGGFGLCGIPENLIDALLKTGVKG
3dkoA           -------------MLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGPVRWTAPEAIQYRKFT
3dajA           --------CHSKRVIHRDIKPENLLLGSNGELKIAD------------------FGWSTLDYLPPEMIHD
3dfaA           QVFSGITYMHKHNIVHRDLKPENILLKDCDIKIIDFGLSTCFTKMKDRIGTAYYIAPEVLRGTYDEKCDV
2bkkC           DFLKTEKPEEELVFSHGDLGDSIFVKDGKVSGFIDLGRSGRADKWYDIAFCVRSIREDIGEEQYVELFFD
3c5yL           II--ENSQAAKNAVVHEALTTVAEP---LGHKVFNYGYTAEDKASLTYVNGLLAGILLNSGAADFVVTGS
3dy7A           AVIKGLTYLREKHKIMHRDVKPSNILVNSRGEICDFGVSGQLIDSMANGTRS-----YMSPERLQGTHYS
3dndA           QIVLTFEYLHSLDLIYRDLKPENLLIDQQG---YIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYN
3cs9D           QISSAMEYLEKKNFIHRDLAARCLVGENHLVKVADFGLSRLMTGDTYTAHAAKFPIKWTAPESLAYNKFS
1e8zA           ---------ATFVLGIGDRHNDNIMITETGLFHIDFGH-----------ERVPFVLTPDFLFVMGTSGKK
3cqzH           --------LFDDIFQVSEVDPGRYNKCRIEAASTTQDQCKLTLAQDSLTVTIASTRSWRPPQAGDRSKFE
3da6A           QMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLA----------RTVVTRYYRAPEVILGMGYK
3dk6B           QISSAMEYLEKKNFIHRDLAARNCVGENHLVKVADFGLSRLMTGDTTAHAGAKFPIKWTAPESLAYNKFS
2a19C           ---------------------------------GDFGLVGKEELLGIISDIFDKKEKTLLQKLLSKKPER
3a5cA           AREASIYVGVTIAEYFRDQGFSVALMADSTSRWAEAL--REISSRLEEMPAEEGYPPYLAARLAAFERAG
3dlxC           -------------------------------FYTDPVEAVKDATVLVGGFGLCGIPENLIDALLKTGVKG
3ck8A           YEPRQAPFGRADKAANWLLRARLYLNAGVYTGQTDYAKAEEYASKVILFMADNDENENAMQEIILPIRQG
3cg2A           --LRGLKYIHSADIIHRDLKPSNLVNEDCELKILDFGLARTRWYRALNQTVDIWSVGCIMAELLTGRTLF
3cuqA           VCLALKHRNGGLITLEELHQQVLKGRGKVGGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEITERARQ
248lA           AAVRGILRNAKLKPVYDSLDAVRRALINMVFQMGETGVAGFTNSLRML---QQKRWDEAAVNLAKS----
3c5yF           II--ENSQAAKNAVVHEALTTVAEP---LGHKVFNYGYTAEDKASLTYVNGLLAGILLNSGAADFVTGGS
2dlaC           KKANLIIYSERKEIKPEEISIDVSTAIPTMKISDFLDLVPDEKLANYYIY---EGRVYEDLIRI------
1a0eA           ----------------------------------EIPKVQFEGKE---STNPLAFKFYDPEEIIDGDHLK
2ckoA           RSLLE-STPSPVVFCHNDCQEGNILLLEGRENSEKQKLML-----IDFEYSSYNYRGFDIGNHFCEWMYD
2dq7X           ---------RMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNETARQGAKFPIKWTAPEAALYGRFT
3e8cE           QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAK---RVKGRTWLCGTPEYLAPEIILSKGYN
2b5mA           GIIGIIDPECRMIGLRLYDGLFKVILDRDNKELKAFNILEELHVIDVKFLYGCQAPTICFVYQDPQGRHV
3dqwA           ----------------------------------------------------------------------
2chxA           ----------------------------------------------------------------------
2ckqA           -------------FCHNDCQEGNILKQKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYSYEKYPFFRANIR
3e3pA           --SIGCLHLPSVNVCHRDIKPHNVLVNEADGTLCDFGSAKKLSPSEPNVAYICSRYYRAPELIFGNQHYT
3ckcA           ---------------NAGVYTGQTDYAKAEEYASKVIGSKLCTNYSELFMADNDENENAMQEIILPIRQG
3cq9D           PHLTLPDEKDAAYNAYPISWASNEFSNTGHFSFDAGVLAV------------------------------
1bygA           -----MEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLL--------------PVKWTAPEALREKKFS
3daeA           ---------------------------------------------------------NYAAPEVISGKLY
3daeB           ---------------------------------------------------------NYAAPEVISGKLY
3dkgA           QVAKGMKFLASKKFVHRDLAARNCLDEKFTVKVADFGLARLPVK-------------WMALESLQTQKFT
3dplC           ---------IEHKYIRRDESDINTF---------------------------------------------
2ae4A           PDYEQTTVWLLTNGVPERAQQWYAQQSPDFRANLDAFAAGI-------NAYAQQNPDDISPDVRQVLPVS
3dlxB           -------------------------------FYTDPVEAVKDATVLVGGFGLCGIPENLIDALLKTGVKG
3cq9B           LPHLTLPDEDAAYNAYPISWASNESGNTGHFSFDAGVLAVIQ----------------------------
1a35A           KCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQ
3bdeB           ----------------------------------------------------------------------
3dyhA           VCGWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYRHPDVTVQCINDGLLLKSWTHMMAMHFFA--------
3cokA           ----------------------------------------------------------SNLLLTRNMNIK
2amuA           GTIIALSNIHGLWESSQKIT--------------------------------------------------
3dyhB           VCGWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYRHPDVTVQCAGLLLKSWTHMMAMHFFADRPFLQDLLC
3bdeA           ----------------------------------------------------------------------
2b8uA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PAVDMFAWGATLVYAANGRGPFGHGSLKAVVQRVINDEPDFGELSGTLREIAERCLNKDAAQRPTAAETL
3dbsA           LRHHTNLLIILFSMMLMTGMPQLTSEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGWTVQFNWFLHL
3dk6A           IKSDVWAFGVLLWEIATYGMSPYPGIDPSQVYELLEKDERPEGCPEKVYELMRACWQWNPSDRPSFAEIH
3c5iA           KYISYENRKLFITAYLSNYLPTPKLIDEILEAVEVQALLLWGFWSIIRGYQTKFDFFLYAEQRLKMYDDQ
2c47C           RRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLR
2bmcF           FLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLSQRPMLREVLEHPWITANSSKPSNCQ--
2e2bA           IKSDVWAFGVLLWEIATYGMSPPGIDLSQVYELLEKDMERPEGCPEKVYELMRACWQWNPSDRPSFAEIH
2bmcA           FLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLKHNPSQRPMLREVLEHPWITANSSKPSNCQ--
3csfA           LRHHTNLLIILFMMLMTGMPQLTSKEDIEYIRDALTVGK----NEEDAKKYFLDQIEVCRDKGWTVQFNW
3dxnA           CGVILYILLCGYPPFGGQTDQEILKRVEKGKFSFDPPDWTQ--VSDEAKQLVKLMLTYEPSKRISAEEAL
