[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ54591.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bfdA.bssp"
#ERROR : Can't open dsspfile "2ag1A.bssp"
#ERROR : Can't open dsspfile "2c31A.bssp"
#ERROR : Can't open dsspfile "3ea4A.bssp"
#ERROR : Can't open dsspfile "3clsD.bssp"
#ERROR : Can't open dsspfile "3clrD.bssp"
#ERROR : Can't open dsspfile "3cltD.bssp"
#ERROR : Can't open dsspfile "3cluD.bssp"
#ERROR : Can't open dsspfile "2a1tR.bssp"
#ERROR : Can't open dsspfile "1efvA.bssp"
#ERROR : Can't open dsspfile "3e12B.bssp"
#ERROR : Can't open dsspfile "3dv0C.bssp"
#ERROR : Can't open dsspfile "2ef9B.bssp"
#ERROR : Can't open dsspfile "3dv0E.bssp"
#ERROR : Can't open dsspfile "3dv0G.bssp"
#ERROR : Can't open dsspfile "2a1uA.bssp"
#ERROR : Can't open dsspfile "2beuA.bssp"
#ERROR : Can't open dsspfile "3dvaA.bssp"
#ERROR : Can't open dsspfile "3e12A.bssp"
#ERROR : Can't open dsspfile "1efpA.bssp"
#ERROR : Can't open dsspfile "2bffA.bssp"
#ERROR : Can't open dsspfile "2bfdA.bssp"
#ERROR : Can't open dsspfile "2b4yB.bssp"
#ERROR : Can't open dsspfile "3dvaE.bssp"
#ERROR : Can't open dsspfile "2bfbA.bssp"
#ERROR : Can't open dsspfile "2b4yD.bssp"
#ERROR : Can't open dsspfile "2bfeA.bssp"
#ERROR : Can't open dsspfile "3dv0A.bssp"
#ERROR : Can't open dsspfile "2bp7A.bssp"
#ERROR : Can't open dsspfile "1cc0E.bssp"
#ERROR : Can't open dsspfile "1ajwA.bssp"
#ERROR : Can't open dsspfile "2ef9A.bssp"
#ERROR : Can't open dsspfile "2bfcA.bssp"
#ERROR : Can't open dsspfile "1dtwA.bssp"
#ERROR : Can't open dsspfile "2b4yA.bssp"
#ERROR : Can't open dsspfile "16pkA.bssp"
#ERROR : Can't open dsspfile "3c38A.bssp"
#ERROR : Can't open dsspfile "1ay0A.bssp"
#ERROR : Can't open dsspfile "2bxwA.bssp"
#ERROR : Can't open dsspfile "2b4yC.bssp"
#ERROR : Can't open dsspfile "2e6kA.bssp"
#ERROR : Can't open dsspfile "3d4bA.bssp"
#ERROR : Can't open dsspfile "1e3tA.bssp"
#ERROR : Can't open dsspfile "1d4oA.bssp"
#ERROR : Can't open dsspfile "2c3yB.bssp"
#ERROR : Can't open dsspfile "1e20A.bssp"
#ERROR : Can't open dsspfile "1djlA.bssp"
#ERROR : Can't open dsspfile "3cf4G.bssp"
#ERROR : Can't open dsspfile "3dv0A.bssp"

## Summary of PDB Search
:553
    2e-70  22%  1bfdA  [x.x.x] BENZOYLFORMATE DECARBOXYLASE
    3e-66  22%  2ag1A  [x.x.x] BENZALDEHYDE LYASE
    3e-56  24%  2c31A  [x.x.x] OXALYL-COA DECARBOXYLASE
    2e-55  25%  3ea4A  [x.x.x] ACETOLACTATE SYNTHASE, CHLOROPLASTIC
    5e-35   9%  3clsD  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT ALPHA
    3e-31   8%  3clrD  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT ALPHA
    5e-30   9%  3cltD  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT ALPHA
    3e-29   9%  3cluD  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT ALPHA
    2e-26  11%  2a1tR  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN ALPHA-SUBUNIT,
    1e-20  11%  1efvA  [c.26.2 - c.31.1] ELECTRON TRANSFER FLAVOPROTEIN
    3e-19  14%  3e12B  [x.x.x] 2-DEHYDRO-3-DEOXYPHOSPHOOCTONATE ALDOLASE
    4e-19  12%  3dv0C  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    2e-18  12%  2ef9B  [x.x.x] 2-DEHYDRO-3-DEOXYPHOSPHOOCTONATE ALDOLASE
    4e-18  12%  3dv0E  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    6e-18  12%  3dv0G  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    6e-18  11%  2a1uA  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN ALPHA-SUBUNIT,
    3e-17  14%  2beuA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    4e-17  13%  3dvaA  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    5e-17  12%  3e12A  [x.x.x] 2-DEHYDRO-3-DEOXYPHOSPHOOCTONATE ALDOLASE
    5e-17  15%  1efpA  [c.26.2 - c.31.1] PROTEIN (ELECTRON TRANSFER FLAVOPROTEIN)
    1e-16  13%  2bffA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    5e-16  14%  2bfdA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    7e-16   9%  2b4yB  [x.x.x] NAD-DEPENDENT DEACETYLASE SIRTUIN-5
    2e-15  12%  3dvaE  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    1e-14  13%  2bfbA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    2e-14   9%  2b4yD  [x.x.x] NAD-DEPENDENT DEACETYLASE SIRTUIN-5
    2e-14  15%  2bfeA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    5e-14  11%  3dv0A  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    8e-14   9%  2bp7A  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    9e-14  13%  1cc0E  [b.1.18] RHO GDP DISSOCIATION INHIBITOR ALPHA
    1e-13  10%  1ajwA  [x.x.x] RHOGDI
    2e-13  10%  2ef9A  [x.x.x] 2-DEHYDRO-3-DEOXYPHOSPHOOCTONATE ALDOLASE
    3e-13  12%  2bfcA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    5e-13  13%  1dtwA  [c.36.1] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE
    5e-13  11%  2b4yA  [x.x.x] NAD-DEPENDENT DEACETYLASE SIRTUIN-5
    5e-12   5%  16pkA  [c.86.1 (13pkA)] 3-PHOSPHOGLYCERATE KINASE
