[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ54630.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dbsA.bssp"
#ERROR : Can't open dsspfile "3dxnA.bssp"
#ERROR : Can't open dsspfile "2c3jA.bssp"
#ERROR : Can't open dsspfile "3dk6A.bssp"
#ERROR : Can't open dsspfile "2e2bA.bssp"
#ERROR : Can't open dsspfile "2bmcA.bssp"
#ERROR : Can't open dsspfile "2c47C.bssp"
#ERROR : Can't open dsspfile "2bmcF.bssp"
#ERROR : Can't open dsspfile "3bceA.bssp"
#ERROR : Can't open dsspfile "3e87A.bssp"
#ERROR : Can't open dsspfile "2e2bB.bssp"
#ERROR : Can't open dsspfile "2c47A.bssp"
#ERROR : Can't open dsspfile "3dkfA.bssp"
#ERROR : Can't open dsspfile "3csfA.bssp"
#ERROR : Can't open dsspfile "3ei1A.bssp"
#ERROR : Can't open dsspfile "3ckwA.bssp"
#ERROR : Can't open dsspfile "3bhhC.bssp"
#ERROR : Can't open dsspfile "3blrA.bssp"
#ERROR : Can't open dsspfile "1cmkE.bssp"
#ERROR : Can't open dsspfile "3byvA.bssp"
#ERROR : Can't open dsspfile "3bhhB.bssp"
#ERROR : Can't open dsspfile "2eb3A.bssp"
#ERROR : Can't open dsspfile "2cgxA.bssp"
#ERROR : Can't open dsspfile "3c0iA.bssp"
#ERROR : Can't open dsspfile "1cdkA.bssp"
#ERROR : Can't open dsspfile "3c0gA.bssp"
#ERROR : Can't open dsspfile "3e5aA.bssp"
#ERROR : Can't open dsspfile "3c5iD.bssp"
#ERROR : Can't open dsspfile "3dndA.bssp"
#ERROR : Can't open dsspfile "2dwbA.bssp"
#ERROR : Can't open dsspfile "2brmA.bssp"
#ERROR : Can't open dsspfile "2bfxB.bssp"
#ERROR : Can't open dsspfile "3comB.bssp"
#ERROR : Can't open dsspfile "2ckpB.bssp"
#ERROR : Can't open dsspfile "1apmE.bssp"
#ERROR : Can't open dsspfile "3bhhD.bssp"
#ERROR : Can't open dsspfile "2a1sB.bssp"
#ERROR : Can't open dsspfile "2bmcB.bssp"
#ERROR : Can't open dsspfile "2ckoB.bssp"
#ERROR : Can't open dsspfile "1e7vA.bssp"
#ERROR : Can't open dsspfile "3dkgA.bssp"
#ERROR : Can't open dsspfile "3c4yB.bssp"
#ERROR : Can't open dsspfile "3dajA.bssp"
#ERROR : Can't open dsspfile "3c5iA.bssp"
#ERROR : Can't open dsspfile "3cqwA.bssp"
#ERROR : Can't open dsspfile "3da6A.bssp"
#ERROR : Can't open dsspfile "3dy7A.bssp"
#ERROR : Can't open dsspfile "3dkoA.bssp"
#ERROR : Can't open dsspfile "3c9wA.bssp"
#ERROR : Can't open dsspfile "1e8wA.bssp"
#ERROR : Can't open dsspfile "3e93A.bssp"
#ERROR : Can't open dsspfile "2bkkA.bssp"
#ERROR : Can't open dsspfile "2chwA.bssp"
#ERROR : Can't open dsspfile "3daeB.bssp"
#ERROR : Can't open dsspfile "3ckcA.bssp"
#ERROR : Can't open dsspfile "3dk7B.bssp"
#ERROR : Can't open dsspfile "3cg2A.bssp"
#ERROR : Can't open dsspfile "1e7uA.bssp"
#ERROR : Can't open dsspfile "1e8xA.bssp"
#ERROR : Can't open dsspfile "3daeA.bssp"
#ERROR : Can't open dsspfile "3csvA.bssp"
#ERROR : Can't open dsspfile "3dfaA.bssp"
#ERROR : Can't open dsspfile "3cs9D.bssp"
#ERROR : Can't open dsspfile "1e90A.bssp"
#ERROR : Can't open dsspfile "3dqwA.bssp"
#ERROR : Can't open dsspfile "2bvaA.bssp"
#ERROR : Can't open dsspfile "2advA.bssp"
#ERROR : Can't open dsspfile "3cquA.bssp"
#ERROR : Can't open dsspfile "1bygA.bssp"
#ERROR : Can't open dsspfile "3dxpA.bssp"