3bceA           HQSDVWSYGVTIWELMTFGGKPYDGPTREIPDLLEKGEPQPPICTIDVYMVMVKCWMIDADSRPKFKE--
3c0iA           KPXXXXXXXXXXXXXXXXXXXXXXXKFEGIIKGKYKMNPQWSHISESAKDLVRRMLMLDPAERITVYEAL
3byvA           FSFDAWALGLVIYWIWCADLPIGGSEWIFRSCKNIPQPVRALLEGFLRYPKEDRLLPLQAMETPEYEQLR
3e87A           RAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFRTLSPEAKSLLAGLLKKDPKQRLGGGPSD
2c3jA           EPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNIDSAPLALLHKILVENPSARITIPDIK
1cdkA           KAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFSHFSSDLKDLLRNLLQVDLTKRFGNLK--
3c0gA           KPXXXXXXXXXXXXXXXXXXXXXXXKFEGIIKGKYKNPRQWSHISESAKDLVRRMLMLDPAERITVYEAL
3ei1A           TYEVSLREKEFNKGPWKQENVEAE----------------------------------------------
2chwA           LRHHTNLLIILFSMMLMTMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGWTVQFNWFL--
1cmkE           KAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFSHFSSDLKDLLRNLLQVDLTKRF------
3dkfA           TKSDVWSFGVLLWELMTRGAPPYPDNTFDITVYLLQGRRLLEYCPDPLYEVMLKCWHPKAEMRPSFSE--
2brmA           DVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKIDSAPLALLHKILVENPSARITIPDIK
2dwbA           EKVDLWSLGVLCYEFLVGKPPFANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPLR----
2ckpB           RKYPTKKQQLHFISSYLPAFQFENLSTEEKSIIKMLLEVNRFALASHFLWGLWAQARFDAYFHQK-----
3blrA           PPIDLWGAGCIMAEMWTRSPIMQGNTYEKLELVKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDAL
3ckwA           SKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPLEGNYSKPLKEFVEACLNKEPSFRPTAKELL
3bhhC           KPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAPEWDTVTPEAKNLINQMLTINPAKRITAHEAL
2cgxA           EPVDVWSCGIVLTAMLAGELPWDQSCQEYSDWKEKKTYLNPWKIDSAPLALLHKILVENPSARITIPDIK
2ckoB           RKYPTKKQQLHFSYLPAFQNDFENLSTEEKSIIKEEMLLEVNRLWGLWSIVQAKISSIEFGYMDYAQARF
2e2bB           IKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMEGCPEKVYELMRACWQWNPSDRPSFAE--
3c5iD           KYISYENRKLFITAYLSNYLDKVVPTPKLIDEILEAVEVQALGLLWGFWSIIRGYQTKSYNEFDFFLYAE
3bhhD           KPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAPEWDTVTPEAKNLINQMLTINPAKRITAHEAL
3e5aA           EKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRSRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVL
3dxpA           LGIPDEASYRKLYEQRTGRPITGDWNFYLAFSFRIARVVDGTASSAQALDAGKRARPAEGWEYAKKA---
1e7uA           HFQKFQDVCVKAYLALR-----HHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKSEEDAKKY--
1e7vA           HFQKFQDVCVKAYLALR-----HHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKSEEDAKKYFL
3bhhB           KPVDIWACGVILYILLVGYPPFWDEDQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEAL
3comB           CVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRWSDNFTDFVKQCLVKSPEQRATATQLL
1apmE           KAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFSHFSSDLKDLLRNLLQVDLTKRFGNLKNG
2c47A           RRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLR
3c4yB           FSVDYFALGVTLYEMIAARGPFRARGEKVENKELKQAVTYPDKFSPASKDFCEALLQKDPEKRLGFRDGS
2advA           SGADVVAHAHRLMNFLYVASPG------------------------------------------------
3c9wA           PGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNLDLLDKMLTFNPHKRIEVEQAL
2a1sB           ----------------------------------------------------------------------
3csvA           TGVDESHFRSAYAVIAVQRNRI-LGIFARLSQR--FGKRHYIEFVPRVWAHFERGL-AHPALASAAEE--
2bfxB           EKVDLWCAGVLCYEFLVGMPPFDSPSHTETHRRIVNVDLKFPPLSDGSKDLISKLLRYHPPQRLPLKGVM
3dk7B           IKSDVWAFGVLLWEIATYGMSPYPGIDPSQVYELLEKDYRMERPEGCPEKLMRACWQWNPSDRPSFAE--
3bboU           ----------------------------------------------------------------------
3c5yE           LAANAPGVFCGLVIDPTDAQINDGNAISPYSKGFGWAAELNLQDVYRKLFDGERGLGYPRERAEIRKNRG
1b5dA           RSNDVVAWQKYVLDKVSDLNAGDSTRQYKAGSIIWN--VGSLHVYSRHFYLVDHWWKTGETHISK-----
1e8xA           ALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKSDAKKYFLDQIEVCRDKGWTVQFNWFLHL
3c5yA           LAANAPGVFCGLVIDPTDAFLFGQINDGNAISPYSKGFAAELNLQDVYRKLFDGERGLGYPRE-------
2bvaA           PEVDIWSLGIMVIEMVDGEPPYFNEPMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELL
2eb3A           HQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQCTIDVYMIMVKCWMIDADSRPKF----
1b5eA           RSNDVVYAKYVLDKLVSDLNAGDSTRQYKAGSIIWNVGS--LHVYSRHFYLVDHWWKTGETHISK-----
2bkkA           PDWEKIKYYILL----------------------------------------------------------
1e8wA           LHFQKFDVCVKAYLALRHHTNLLIILFS---MMLMTGMPQL--TSKEDIEYIRDALTVGKSEEDAKKYFL
2bmcB           GKPPFEANTYQETYKRISRVEFTFPDARDLISRLLKHNPSQRP---MLREVLEHPWITANSSKPSNCQ--
3c5yB           LAANAPGVFCGLVIDPTDAFLFGQINDGNAISPYSAEIRKNRGILRELKDASCRDLTVLKTVDQDLLRAA
3dlxA           LTAVVDNFGGLLLRSKQIKRMSYVGENAEFERQYLSGELEVTPQGTLAERIRAGGAGVPAFYTPTGYGT-
3dkoA           SASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGPAPMDCPAGLHQLMLDCWQKERAERPKFEQIV
3dajA           EKVDLWSLGVLCYEFLVGMPPFAHTYQETYRRISRVEFTFPDFVTEGARDLISRLLKHNASQRLTLAEVL
3dfaA           WSAGVILYILLSGTPPFYGKNEYDILKRVETGKYAFDLPQWRTISDDAKDLIRKMLTFHPSLRITATQCL
2bkkC           PDWEKIKYYILL----------------------------------------------------------
3c5yL           LAANAPGVFCGLVIDPTDAFLF------------------------------------------------
3dy7A           VQSDIWSMGLSLVEMAVGRYPIPPPPMAILLDYIVNEPPPKGVFSLEFQDFVNKCLIKNPAERADLKQLM
3dndA           KAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFSHFSSDLKDLLRNLLQVD-----------