    3e-11  10%  3c38A  [x.x.x] AUTOINDUCER 2 SENSOR KINASE/PHOSPHATASE LUXQ
    8e-11  15%  1ay0A  [c.36.1 - c.36.1 - c.48.1] TRANSKETOLASE
    8e-11  15%  2bxwA  [x.x.x] RHO GDP-DISSOCIATION INHIBITOR 1
    2e-09  10%  2b4yC  [x.x.x] NAD-DEPENDENT DEACETYLASE SIRTUIN-5
    1e-08  20%  2e6kA  [x.x.x] TRANSKETOLASE
    4e-08  11%  3d4bA  [x.x.x] NAD-DEPENDENT DEACETYLASE
    8e-07  11%  1e3tA  [c.31.1] NICOTINAMIDE NUCLEOTIDE TRANSHYDROGENASE
    2e-05   8%  1d4oA  [c.31.1] NADP(H) TRANSHYDROGENASE
    3e-05  18%  2c3yB  [x.x.x] PYRUVATE-FERREDOXIN OXIDOREDUCTASE
    1e-04  12%  1e20A  [c.34.1] HALOTOLERANCE PROTEIN HAL3
    2e-04  11%  1djlA  [c.31.1] TRANSHYDROGENASE DIII
    0.001  16%  3cf4G  [x.x.x] ACETYL-COA DECARBONYLASE/SYNTHASE EPSILON
    8e-05  15%  3dv0A  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT(query 11->174)
:553

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxTGHGGNHAVEVARHHGVDTLFTLSGGHIFPIYDGAVKADPPMRLLDVRHEQTAVFAAEAV
1bfdA           -------------VHGTTYELLRRQGIDTVFGNPGSNELPFLKDFPED---FRYILALQEACVVGIADGY
2ag1A           -------------GGELVVRTLIKAGVEHLFGLHGAHIDTIFQAC--LDHDVPIIDTRHEAAAGHAAEGY
2c31A           --------------GFHVLDALKMNDIDTMYGVVGIPITNLARMW--QDDGQRFYSFRHEQHAGYAASIA
3ea4A           --------------GADILEALERQGVETVFAYPGGASMEIHQ-ALTRSSSIRNVLPRHEQGGVFAAEGY
3clsD           -------------------------IAEHRRNDLRPVSLELIGAANGSGEDKVVVAVIGSQADAFVPALV
3clrD           -------------------------IAEHRRNDLRPVSLELIGAANGSGEDKVVVAVIGSQADAFVPALS
3cltD           -------------------------IAEHRRNDLRPVSLELIGAANGSGEDKVVVAVIGSQADAFVPALS
3cluD           -------------------------IAEHRRNDLRPVSLELIGAANGSGEDKVVVAVIGSQADAFVPALS
2a1tR           ------------------------VIAEHANDSLAPITLNTITAATRLG--GEVSCLVAGTKCDKVAQDL
1efvA           -------------------------IAEHANDSLAPITLNTITAATRLGGEVSC--LVAGTKCDKVAQDL
3e12B           ----------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
2ef9B           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
3dv0G           ----------------------------------------------------------------------
2a1uA           ------------------------VIAEHANDSLAPITLNTITAATRLGGEVSC--LVAGTKCDKVAQDL
2beuA           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
3e12A           ----------------------------------------------------------------------
1efpA           ----------------------------------------------------------------------
2bffA           ----------------------------------------------------------------------
2bfdA           ----------------------------------------------------------------------
2b4yB           ----------------------------------------------------------------------
3dvaE           ----------------------------------------------------------------------
2bfbA           ----------------------------------------------------------------------
2b4yD           ----------------------------------------------------------------------
2bfeA           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------
2bp7A           ----------------------------------------------------------------------
1cc0E           ----------------------------------------------------------------------
1ajwA           ----------------------------------------------------------------------
2ef9A           ----------------------------------------------------------------------
2bfcA           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
2b4yA           ----------------------------------------------------------------------
16pkA           ----------------------------------------------------------------------
3c38A           ----------------------------------------------------------------------
1ay0A           ----------------------------------------------------------------------
2bxwA           ----------------------------------------------------------------------
2b4yC           ----------------------------------------------------------------------
2e6kA           ----------------------------------------------------------------------
3d4bA           ----------------------------------------------------------------------
1e3tA           ----------------------------------------------------------------------
1d4oA           ----------------------------------------------------------------------
2c3yB           --------------GNTATAHVAYAMSEVAAIYPITEEADDWAAQGRKNIFGQTLTIREMQSEAGAAGAV
1e20A           -------------GSVAAIKFGNTEWAEVRAVVTKSSLHFLDKLSLPQEVTLYTDSSWNKIGDPVLHIEL
1djlA           ----------------------------------------------------------------------
3cf4G           ----------------------------------------------------------------------
3dv0A           ----------PGYRDVPQIIWHGLPLYQAFLFSRGHFHGNQIPEGVNVLPPQIIIGAQYIQAAGVALGLK


                         .         .         *         .         .         .         .:140