#ERROR : Can't open dsspfile "3dk6B.bssp"
#ERROR : Can't open dsspfile "3e8cE.bssp"
#ERROR : Can't open dsspfile "3cuqA.bssp"
#ERROR : Can't open dsspfile "3bdeB.bssp"
#ERROR : Can't open dsspfile "3cs9C.bssp"
#ERROR : Can't open dsspfile "3dgkA.bssp"
#ERROR : Can't open dsspfile "3bhyA.bssp"
#ERROR : Can't open dsspfile "1e8zA.bssp"
#ERROR : Can't open dsspfile "3cstA.bssp"
#ERROR : Can't open dsspfile "3c5yE.bssp"
#ERROR : Can't open dsspfile "2b5mA.bssp"
#ERROR : Can't open dsspfile "3dyhA.bssp"
#ERROR : Can't open dsspfile "2ckoA.bssp"
#ERROR : Can't open dsspfile "1e8yA.bssp"
#ERROR : Can't open dsspfile "3bqrA.bssp"
#ERROR : Can't open dsspfile "2amuA.bssp"
#ERROR : Can't open dsspfile "3c5yA.bssp"
#ERROR : Can't open dsspfile "3bboU.bssp"
#ERROR : Can't open dsspfile "3e3pA.bssp"
#ERROR : Can't open dsspfile "1b5dA.bssp"
#ERROR : Can't open dsspfile "1a35A.bssp"
#ERROR : Can't open dsspfile "2bvaB.bssp"
#ERROR : Can't open dsspfile "3dlsD.bssp"
#ERROR : Can't open dsspfile "3bdeA.bssp"
#ERROR : Can't open dsspfile "3dk3B.bssp"
#ERROR : Can't open dsspfile "3dfcB.bssp"
#ERROR : Can't open dsspfile "3dpkA.bssp"
#ERROR : Can't open dsspfile "3dneA.bssp"
#ERROR : Can't open dsspfile "2dq7X.bssp"
#ERROR : Can't open dsspfile "3a5cA.bssp"
#ERROR : Can't open dsspfile "3dplC.bssp"
#ERROR : Can't open dsspfile "3dtwA.bssp"
#ERROR : Can't open dsspfile "3cokA.bssp"
#ERROR : Can't open dsspfile "3dlsB.bssp"
#ERROR : Can't open dsspfile "1b5eA.bssp"
#ERROR : Can't open dsspfile "3c5yB.bssp"
#ERROR : Can't open dsspfile "3e8eI.bssp"
#ERROR : Can't open dsspfile "2ckeA.bssp"
#ERROR : Can't open dsspfile "248lA.bssp"
#ERROR : Can't open dsspfile "3dk7A.bssp"
#ERROR : Can't open dsspfile "3dtcA.bssp"
#ERROR : Can't open dsspfile "2ckeB.bssp"
#ERROR : Can't open dsspfile "3cp9A.bssp"
#ERROR : Can't open dsspfile "2a2aA.bssp"
#ERROR : Can't open dsspfile "3c5yL.bssp"
#ERROR : Can't open dsspfile "3cq9D.bssp"
#ERROR : Can't open dsspfile "3bymA.bssp"
#ERROR : Can't open dsspfile "3ck8A.bssp"
#ERROR : Can't open dsspfile "3dlsC.bssp"
#ERROR : Can't open dsspfile "3cpcA.bssp"
#ERROR : Can't open dsspfile "3cqzH.bssp"
#ERROR : Can't open dsspfile "3dyhB.bssp"
#ERROR : Can't open dsspfile "3dlsE.bssp"
#ERROR : Can't open dsspfile "1a0eA.bssp"
#ERROR : Can't open dsspfile "1bcpA.bssp"
#ERROR : Can't open dsspfile "3dpdA.bssp"
#ERROR : Can't open dsspfile "3cs9B.bssp"
#ERROR : Can't open dsspfile "3dlxA.bssp"
#ERROR : Can't open dsspfile "2dlaC.bssp"
#ERROR : Can't open dsspfile "3dlxC.bssp"
#ERROR : Can't open dsspfile "2ae4A.bssp"
#ERROR : Can't open dsspfile "3c5yF.bssp"
#ERROR : Can't open dsspfile "2cn8A.bssp"
#ERROR : Can't open dsspfile "3dlsA.bssp"
#ERROR : Can't open dsspfile "3cc6A.bssp"
#ERROR : Can't open dsspfile "3dkcA.bssp"
#ERROR : Can't open dsspfile "2ckqA.bssp"
#ERROR : Can't open dsspfile "3cq9B.bssp"
#ERROR : Can't open dsspfile "3bg0C.bssp"
#ERROR : Can't open dsspfile "3dlsF.bssp"
#ERROR : Can't open dsspfile "3dk3A.bssp"
#ERROR : Can't open dsspfile "2a2yA.bssp"