3cs9D           IKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDERPEGCPEKVYELMRACWQWNPSDRPSFAEIH
1e8zA           TSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQL--TSKEDIEYIRDALTVGKNEEDAKKYFL
3cqzH           EVSKVYSFGGLLMRLEENAYLL------------------------------------------------
3da6A           ENVDIWSVGCIM----------------------------------------------------------
3dk6B           IKSDVWAFGVLLWEIATYGMSPYPGIDPSQVYELLEKDYRMERCPEKVYELMRACWQWNPSDRPSFAEIH
2a19C           PNTSEILRTLTV----------------------------------------------------------
3a5cA           KVITLGGEEGAVTIVGAVSPPGGDMSEPVTSTLRIVGAFWRLD-----ASLAFHFPAINWNGSYSLFTSA
3dlxC           LGVDNFGLGLLLRSKQIKRMVSYVGENAEFERQYLSGELEVELPQGTLAERIRAGGAGVPAFYTPTGY--
3ck8A           VKTRN--YGGSTYLVCGTRVAGM-----------------------------------------------
3cg2A           PGTDHIDQLKLILRLVGTPGELLKKISSESARNYIQSLTQMIGANPLAVDLLEKMLVLDSDKRITAAQAL
3cuqA           VLEHLLKEGLAWLDLQAPGEAH------------------------------------------------
248lA           ----------------------------------------------------------------------
3c5yF           LAANAPGVFCGLVIDPTDAFLFGQINDGNAISPYSAEIRKNRGILRELKDASCRDLTVLKTVDQDLLRAA
2dlaC           ----------------------------------------------------------------------
1a0eA           FSVAFWHTFVNEGRDPFGDPTADRPWNRYTDPMDKAFARVDLFEFCEKLNIEYFCFHDRDIAPEG-----
2ckoA           YSYEKYPFFRANIRKYPTKKQQHFISSYLPAFQNDFENLSTEEKSIIKEEMLLEV------NRFALASHF
2dq7X           IKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERMPCPQDCPISLHELMIHCWKKDPEERPTFEY--
3e8cE           KAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSFSSDLKDLLRNLLQVDLTKRFGNLKNG
2b5mA           KTYEVSLREKEFNKGPWKQENVEA----------------------------------------------
3dqwA           ----VWSFGILLTELTTKGRVPYPGMVNREVLDQVERGPCPPECPESLHDLMCQCWRKDPEERPTFEYLQ
2chxA           ---HTNLLIILFSMMLMTGMPQLTSEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGWTVQFNWFLHL
2ckqA           KYPTKKQQLHFISSYLPAFQNDFENLSTEEKSIIKEEMALASHFLWGLWSIVQAKISSIEFGYMDYAQAR
3e3pA           TAVDIWSVGCIFAEMMLGEPIFRGDNNSKGIPWSNVFSDHSLKDAKEAYDLLSALLQYLPEERMKPYEAL
3ckcA           VKTRN--YGGSTYLVCPRMGTTNGWSIFARAAMVQKFNLEDVPMLPADVEIPTKGLDTDEQIDAFDAE--
3cq9D           ----------------------------------------------------------------------
1bygA           TKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGDAPDGCPPAVYEVMKNCWHLDAAMRPSFLQLR
3daeA           AGPEVDVWSCGVILYVMRRLPFDDESIPVLFKNISNGVYTLPKLSPGAAGLIKRMLIVNPLNRISIHEIM
3daeB           AGPEVDVWSCGVILYVMRRLPFDDESIPVLFKNISNGVYTLPKLSPGAAGLIKRMLIVNPLNRISIHEIM
3dkgA           TKSDVWSFGVLLWELMTRGAPPYPDVTVYLLQGRRLLQPEY--CPDPLYEVMLKCWHPKAEMRPSFSELV
3dplC           ----------------------------------------------------------------------
2ae4A           G-ADVVAHAHRLMNFLYVASPG------------------------------------------------
3dlxB           AGVDNFGLGLLLRSKQIKRMVSSYV---------------------------------------------
3cq9B           ----------------------------------------------------------------------
1a35A           EYVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLLQDLMEGLTAKVFRTYNASITLQQQ--
3bdeB           ----------------------------------------------------------------------
3dyhA           ----------------------------------------------------------------------
3cokA           IADFGLATQLKESDVWSLGCMFYTLLIGRPPFDTDTVKEMPSFLSIEAKDLIHQLLRRNPADRLSLSSVL
2amuA           ----------------------------------------------------------------------
3dyhB           RFNRVDYTTAVGQLYDVTSMFDSN----------------------------------------------
3bdeA           ----------------------------------------------------------------------
2b8uA           --CDITLQEIIKTLNSLTEQKTLCTELNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLI


                         .         *         .         .         .         .         +:350
query           MLVLGIEGPPPTEEPSTDTAIPVTHQTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dbsA           V---------------------------------------------------------------------
3dk6A           ----------------------------------------------------------------------
3c5iA           LISN------------------------------------------------------------------
2c47C           KLFTDLFDRSGFVFD-------------------------------------------------------
2bmcF           ----------------------------------------------------------------------
2e2bA           ----------------------------------------------------------------------
2bmcA           ----------------------------------------------------------------------
3csfA           FL--------------------------------------------------------------------
3dxnA           ----------------------------------------------------------------------
3bceA           ----------------------------------------------------------------------
3c0iA           ----------------------------------------------------------------------
3byvA           TELSAALPL-------------------------------------------------------------
3e87A           ----------------------------------------------------------------------
2c3jA           ----------------------------------------------------------------------
1cdkA           ----------------------------------------------------------------------
3c0gA           ----------------------------------------------------------------------