query           GKLTRRAGWAALTAGPGVTNGVSGIATAHFNGSPLVVVGGRAPDNRWGQGLLQELDQSPLFTTITKRAWT
1bfdA           AQASRKPAFINLHSAAGTGNAMGALSNAWNSHSPLIVTAGQQTRAMIGVELLTNVDAANLPRPLVKWSYE
2ag1A           ARAGAKLGVALVTAGGGFTNAVTPIANAWLDRTPVLFLTGSGALRDDETNTLQAGIDQVAAAPITK--WA
2c31A           GYIEGKPGVCLTVSAPGFLNGVTSLAHATTNCFPMILLSGSSEREIVDQGDYEEMDQMNVARPHCKASFR
3ea4A           ARSSGKPGICIATSGPGATNLVSGLADALLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYL
3clsD           DELVVVKGSSIDFDPDVFEASVSALIAAHNPSVVLLPHSVDSLGYASSLASKTGYGFATDVYIVEYQGDE
3clrD           VNGVDELVVSIDFDPDVFEASVSALIAAHNPSVVLLPHSVDSLGYASSLASKTGYGFATDVYIVEYQGDE
3cltD           DELVVVKGSSIDFDPDVFEASVSALIAAHNPSVVLLPHSVDSLGYASSLASKTGYGFATDVYIVEVATRG
3cluD           DELVVVKGSSIDFDPDVFEASVSALIAAHNPSVVLLPHSVDSLGYASSLASKTGYGFATDVYEYQGDELV
2a1tR           CKVAGIAKVLVAQHDVYKGLLPEELTPLILATQKQFNYTHICAGASAFGKNLLPRVAAKLEVAPISDIIA
1efvA           CKVAGIAKVLVAQHDVYKGLLPEELTPLILQFNYTHICAGASAFGKNLLPRVAAKLEVAPISDIIA----
3e12B           ----------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
2ef9B           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
3dv0G           ----------------------------------------------------------------------
2a1uA           CKVAGIAKVLVAQHDVYKGLLPEELTPLILATQKQFNYTHISAFGKNLLPRVAAKLEVAPISDI--IAIK
2beuA           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
3e12A           ----------------------------------------------------------------------
1efpA           ---------DALYGHRLAEPTAALIVGLAGDYSHIAAPATTDAKNVMPLDVMVLSDVRPIYAGNAIQVVK
2bffA           ----------------------------------------------------------------------
2bfdA           ----------------------------------------------------------------------
2b4yB           -------------------SSSADFRKFFAKAKHIVIISGAGVSAESGVPTGYWRHNPSRVWEFYHYRRE
3dvaE           ----------------------------------------------------------------------
2bfbA           ----------------------------------------------------------------------
2b4yD           -------------------SSSADFRKFFAKAKHIVIISGAGVSAESGVPTFYWRKWQAQDLAVWEFYHY
2bfeA           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------
2bp7A           ----------------------------------------------------------------------
1cc0E           ---------------------------------------NYKPPAQKSIQEIQELDKDRKYKEALLGRVA
1ajwA           ----------------------------------------------------------------------
2ef9A           ----------------------------------------------------------------------
2bfcA           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
2b4yA           -------------------SSSADFRKFFAKAKHIVIISGAGVSAESGVGYWRKWQAQDLATPWEFYHYR
16pkA           -------------------------------------------------NAADVVSKMSPGDVVLLENVR
3c38A           ----------------------------------------------------------------------
1ay0A           ----------------------------------------------------------------------
2bxwA           ----------------------------------------------------------------------
2b4yC           -------------------SSSADFRKFFAKAKHIVIISGAGVSAESGVPTFRYWRKWQAQDLATPLAFA
2e6kA           ----------------------------------------------------------------------
3d4bA           ---------------------MKEFLDLLNESRLTVTLTGAGISTPSGIPDFNVFDIDFFYSPEEFYRFA
1e3tA           ----------------------------------------------------------------------
1d4oA           ----------------------------------------------------------------------
2c3yB           GALAAGALTTTFTASQGLLLMIPNMYKISGELLPGVFHVTARAIA--AHALSIFGDHQDIYAAR----QT
1e20A           RRWADVLVIAPLSAGGLCDNLLTCIIRAWDYTKPLFVAPA-MNTLMWNNPFTER----------------
1djlA           ----------------------------------------------------------------------
3cf4G           ----------------------------------------------------------------------
3dv0A           MRGKKAVAITYTGDGGTSQGDFYEINFAGAFKAPAIFV---VQNNRFAISTPVEKQTVAKAVAAGIPGIQ


                         +         .         .         .         .         *         .:210
query           VHDTAQIGPALDEAFTLANTAHRGPVFLDIPMDRLYDQAEITVTGQAAAEDRSPDPDAVAAVARLLSEAE
1bfdA           PASAAEVPHAMSRAIHMASMAPQGPVYLSVPYDDWDKDADPQLFDRHVSSSVRLNDQDLDILVKALNSAS
2ag1A           HRVATEHIPRLVQAIRAALSAPRGPVLLDLPWDILNQIDEDSVIIPDLVLSAHPDPADLDQALALLRKAE
2c31A           INSIKDIPIGIARAVRTAVSGRPGGVYVDLPAKLFGQTISVEEANKLLFKPIDPAEDAIARAADLIKNAK
3ea4A           VMDVEDIPRIIEEAFFLATSGRPGPVLVDVPKDIQQQLAIPNLPGYMSRMPKPPEDSHLEQIVRLISESK
3clsD           LVATRGGYNQKVNVEVDFPGKSTVVLTIRPSVFKPSPVVSNVDAPSVQSRSQNKDYVEVGGGNDIDITTV
3clrD           LVATRGGYNQKVNVEVDFPGKSTVVLTIRPSVFKPSPVVSNVDAPSVQSRSQNKDYVEVGGGNDIDITTV
3cltD           GYNQKVNVEVDFPGKSTVVLTIRPSVFKPLEGAGSPVVSN-VDAPSVQSRSQNKDYVEVGGGNDIDITTV
3cluD           ATRGGYNQKVNVEVDFPGVVLTIRPSVFKPLEGAGSPVVSNVDAPSVQSRSQNKDYVEVGGGNDIDITTV
2a1tR           IKSPDTFVRTIYAGNALCTVKCDEKVKVFSVRGTSFD-AAATSGGSASSEPVEISEWLDQKLTRPELTGA