#ERROR : Can't open dsspfile "3d5wA.bssp"
#ERROR : Can't open dsspfile "2ac5A.bssp"
#ERROR : Can't open dsspfile "3cpbA.bssp"
#ERROR : Can't open dsspfile "3cs9A.bssp"
#ERROR : Can't open dsspfile "3dlxB.bssp"
#ERROR : Can't open dsspfile "3be2A.bssp"
#ERROR : Can't open dsspfile "1a79A.bssp"
#ERROR : Can't open dsspfile "2bajA.bssp"
#ERROR : Can't open dsspfile "2cpkE.bssp"
#ERROR : Can't open dsspfile "2c3lA.bssp"
#ERROR : Can't open dsspfile "3ek4A.bssp"
#ERROR : Can't open dsspfile "2byvE.bssp"
#ERROR : Can't open dsspfile "3d4qA.bssp"
#ERROR : Can't open dsspfile "3b8eA.bssp"
#ERROR : Can't open dsspfile "3b8qB.bssp"

## Summary of PDB Search
:603
    8e-31   9%  3dbsA  [x.x.x] PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE
    2e-28  15%  3dxnA  [x.x.x] CALMODULIN-LIKE DOMAIN PROTEIN KINASE ISOFORM 3
    2e-26  17%  2c3jA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    1e-25  19%  3dk6A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-24  22%  2e2bA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-24  26%  2bmcA  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    8e-24  12%  2c47C  [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
    1e-23  21%  2bmcF  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    4e-23  16%  3bceA  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    2e-22  24%  3e87A  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    6e-22  19%  2e2bB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    9e-22  15%  2c47A  [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
    1e-21  17%  3dkfA  [x.x.x] MET PROTO-ONCOGENE
    2e-21   9%  3csfA  [x.x.x] PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE
    1e-20  12%  3ei1A  [x.x.x] DNA DAMAGE-BINDING PROTEIN 1
    2e-20  26%  3ckwA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 24
    4e-20  22%  3bhhC  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    6e-20  17%  3blrA  [x.x.x] CELL DIVISION PROTEIN KINASE 9
    6e-20  20%  1cmkE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    1e-19  11%  3byvA  [x.x.x] RHOPTRY KINASE
    1e-19  20%  3bhhB  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    1e-19  18%  2eb3A  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    3e-19  16%  2cgxA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-19  22%  3c0iA  [x.x.x] PERIPHERAL PLASMA MEMBRANE PROTEIN CASK[MASQUE :
    4e-19  22%  1cdkA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    5e-19  22%  3c0gA  [x.x.x] PERIPHERAL PLASMA MEMBRANE PROTEIN CASK[MASQUE :
    9e-19  27%  3e5aA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-18   8%  3c5iD  [x.x.x] CHOLINE KINASE
    2e-18  20%  3dndA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    2e-18  24%  2dwbA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-18  10%  2brmA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-18  22%  2bfxB  [x.x.x] LOC398457 PROTEIN
    5e-18  23%  3comB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 4