3ei1A           ----------------------------------------------------------------------
2chwA           ----------------------------------------------------------------------
1cmkE           ----------------------------------------------------------------------
3dkfA           ----------------------------------------------------------------------
2brmA           ----------------------------------------------------------------------
2dwbA           ----------------------------------------------------------------------
2ckpB           ----------------------------------------------------------------------
3blrA           ----------------------------------------------------------------------
3ckwA           K---------------------------------------------------------------------
3bhhC           KHPWVCQRSTVASMMHRQETVE------------------------------------------------
2cgxA           ----------------------------------------------------------------------
2ckoB           D---------------------------------------------------------------------
2e2bB           ----------------------------------------------------------------------
3c5iD           RLKMYDDQKENNIIKGYD----------------------------------------------------
3bhhD           KHPWVCQRSTVASMMHRQETVE------------------------------------------------
3e5aA           ----------------------------------------------------------------------
3dxpA           ----------------------------------------------------------------------
1e7uA           ----------------------------------------------------------------------
1e7vA           DQI-------------------------------------------------------------------
3bhhB           KHPWVCQRSTVASMMHRQETVE------------------------------------------------
3comB           ----------------------------------------------------------------------
1apmE           VNDIKNHKWFA-----------------------------------------------------------
2c47A           KLFTDLFDRSGFVFD-------------------------------------------------------
3c4yB           C---------------------------------------------------------------------
2advA           ----------------------------------------------------------------------
3c9wA           AHPYLEQYYDPSDEP-------------------------------------------------------
2a1sB           ----------------------------------------------------------------------
3csvA           ILNALPAPAPEVLE--------------------------------------------------------
2bfxB           EHPWVKANSRRVLPP-------------------------------------------------------
3dk7B           ----------------------------------------------------------------------
3bboU           ----------------------------------------------------------------------
3c5yE           I---------------------------------------------------------------------
1b5dA           ----------------------------------------------------------------------
1e8xA           VL--------------------------------------------------------------------
3c5yA           ----------------------------------------------------------------------
2bvaA           ----------------------------------------------------------------------
2eb3A           ----------------------------------------------------------------------
1b5eA           ----------------------------------------------------------------------
2bkkA           ----------------------------------------------------------------------
1e8wA           DQI-------------------------------------------------------------------
2bmcB           ----------------------------------------------------------------------
3c5yB           I---------------------------------------------------------------------
3dlxA           ----------------------------------------------------------------------
3dkoA           ILDKMIRNPNS-----------------------------------------------------------
3dajA           ----------------------------------------------------------------------
3dfaA           ----------------------------------------------------------------------
2bkkC           ----------------------------------------------------------------------
3c5yL           ----------------------------------------------------------------------
3dy7A           ----------------------------------------------------------------------
3dndA           ----------------------------------------------------------------------
3cs9D           ----------------------------------------------------------------------
1e8zA           DQIEVCRDKGWTVQF-------------------------------------------------------
3cqzH           ----------------------------------------------------------------------
3da6A           ----------------------------------------------------------------------
3dk6B           AFETMFQESSISDE--------------------------------------------------------
2a19C           ----------------------------------------------------------------------
3a5cA           ----------------------------------------------------------------------
3dlxC           ----------------------------------------------------------------------
3ck8A           ----------------------------------------------------------------------
3cg2A           ----------------------------------------------------------------------
3cuqA           ----------------------------------------------------------------------