1efvA           IKSPDTFVRTIYAGNALCTVKDEKVKVFSVR-GTSFDAAATSASSTSPVEISEWLDQKLTKSDRPELTGA
3e12B           ----------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
2ef9B           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
3dv0G           ----------------------------------------------------------------------
2a1uA           SPDTFVRTIYAGNALCTVKCDEK-VKVFSVR-GTSFDAAATSASSTSPVEISEWLDQKLTKSDRPELTGA
2beuA           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
3e12A           ----------------------------------------------------------------------
1efpA           SKDAKKVFTIRTASFDAAGEGGTAPV-TETAAAADPGLSS-------------WVADEVAESDRPELTSA
2bffA           ----------------------------------------------------------------------
2bfdA           ----------------------------------------------------------------------
2b4yB           VGSKEPNAGHRAIAECETRLGKQGRRVVVITQN--IDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENY
3dvaE           ----------------------------------------------------------------------
2bfbA           ----------------------------------------------------------------------
2b4yD           RREVGSKEPNAGHRAIAECETRLGKQGRRVVVIQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENY
2bfeA           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------
2bp7A           ----------------------------------------------------------------------
1cc0E           VSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVISFRVNREIVSGMKYIQHTYRKGVKID
1ajwA           VSADPNVPNVVVTRLTLVCSTAPGPLELDLTGDLESFKKQLKEGVEYRIKISFRVNREIVSGMKYIQHTY
2ef9A           ----------------------------------------------------------------------
2bfcA           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
2b4yA           REVGSKEPNAGHRAICETRLGKQGRRVVVITQN--IDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENY
16pkA           FYKEEGSKKAKDREAMAKILASYGDVYISDAFGRDSATMTGIPKILGNGAAGYLMEKEISYFAKVLGNPP
3c38A           ----------------------------------------------------------------------
1ay0A           ----------------------------------------------------------------------
2bxwA           ----AMVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQISFRVNREIVSGMKYIQHTYRYGVYIDYTD
2b4yC           HNPSRVWEFYHYRREVGSKEPNAGHRAIAECETRLGKQGRRVVVTKNLLEIHGSLFKTRCTSCGVVAENY
2e6kA           ----------------------------------------------------------------------
3d4bA           KEGIFPMLQAKPNLALLAKLEEKGLIEAVITQNIDRLH------QRAGSKKVIELHGNVEEYYCVRCEKK
1e3tA           ---------------------------------------------------RSVKAGSAEDAAFIMKNAS
1d4oA           ----------------------------------------------------THTEINLDNAIDMIREAN
2c3yB           GF--AMLASSVQEAHDMALVAHLAAIESNVPFMHFFDGFRTSHEIQ------------------------
1e20A           ----------------------------------------------------------------------
1djlA           -----------------------------------------------MEISGTHTEINLDNAIDMIREAN
3cf4G           ---------------------------VDTTKNTKLFTSYGV---------NTSKAVSPEMAAKIISKAK
3dv0A           VMDPLAVYAAVKAARERAINGE-GPTLIETLCFR------------------------------------


                         .         .         .         +         .         .         .:280
query           RPVLVYGSDVWLDHXXXXXXXXXXXXGVPVVTNGQGRGVLPAGHPXXXXXXXXXXXXXXDLVIVVGTPLD
1bfdA           NPAIVLGPDVDAANANADCVMLAERLKAPVWVAPSPRCPFPTRHPCFRGLMPAGIAAISDVVLVIGAPVF
2ag1A           RPVIVLGSEASRTARKTALSAFVAATGVPVFADYEGLSLSGLPDARGGLVQNLYSFAKAPDLVLLGARFG
2c31A           RPVIMLGKGAAYAQCDDEIRALVEETGIPFLPMGMAKGLLPDNHPQSAAATRAFALAQCDVCVLIGARLN
3ea4A           KPVLYVGGGCLNSS--DELGRFVELTGIPVATTLMGLGSYPDDELSLHMLGMHGTVYANYAVEHSDLLLA
3clsD           DFIMSIGRGIGEETNVEQFRELADEAGATLCCSCPIADAGWLPKS-RQVGQSGKVVGSCKLYVAMGISGS
3clrD           DFIMSIGRGIGEETNVEQFRELADEAGATLCCSAPIADAGWLPKS-RQVGQSGKVVGSCKLYVAMGISGS
3cltD           DFIMSIGRGIGEETNVEQFRELADEAGATLCCSEPIADAGWLPKS-RQVGQSGKVVGSCKLYVAMGISGS
3cluD           DFIMSIGRGIGEETNVEQFRELADEAGATLCCSKPIADAGWLPKS-RQVGQSGKVVGSCKLYVAMGISGS
2a1tR           KVVVSGGRGLKSGENFKLLYDLADQLHAAVGASRAAVDAGFVPND--MQVGQTGKIVAPELYIAVGISGA
1efvA           KVVVSGGRGLKSGENFKLLYDLADQLHAAV---GASRAAVDAGVPNDMQVGQTGKIVAPELYIAVGISGA
3e12B           ----------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
2ef9B           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------FQFPFA
3dv0G           ----------------------------------------------------------------------
2a1uA           KVVVSGGRGLKSGENFKLLYDLADQLHAAV---GASRAAVDAGVPNDMQVGQTGKIVAPELYIAVGISGA
2beuA           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
3e12A           ----------------------------------------------------------------------
1efpA           RRVVSGGRGLGSKESFAIIEELADKLGAAVGASRAAVDSGYAPND--WQVGQTGKVVAPELYVAVGISGA
2bffA           ----------------------------------------------------------------------