    5e-18  10%  2ckpB  [x.x.x] CHOLINE KINASE ALPHA
    4e-17  20%  1apmE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    7e-17  18%  3bhhD  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    9e-17   7%  2a1sB  [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN
    2e-16  20%  2bmcB  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    3e-16  11%  2ckoB  [x.x.x] CHOLINE KINASE ALPHA
    1e-15  13%  1e7vA  [d.15.1 - b.7.1 - a.118.1 - d.144.1] PHOSPHATIDYLINOSITOL
    1e-15  16%  3dkgA  [x.x.x] MET PROTO-ONCOGENE
    1e-15  20%  3c4yB  [x.x.x] RHODOPSIN KINASE
    2e-15  25%  3dajA  [x.x.x] SERINE/THREONINE KINASE 6
    2e-15   7%  3c5iA  [x.x.x] CHOLINE KINASE
    3e-15  21%  3cqwA  [x.x.x] RAC-ALPHA SERINE/THREONINE-PROTEIN KINASE
    6e-15  16%  3da6A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    7e-15  21%  3dy7A  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    8e-15  16%  3dkoA  [x.x.x] EPHRIN TYPE-A RECEPTOR 7
    3e-14  16%  3c9wA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    4e-14  12%  1e8wA  [d.15.1 - b.7.1 - a.118.1 - d.144.1] PHOSPHATIDYLINOSITOL
    6e-14  20%  3e93A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-13  13%  2bkkA  [x.x.x] AMINOGLYCOSIDE 3'-PHOSPHOTRANSFERASE
    2e-13   7%  2chwA  [x.x.x] PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE
    5e-13  22%  3daeB  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    5e-13  12%  3ckcA  [x.x.x] SUSD
    6e-13  18%  3dk7B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    7e-13  21%  3cg2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    8e-13  15%  1e7uA  [d.15.1 - b.7.1 - a.118.1 - d.144.1] PHOSPHATIDYLINOSITOL
    9e-13  10%  1e8xA  [d.15.1 - b.7.1 - a.118.1 - d.144.1] PHOSPHATIDYLINOSITOL
    1e-12  22%  3daeA  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    1e-12  10%  3csvA  [x.x.x] AMINOGLYCOSIDE PHOSPHOTRANSFERASE
    1e-12  15%  3dfaA  [x.x.x] CALCIUM-DEPENDENT PROTEIN KINASE CGD3_920
    2e-12  21%  3cs9D  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-12   9%  1e90A  [d.15.1 - b.7.1 - a.118.1 - d.144.1] PHOSPHATIDYLINOSITOL
    1e-11  13%  3dqwA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-11  25%  2bvaA  [x.x.x] P21-ACTIVATED KINASE 4
    1e-11   6%  2advA  [x.x.x] GLUTARYL 7- AMINOCEPHALOSPORANIC ACID ACYLASE
    2e-11  21%  3cquA  [x.x.x] RAC-ALPHA SERINE/THREONINE-PROTEIN KINASE
    2e-11  17%  1bygA  [d.144.1] PROTEIN (C-TERMINAL SRC KINASE)
    2e-11   6%  3dxpA  [x.x.x] PUTATIVE ACYL-COA DEHYDROGENASE
    2e-11  17%  3dk6B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-11  20%  3e8cE  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    3e-11   8%  3cuqA  [x.x.x] VACUOLAR-SORTING PROTEIN SNF8
    3e-11   9%  3bdeB  [x.x.x] MLL5499 PROTEIN
    4e-11  14%  3cs9C  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-11  16%  3dgkA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
    5e-11  15%  3bhyA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 3