248lA           ----------------------------------------------------------------------
3c5yF           I---------------------------------------------------------------------
2dlaC           ----------------------------------------------------------------------
1a0eA           ----------------------------------------------------------------------
2ckoA           LWGLWSIVQAKISSIEFG----------------------------------------------------
2dq7X           ----------------------------------------------------------------------
3e8cE           V---------------------------------------------------------------------
2b5mA           ----------------------------------------------------------------------
3dqwA           FLEDYFTSTEPQYQPGEN----------------------------------------------------
2chxA           VL--------------------------------------------------------------------
2ckqA           FD--------------------------------------------------------------------
3e3pA           CHPYFDELHDPATKLPNNKDLP------------------------------------------------
3ckcA           ----------------------------------------------------------------------
3cq9D           ----------------------------------------------------------------------
1bygA           ----------------------------------------------------------------------
3daeA           ----------------------------------------------------------------------
3daeB           ----------------------------------------------------------------------
3dkgA           ----------------------------------------------------------------------
3dplC           ----------------------------------------------------------------------
2ae4A           ----------------------------------------------------------------------
3dlxB           ----------------------------------------------------------------------
3cq9B           ----------------------------------------------------------------------
1a35A           ----------------------------------------------------------------------
3bdeB           ----------------------------------------------------------------------
3dyhA           ----------------------------------------------------------------------
3cokA           ----------------------------------------------------------------------
2amuA           ----------------------------------------------------------------------
3dyhB           ----------------------------------------------------------------------
3bdeA           ----------------------------------------------------------------------
2b8uA           FLKRLDRNLWGLAGLNSCPVKEANQST-------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dbsA           ----------------------------------------------------------------------
3dk6A           ----------------------------------------------------------------------
3c5iA           ----------------------------------------------------------------------
2c47C           ----------------------------------------------------------------------
2bmcF           ----------------------------------------------------------------------
2e2bA           ----------------------------------------------------------------------
2bmcA           ----------------------------------------------------------------------
3csfA           ----------------------------------------------------------------------
3dxnA           ----------------------------------------------------------------------
3bceA           ----------------------------------------------------------------------
3c0iA           ----------------------------------------------------------------------
3byvA           ----------------------------------------------------------------------
3e87A           ----------------------------------------------------------------------
2c3jA           ----------------------------------------------------------------------
1cdkA           ----------------------------------------------------------------------
3c0gA           ----------------------------------------------------------------------
3ei1A           ----------------------------------------------------------------------
2chwA           ----------------------------------------------------------------------
1cmkE           ----------------------------------------------------------------------
3dkfA           ----------------------------------------------------------------------
2brmA           ----------------------------------------------------------------------
2dwbA           ----------------------------------------------------------------------
2ckpB           ----------------------------------------------------------------------
3blrA           ----------------------------------------------------------------------
3ckwA           ----------------------------------------------------------------------
3bhhC           ----------------------------------------------------------------------
2cgxA           ----------------------------------------------------------------------
2ckoB           ----------------------------------------------------------------------
2e2bB           ----------------------------------------------------------------------
3c5iD           ----------------------------------------------------------------------
3bhhD           ----------------------------------------------------------------------