2bfdA           ----------------------------------------------------------------------
2b4yB           KSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVDPAILEEVDRELAHCDLCLVVGTSSV
3dvaE           ----------------------------------------------------------------------
2bfbA           ----------------------------------------------------------------------
2b4yD           KSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVPAILEEVDRELAHCDLCLVVGTSSV
2bfeA           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------
2bp7A           ----------------------------------------------------------------------
1cc0E           KTDYMVGSYGPRAEEYEFLTPV-----EEAPKGMLARGSYSIKSR-------------------------
1ajwA           RKGVKIDKTDYMSYGPRAEEYEFLTPMEEAPKGMLARGSYNIKSR-------------------------
2ef9A           ----------------------------------------------------------------------
2bfcA           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
2b4yA           KSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVDPAILEEVDRELAHCDLCLVVGT--S
16pkA           RPLVAIVGGAKVSDKIQLLDNMLQRIDYLLIGGAMAQGYSIGKSKFARSLLKKAEDRKVQVILPIDHVCH
3c38A           ----------------------------------------------------------------------
1ay0A           ----------------------------------------------------------------------
2bxwA           YMVGSYG------PRAEEYEFLTPVEEAPKGM--LARGSYSIKSR-------------------------
2b4yC           KSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVPAILEEVDRELAHCDLCLVVGTSSV
2e6kA           ----------------------------------------------------------------------
3d4bA           YTVEDVIKKLE---------------SSDVPLCDDCNSLIRPNIPQDALREAIGLSSRASLMIVLGSSLV
1e3tA           KVIIVPGYGMAVAQAQHALREMADVLKKEGVEVSYAIHPVAGRMPVFELEEINSSFQTADVAFVIGANDV
1d4oA           SIIITPGYGLCAAKAQYPIADLVKMLSEQGKKVRFGIHPVAGRMP-------------------------
2c3yB           ----------------------------------------------------------------------
1e20A           ----------------------------------------------------------------------
1djlA           SIIITPGYGLCAAKAQYPIADLVKMLTEQGKKVRFGIHPVAGRMPGQLNVLLAEAGVPYDLVLVIGANDT
3cf4G           RPLLMVGTLALDPELLDRVVKISKAANIPIAATGSSLAVLADKDVTDPKWPGLDGNGNYDMIITIGF--K
3dv0A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           FRLNHGLFGGRDGAPLARTVHITDSPAQLATHLTLAGAVSGDLSAILRALAEQAKPKREVAQWRXXXXXX
1bfdA           RYHQYDP--GQYLKPGTRLISVTCDPLEAARA-PMGDAIVADIGAMASALANLVEESSRQLPTAA-----
2ag1A           LNTGHGSGQLIPHSAQVIQVDPDACELGRLQGIALG--IVADVGGTIEALAQATAQDAAWPDRGDWCAKV
2c31A           WL-MQHGKGKTWGDELKKYVQIDIQANEMDSNQPIAAPVVGDIKSAVSLLRKALKGAPKADAEWTGALKA
3ea4A           FGVRFDTGKLEAFASRAKIVHIDIDSAEIGKNKTPHVSVCGDVKLALQGMNKVLENRAELKLDFGVWRNE
3clsD           IQHMAGM------KHVPTIIAVNTDPGASIFTIAKYGIV-ADIFDIEEELKAQ-----------------
3clrD           IQHMAGM------KHVPTIIAVNTDPGASIFTIAKYGIV-ADIFDIEEELKAQ-----------------
3cltD           IQHMAGM------KHVPTIIAVNTDPGASIFTIAKYGIV-ADIFDIEEELKAQ-----------------
3cluD           IQHMAGM------KHVPTIIAVNTDPGASIFTIAKYGIV-ADIFDIEEELKAQ-----------------
2a1tR           IQHLAGM------KDSKTIVAINKDPEAPIFQVADYGIV-ADLFKVVPEMTEILKKK-------------
1efvA           IQHLAGM------KDSKTIVAINKDPEAPIFQVADYGIV-ADLFKVVPEMTEILK---------------
3e12B           -------------------------------------CAIESEELLLKVGEEIKRLSEKFKEVEFVFKSS
3dv0C           ------------QFPFAEQLEKVAEQFPTFQILNEEGEVVNEEAMPELSDEQLKELMRRMVYTR---ILD
2ef9B           -------------------------------------NAIESEELLLKVGEEIKRL----SEKFKEVEFV
3dv0E           EQLEKV-------AEQFPTFQILNEEGEVVNEEAMPELSDEQLKELMRRMVYTRILDQRSISLNR-----
3dv0G           ------------------TFQF--PFAEQLEKVAEQFPTFQILNEEGEVVNEEAMPELSDEQLKELMRRM
2a1uA           IQHLAGM------KDSKTIVAI-NKDPEAPIFQVADYGIVADLFKVVPEMTEILKKK-------------
2beuA           -------------IDKLEFIQPNVISGPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRIL
3dvaA           ------------------TFQF--PFAEQLEKVAEQFPTFQILNEEGEVVNEEAMPELSDEQLKELMRRM
3e12A           -------------------------------------ELLLKVGEEIKRLSEKFKEVEFVFKFDKANRSS
1efpA           IQHLAGM------KDSKVIVAINKDEEAPIFQIADYGLV-GDLFSVVPELTGK-----------------
2bffA           -------------FPGASAEFIDK-LEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSM
2bfdA           -------------FPGASAEFIDK-LEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSM
2b4yB           VYPAAFA--PQVAARGVPVAEFNTETTPATNRFRF--HFQGPCGTTLPEA--------------------
3dvaE           -------------AEQFPTFQILNEEGEVVNEEAMPELSDEQLKELMRRMVYTRILDQRSISLN------
2bfbA           -------------IDKLEFIQPNVIGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRIL
2b4yD           V--YPAAFAPQVAARGVPVAEFNTETTPATNRFRF--HFQGPCGTTLPEA--------------------
2bfeA           --------------PGASAEFIDK-LEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSM
3dv0A           -------------AEQFPTFQILNEEGEVVNEEAMPELSDEQLKELMRRMVYTRILDQRSISLN------