3e5aA           ----------------------------------------------------------------------
3dxpA           ----------------------------------------------------------------------
1e7uA           ----------------------------------------------------------------------
1e7vA           ----------------------------------------------------------------------
3bhhB           ----------------------------------------------------------------------
3comB           ----------------------------------------------------------------------
1apmE           ----------------------------------------------------------------------
2c47A           ----------------------------------------------------------------------
3c4yB           ----------------------------------------------------------------------
2advA           ----------------------------------------------------------------------
3c9wA           ----------------------------------------------------------------------
2a1sB           ----------------------------------------------------------------------
3csvA           ----------------------------------------------------------------------
2bfxB           ----------------------------------------------------------------------
3dk7B           ----------------------------------------------------------------------
3bboU           ----------------------------------------------------------------------
3c5yE           ----------------------------------------------------------------------
1b5dA           ----------------------------------------------------------------------
1e8xA           ----------------------------------------------------------------------
3c5yA           ----------------------------------------------------------------------
2bvaA           ----------------------------------------------------------------------
2eb3A           ----------------------------------------------------------------------
1b5eA           ----------------------------------------------------------------------
2bkkA           ----------------------------------------------------------------------
1e8wA           ----------------------------------------------------------------------
2bmcB           ----------------------------------------------------------------------
3c5yB           ----------------------------------------------------------------------
3dlxA           ----------------------------------------------------------------------
3dkoA           ----------------------------------------------------------------------
3dajA           ----------------------------------------------------------------------
3dfaA           ----------------------------------------------------------------------
2bkkC           ----------------------------------------------------------------------
3c5yL           ----------------------------------------------------------------------
3dy7A           ----------------------------------------------------------------------
3dndA           ----------------------------------------------------------------------
3cs9D           ----------------------------------------------------------------------
1e8zA           ----------------------------------------------------------------------
3cqzH           ----------------------------------------------------------------------
3da6A           ----------------------------------------------------------------------
3dk6B           ----------------------------------------------------------------------
2a19C           ----------------------------------------------------------------------
3a5cA           ----------------------------------------------------------------------
3dlxC           ----------------------------------------------------------------------
3ck8A           ----------------------------------------------------------------------
3cg2A           ----------------------------------------------------------------------
3cuqA           ----------------------------------------------------------------------
248lA           ----------------------------------------------------------------------
3c5yF           ----------------------------------------------------------------------
2dlaC           ----------------------------------------------------------------------
1a0eA           ----------------------------------------------------------------------
2ckoA           ----------------------------------------------------------------------
2dq7X           ----------------------------------------------------------------------
3e8cE           ----------------------------------------------------------------------
2b5mA           ----------------------------------------------------------------------
3dqwA           ----------------------------------------------------------------------
2chxA           ----------------------------------------------------------------------
2ckqA           ----------------------------------------------------------------------
3e3pA           ----------------------------------------------------------------------
3ckcA           ----------------------------------------------------------------------
3cq9D           ----------------------------------------------------------------------
1bygA           ----------------------------------------------------------------------
3daeA           ----------------------------------------------------------------------
3daeB           ----------------------------------------------------------------------
3dkgA           ----------------------------------------------------------------------
3dplC           ----------------------------------------------------------------------
2ae4A           ----------------------------------------------------------------------
3dlxB           ----------------------------------------------------------------------
3cq9B           ----------------------------------------------------------------------
1a35A           ----------------------------------------------------------------------
3bdeB           ----------------------------------------------------------------------
3dyhA           ----------------------------------------------------------------------
3cokA           ----------------------------------------------------------------------
2amuA           ----------------------------------------------------------------------
3dyhB           ----------------------------------------------------------------------
3bdeA           ----------------------------------------------------------------------
2b8uA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dbsA           ----------------------------------------------------------------------
3dk6A           ----------------------------------------------------------------------
3c5iA           ----------------------------------------------------------------------
2c47C           ----------------------------------------------------------------------
2bmcF           ----------------------------------------------------------------------
2e2bA           ----------------------------------------------------------------------
2bmcA           ----------------------------------------------------------------------
3csfA           ----------------------------------------------------------------------
3dxnA           ----------------------------------------------------------------------
3bceA           ----------------------------------------------------------------------
3c0iA           ----------------------------------------------------------------------
3byvA           ----------------------------------------------------------------------
3e87A           ----------------------------------------------------------------------
2c3jA           ----------------------------------------------------------------------
1cdkA           ----------------------------------------------------------------------
3c0gA           ----------------------------------------------------------------------
3ei1A           ----------------------------------------------------------------------
2chwA           ----------------------------------------------------------------------
1cmkE           ----------------------------------------------------------------------
3dkfA           ----------------------------------------------------------------------
2brmA           ----------------------------------------------------------------------
2dwbA           ----------------------------------------------------------------------
2ckpB           ----------------------------------------------------------------------
3blrA           ----------------------------------------------------------------------
3ckwA           ----------------------------------------------------------------------
3bhhC           ----------------------------------------------------------------------
2cgxA           ----------------------------------------------------------------------
2ckoB           ----------------------------------------------------------------------
2e2bB           ----------------------------------------------------------------------
3c5iD           ----------------------------------------------------------------------
3bhhD           ----------------------------------------------------------------------
3e5aA           ----------------------------------------------------------------------
3dxpA           ----------------------------------------------------------------------
1e7uA           ----------------------------------------------------------------------
1e7vA           ----------------------------------------------------------------------
3bhhB           ----------------------------------------------------------------------
3comB           ----------------------------------------------------------------------
1apmE           ----------------------------------------------------------------------
2c47A           ----------------------------------------------------------------------
3c4yB           ----------------------------------------------------------------------
2advA           ----------------------------------------------------------------------
3c9wA           ----------------------------------------------------------------------
2a1sB           ----------------------------------------------------------------------
3csvA           ----------------------------------------------------------------------
2bfxB           ----------------------------------------------------------------------
3dk7B           ----------------------------------------------------------------------