2bp7A           --------------------AEDIDPQILRQGMRAMLKTRIFDSRMVVAQRQKKMSFYMQSLGEEAIGSG
1cc0E           ----------------------------------------------------------------------
1ajwA           ----------------------------------------------------------------------
2ef9A           -------------------IESEELLLKVGEEIKRLSEKFKEVEFVFKSSFDK-ANRSSIHSFRG-----
2bfcA           -------------FPGASAEFIDK-LEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSM
1dtwA           --------------PGASAEFIDK-LEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSM
2b4yA           SVVYPAAFAPQVAARGVPVAEFNTETTPATNRFRF--HFQGPCGTTLPEA--------------------
16pkA           TEFK---AVDSPLITEDQNIPEGHMALDIGPKTIEKYQTIGKCKSAIWNGPMGVFEMVPYSKG-------
3c38A           ----------------------------------------------------------------------
1ay0A           -----------------------------TVSKANSGHPGAPLGMAAHVLWSQMRMNPTNPDWINR----
2bxwA           ----------------------------------------------------------------------
2b4yC           VYPAAFAPQVAA--RGVPVAEFNTETTPATNRFRF--HFQGPCGTTLPEA--------------------
2e6kA           ----------------------------------------------------------------------
3d4bA           VYPAAELP---LITVRSGGKLVIVNLGETPFDDIATLKYNMDVVEFARRVMEEG----------------
1e3tA           AKTDPSSPMPILDVEKAGTVLFIKGVENELFFRNNTMMLFGDAKKMTEQIVQA-----------------
1d4oA           ----------------------------------------------------------------------
2c3yB           ----------------------------------------------------------------------
1e20A           ----------------------------------------------------------------------
1djlA           VN-SAAQEDPNSIIAGMPVLEVWKSKQVIVMKRSLGVMLLGDAKKTCDALQAKVR---------------
3cf4G           KFYINQVLSAAKNFSNLKTIAIERGYIQNATMSFGNLSK-ADHYAALDELIN------------------
3dv0A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           XXXXXXKDREVLDSDASPIHPARIYGELNRILXXXXXXXXXXXXXXSYAGKYIQPRRPGNWLDPGPFGCL
1bfdA           ------PEPAKVDQDAGRLHPETVFDTLNDMAPENAIYLNESTSTTAQMWQRLNMRNPGSYYFCAAGG-L
2ag1A           TDLAQERYASAKSSSEHALHPFHASQVIAKHVDAGVTVVADGALTYLWLSEVSRVKPGGFLCHGYLGSGV
2c31A           KVDGNKAKLAGAETPSGMMNYSNSLGVVRMLANPDISLVNEGANALDNTRMIVDMLKPRKRLDSGTWGVM
3ea4A           LNVQKQKFPLSFKTFGEAIPPQYAIKVLDELTDGKAIISTGVGQHQMWAAQFYNYKKPRQWLSSGGLGAM
3clsD           ----------------------------------------------------------------------
3clrD           ----------------------------------------------------------------------
3cltD           ----------------------------------------------------------------------
3cluD           ----------------------------------------------------------------------
2a1tR           ----------------------------------------------------------------------
1efvA           ----------------------------------------------------------------------
3e12B           FDK---ANRSSIHSFR-GHGLEYGVKALRKVKEEFGLKITTDIHESWQAEPVAEVAD---IIQIPAFLCR
3dv0C           QRSISLNRQGRLGFYAPTAGQEASQIASHFALEKEDFILPGYRDVPQIIWHLPLYQAFLFSRGHFHGNQI
2ef9B           FKSSFDKANRSSIHSFRGHGLEYGVKALRKVKEEFGLKITTDIHESWQAEPVAEVARQTDLLLAAAKTGR
3dv0E           --------QGRLGFYAPTAGQEASQIASHFALEKEDFILPGYRDVPQIWHGLPLYQAFLFSRGHFHGNQI
3dv0G           VYTRILDQRSISLFYAPTAGQEASQIASHFALEKEDFILPGYRDVPQIWHGLPLYQAFLFSRGHFHGNQI
2a1uA           ----------------------------------------------------------------------
2beuA           YESQRQGRISFYMT--NYGEEGTHVGSAAALDNTDLVFGQYREAGVLMYLFMAQCYGNISDLGKGISSPL
3dvaA           VYTRILDQRSISLFYAPTAGQEASQIASHFALEKEDFILPGYRDVPQIIWHGLPLYQFLFSRGHFHGNQI
3e12A           IHSFRGHGLEYGVKALRKVKEEFGLKITTDIHESWQAEPVAEVADIIQIPAFLCRQTDLLLAAAK--TGR
1efpA           ----------------------------------------------------------------------
2bffA           TLLNTMDRILYESFYMTNYGEEGTHVGSALVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPV
2bfdA           TLLNTMDRILYESFYMTNYGEEGTHVGSAAALDNTDLVFGQAREAGVYRDYPLSDLGKGRQMPVHYSSPL
2b4yB           ----------------------------------------------------------------------
3dvaE           ------RQGRLGFYAPTAGQEASQIASHFALEKEDFILPGYRDVPQIIWHGLPLYQAFLFSRGHFHGNQI
2bfbA           YESQRQGRISFYMT--NYGEEGTHVGSAAALDNTDLVFGAYREAGVLMYRDYPLELFMAQCYGNTISSPL
2b4yD           ----------------------------------------------------------------------
2bfeA           TLLNTMDRILYESQRQGRGEEGTHVGSAAALDNTDLVFGAAREAGVLMYRDYPLELFMAQCYGNISDLGK
3dv0A           ------RQGRLGFYAPTAGQEASQIASHFALEKEDFILPGYRDVPQIIWHGLPLYQAFLFSRGHFHGNQI
2bp7A           QALALNRTDMCFPTYRQQSILMARDVSLVEMICQLLSNERDPLKGRQLPIMYSVREAGFFTISGNLATQF
1cc0E           ----------------------------------------------------------------------
1ajwA           ----------------------------------------------------------------------
2ef9A           ------HGLEYGVKALRKVKEEFGLKITTDIHESWQAEPVAEVADIIQIPAFLCRQTDLLLA--AAKTGR
2bfcA           TLLNTMDRILYESFYMTNYGEEGTHVGSAAVFGQFREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPV
1dtwA           TLLNTMDRILYESQYMTNYGEEGTHVGSAAALDNTDLVFGQYREAGVYRDYPLELFMNISDLGKGRQMPV
2b4yA           ----------------------------------------------------------------------
16pkA           ----------------------------------------------------------------------
3c38A           -----------------------------------------------MRRSSLIEAGGQVVGYLYVGIVL
1ay0A           ------------DRFVLSNGHAVALLYSMLHLTGYDLSIEDLKQFRQLGSRTPGHPEFELPGVEVTTGPL
2bxwA           ----------------------------------------------------------------------
2b4yC           ----------------------------------------------------------------------
2e6kA           -------------------------------------------------GHPERGHTPGVEVTTGPLGGI
3d4bA           ----------------------------------------------------------------------
1e3tA           ----------------------------------------------------------------------
1d4oA           ----------------------------------------------------------------------
2c3yB           ----------------------------------------------------------------------
1e20A           ----------------------------------------------------------------------
1djlA           ----------------------------------------------------------------------
3cf4G           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GTGMGYAIAARLVRPSSQVVALFGDGALGFSLADVDTLVRHNLPVVMVCGNNGIWGLEKAPMQLVYGYDV
1bfdA           GFALPAAIGVQLAEPERQVIAVIGDGSANYSISALWTAAQYNIPTIFVIMNNGTYGALRWFAGVLEAENV
2ag1A           GFGTALGAQVADLEAGRRTILVTGDGSVGYSIGEFDTLVRKQLPLIVIINNQSWGATLHFQQLAVGPNRV
2c31A           GIGMGYCVAAA-AVTGKPVIAVEGDSAFGFSGMELETICRYNLPVTVIIMNNGGIYKGNEADP--QPGVI
3ea4A           GFGLPAAIGASVANPDAIVVDIDGDGSFIMNVQELATIRVENLPVKVLLLNNQHLGMVMQWEDRFYKADP
3clsD           ----------------------------------------------------------------------
3clrD           ----------------------------------------------------------------------
3cltD           ----------------------------------------------------------------------
3cluD           ----------------------------------------------------------------------
2a1tR           ----------------------------------------------------------------------
1efvA           ----------------------------------------------------------------------
3e12B           QTDLLLAAALAPWDTKNVVEKLKFGGAKEIYLTERGTTFGYNNLVV----DFRSLPIMKQWAKVIYDATH
3dv0C           PEGVNVALGLKMRGKKAVAITYTGDGGTGDFYEGINFAGAFKAPAIFVVQNNRFAIST--PVEKQTVAKT
2ef9B           AVNVKKGQFLAPWDTKNVVEKLKFGGAKEIYLTERGTTFGYNNLVV----DFRSLPIMKQWAKVIYDATS
3dv0E           PEGVNVALGLKMRGKKAVAITYTGDGGTGDFYEGINFAGAFKAPAIFVVQNNRFAIST--PVEKQTVAKT
3dv0G           PEGVNVALGLKMRGKKAVAITYTGDGGTGDFYEGINFAGAFKAPAIFVVQNNR-FAISTPVEKQTVAKT-
2a1uA           ----------------------------------------------------------------------
2beuA           ATQIPQAVAAKRANANRVVICYFGEGAAGDAHAGFNFAATLECPIIFFCRNNGYAIST--PTSEQYRGDG
3dvaA           PEGVNVLLGLKMRGKKAVAITYTGDGGTGDFYEGINFAGAFKAPAIFVVQNNRFAAST--PVEKQTVAKT
3e12A           AVNVKKGQFLAPWDTKNVVEKLKFGGAKEIYLTERGTTFGYNNLVV----DFRSLPIMKQWAKVIYDATH
1efpA           ----------------------------------------------------------------------
2bffA           HYGCKERHFVTISSPLATQICYFGEGAAGDAHAGFNFAATLECPIIFFCRNNGYAIST--PTSEQYRGDG
2bfdA           ATQIPQAVAAKRANANRVVICYFGEGAAGDAHAGFNFAATLECPIIFFCRNNGYAIST--PTSEQYRGDG
2b4yB           ----------------------------------------------------------------------
3dvaE           PEGVNVALGLKMRGKKAVAITYTGDGGTGDFYEGINFAGAFKAPAIFVVQNNRFAAST--PVEKQTVAKT
2bfbA           ATQIPQAVAAKRANANRVVICYFGEGAAGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRG----
2b4yD           ----------------------------------------------------------------------
2bfeA           GRQMGAAYAAKRANANRVVICYFGEGAAGDAHAGFNFAATLECPIIFFCRNNGY--AISTPTSEQYRGDG
3dv0A           PEGVNVALGLKMRGKKAVAITYTGDGGTGDFYEGINFAGAFKAPAIFVVQNNRFAIST--PVEKQTVAKT
2bp7A           VQAVGWAMASAIKGDTKIASAWIGDGATSDFHTALTFAHVYRAPVILNVVNNQWAISTFQAIAGGESTT-
1cc0E           ----------------------------------------------------------------------
1ajwA           ----------------------------------------------------------------------
2ef9A           AVNVKKGQFLAPWDTKNVVEKLKFGGAKEIYLTERGTTFGYNNLVV----DFRSLPIMKQWAKVIYGDKS
2bfcA           HYGCKERHFVTISSPLATQICYFGEGAAGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRG----
1dtwA           HYGCKERHFVTISSPLATQICYFGEGAAGDAHAGFNFAATLECPIIFFCRNNGYAIST--PTSEQYRGDG
2b4yA           ----------------------------------------------------------------------
16pkA           ----------------------------------------------------------------------
3c38A           NDNFALLENIRSGSNSENLVLAVDTTPLVSEPYSLDYVVHSAKDADSFIVGQTFLEVES-VPTYLCVYSI
1ay0A           GQGVGMAMAQANLASDNYTYVFLGDGCLGISSEASSLAGHLKLGNLIAIYDDNKITIDGA----------
2bxwA           ----------------------------------------------------------------------