3bboU           ----------------------------------------------------------------------
3c5yE           ----------------------------------------------------------------------
1b5dA           ----------------------------------------------------------------------
1e8xA           ----------------------------------------------------------------------
3c5yA           ----------------------------------------------------------------------
2bvaA           ----------------------------------------------------------------------
2eb3A           ----------------------------------------------------------------------
1b5eA           ----------------------------------------------------------------------
2bkkA           ----------------------------------------------------------------------
1e8wA           ----------------------------------------------------------------------
2bmcB           ----------------------------------------------------------------------
3c5yB           ----------------------------------------------------------------------
3dlxA           ----------------------------------------------------------------------
3dkoA           ----------------------------------------------------------------------
3dajA           ----------------------------------------------------------------------
3dfaA           ----------------------------------------------------------------------
2bkkC           ----------------------------------------------------------------------
3c5yL           ----------------------------------------------------------------------
3dy7A           ----------------------------------------------------------------------
3dndA           ----------------------------------------------------------------------
3cs9D           ----------------------------------------------------------------------
1e8zA           ----------------------------------------------------------------------
3cqzH           ----------------------------------------------------------------------
3da6A           ----------------------------------------------------------------------
3dk6B           ----------------------------------------------------------------------
2a19C           ----------------------------------------------------------------------
3a5cA           ----------------------------------------------------------------------
3dlxC           ----------------------------------------------------------------------
3ck8A           ----------------------------------------------------------------------
3cg2A           ----------------------------------------------------------------------
3cuqA           ----------------------------------------------------------------------
248lA           ----------------------------------------------------------------------
3c5yF           ----------------------------------------------------------------------
2dlaC           ----------------------------------------------------------------------
1a0eA           ----------------------------------------------------------------------
2ckoA           ----------------------------------------------------------------------
2dq7X           ----------------------------------------------------------------------
3e8cE           ----------------------------------------------------------------------
2b5mA           ----------------------------------------------------------------------
3dqwA           ----------------------------------------------------------------------
2chxA           ----------------------------------------------------------------------
2ckqA           ----------------------------------------------------------------------
3e3pA           ----------------------------------------------------------------------
3ckcA           ----------------------------------------------------------------------
3cq9D           ----------------------------------------------------------------------
1bygA           ----------------------------------------------------------------------
3daeA           ----------------------------------------------------------------------
3daeB           ----------------------------------------------------------------------
3dkgA           ----------------------------------------------------------------------
3dplC           ----------------------------------------------------------------------
2ae4A           ----------------------------------------------------------------------
3dlxB           ----------------------------------------------------------------------
3cq9B           ----------------------------------------------------------------------
1a35A           ----------------------------------------------------------------------
3bdeB           ----------------------------------------------------------------------
3dyhA           ----------------------------------------------------------------------
3cokA           ----------------------------------------------------------------------
2amuA           ----------------------------------------------------------------------
3dyhB           ----------------------------------------------------------------------
3bdeA           ----------------------------------------------------------------------
2b8uA           ----------------------------------------------------------------------