2b4yC           ----------------------------------------------------------------------
2e6kA           STAVGLALAERKLAVDHYTYVLASDGDLEGVSGEASLAGHWGLSKLIVFWDDNRISIDGPT---------
3d4bA           ----------------------------------------------------------------------
1e3tA           ----------------------------------------------------------------------
1d4oA           ----------------------------------------------------------------------
2c3yB           ----------------------------------------------------------------------
1e20A           ----------------------------------------------------------------------
1djlA           ----------------------------------------------------------------------
3cf4G           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           LADLAPQTRYDQVVTALGGGGELVTDPAEIGPALRRAFDSGVPYLVNIVTDPENVYPRKTMGV
1bfdA           PGLDVPGIDFRALAKGYGVQALKADNLEQLKGSLQEALSAKGPVLIEVST-------------
2ag1A           TGTRLENGSYHGVAAAFGADGYHVDSVESFSAALAQALAHNRPACINVAVALPIPPE------
2c31A           SCTRLTRGRYDMMMEAFGGKGYVANTPAELKAALEEAVASGKPCLINAMIDPD----------
3ea4A           AQEDEIFPNMLLFAAACGIPAARVTKKADLREAIQTMLDTPGPYLLDVICPHEHVLP------
3clsD           ---------------------------------------------------------------
3clrD           ---------------------------------------------------------------
3cltD           ---------------------------------------------------------------
3cluD           ---------------------------------------------------------------
2a1tR           ---------------------------------------------------------------
1efvA           ---------------------------------------------------------------
3e12B           SVQLPGGGMREFIFPAVGCDGVFMETHPEPEKALSDASTQLPLSQLEGIIEAASKYY------
3dv0C           LAQKA-VAAGIPGIQVDG------MDPLAVYAAVKAARERAINGEGPTLIETCFRYGPHTEN-
2ef9B           GGMREFIFPLIRAAVAVGCDGVFMETHPEPEKALSDAPTALPLSQLEGIREVASKYY------
3dv0E           LAQKA---VAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYEWAKKDPL--
3dv0G           LAQKAVAAGIPGIQVDGMDPLAVY---AAVKAARERAINGEGPTLIETLCFRGPHTD------
2a1uA           ---------------------------------------------------------------
2beuA           IAARGPGYGIM---SIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRGHHSTSD----
3dvaA           LAQKAVAAGI-------PGIQVDGMDPLAVYAAVKAARNGEGPTLIETLCFRGPHTM------
3e12A           SVQLPGGGGMREFIFAVGCDGVFMETHPEPEKALSDASTQLPLSQLEGIREVASKYY------
1efpA           ---------------------------------------------------------------
2bffA           IAARGPGYGIMSIRVDGNDVFAVY---NATKEARRRAVAENQPFLIEAMTYRGHHSTSDDSSA
2bfdA           IAAR-GPGYGIMSIRVDGN------DVFAVYNATKEARRENQPFLIEAMTYRGSTDH------
2b4yB           ---------------------------------------------------------------
3dvaE           LAQKAVAAGIP-------GIQVDGMDPLAVYAAVKAAREGEGPTLIETLCFRYGPHT------
2bfbA           -DGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRDHPISRL----
2b4yD           ---------------------------------------------------------------
2bfeA           IAARG-PGYGIMSIRVDGN------DVFAVYNATKEARAENQPFLIEAMTY------------
3dv0A           LAQKA---VAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHEN-----
2bp7A           FAGRGVGCGIASL--------------------------------------------------
1cc0E           ---------------------------------------------------------------
1ajwA           ---------------------------------------------------------------
2ef9A           GGMREFIFPLIRAAVAVGCDGVFMETHPEPEKALSDAPTALPLSQLEGIREVASKYY------
2bfcA           -DGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRDHPIS------
1dtwA           IAARG---PGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRGHHSTSDDSSA
2b4yA           ---------------------------------------------------------------
16pkA           ---------------------------------------------------------------
3c38A           ---------------------------------------------------------------
1ay0A           -TSISFDEDVAKRYEAYGWEVLYVENGNEDLAGIAKAISKDKPTLIKMTTTI-----------
2bxwA           ---------------------------------------------------------------
2b4yC           ---------------------------------------------------------------
2e6kA           --DLAFTEDVLARYRAYGWQTLRVEDLEALRKAIKLAKLDERPTLIAVRSHIGFGSPKQDSA-
3d4bA           ---------------------------------------------------------------
1e3tA           ---------------------------------------------------------------
1d4oA           ---------------------------------------------------------------
2c3yB           ---------------------------------------------------------------
1e20A           ---------------------------------------------------------------
1djlA           ---------------------------------------------------------------
3cf4G           ---------------------------------------------------------------
3dv0A           ---------------------------------------------------------------