    6e-11   9%  1e8zA  [d.15.1 - b.7.1 - a.118.1 - d.144.1] PHOSPHATIDYLINOSITOL
    7e-11  11%  3cstA  [x.x.x] PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE
    2e-10   8%  3c5yE  [x.x.x] RIBOSE/GALACTOSE ISOMERASE
    2e-10  12%  2b5mA  [x.x.x] DAMAGE-SPECIFIC DNA BINDING PROTEIN 1
    2e-10   4%  3dyhA  [x.x.x] FARNESYL PYROPHOSPHATE SYNTHASE
    5e-10  11%  2ckoA  [x.x.x] CHOLINE KINASE ALPHA
    5e-10  11%  1e8yA  [d.15.1 - b.7.1 - a.118.1 - d.144.1] PHOSPHATIDYLINOSITOL
    7e-10  17%  3bqrA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 3
    9e-10  17%  2amuA  [x.x.x] PUTATIVE SUPEROXIDE REDUCTASE
    1e-09  13%  3c5yA  [x.x.x] RIBOSE/GALACTOSE ISOMERASE
    2e-09  14%  3bboU  [x.x.x] RIBOSOMAL PROTEIN L22
    2e-09   9%  3e3pA  [x.x.x] PROTEIN KINASE, PUTATIVE GLYCOGEN SYNTHASE
    2e-09   5%  1b5dA  [d.117.1] PROTEIN (DEOXYCYTIDYLATE HYDROXYMETHYLASE)
    3e-09   8%  1a35A  [e.15.1 - d.163.1] PROTEIN (DNA TOPOISOMERASE I)
    5e-09  24%  2bvaB  [x.x.x] P21-ACTIVATED KINASE 4
    5e-09  17%  3dlsD  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    1e-08   9%  3bdeA  [x.x.x] MLL5499 PROTEIN
    1e-08  18%  3dk3B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-08  19%  3dfcB  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
    2e-08  14%  3dpkA  [x.x.x] MACROPHAGE COLONY-STIMULATING FACTOR 1 RECEPTOR
    2e-08  20%  3dneA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    3e-08  15%  2dq7X  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE FYN
    4e-08  15%  3a5cA  [x.x.x] V-TYPE ATP SYNTHASE ALPHA CHAIN
    5e-08   8%  3dplC  [x.x.x] CULLIN-5
    6e-08  16%  3dtwA  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    6e-08  13%  3cokA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PLK4
    7e-08  20%  3dlsB  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    8e-08   5%  1b5eA  [d.117.1] PROTEIN (DEOXYCYTIDYLATE HYDROXYMETHYLASE)
    8e-08  13%  3c5yB  [x.x.x] RIBOSE/GALACTOSE ISOMERASE
    9e-08  19%  3e8eI  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    1e-07  20%  2ckeA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    1e-07   8%  248lA  [x.x.x] T4 LYSOZYME
    1e-07  19%  3dk7A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-07  19%  3dtcA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 9
    2e-07  20%  2ckeB  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    2e-07  15%  3cp9A  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    6e-07  20%  2a2aA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    7e-07  11%  3c5yL  [x.x.x] RIBOSE/GALACTOSE ISOMERASE
    7e-07  11%  3cq9D  [x.x.x] UNCHARACTERIZED PROTEIN LP_1622
    1e-06  15%  3bymA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    1e-06  12%  3ck8A  [x.x.x] SUSD
    1e-06  29%  3dlsC  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    2e-06  16%  3cpcA  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    2e-06  12%  3cqzH  [x.x.x] DNA-DIRECTED RNA POLYMERASES I, II, AND III
    3e-06   8%  3dyhB  [x.x.x] FARNESYL PYROPHOSPHATE SYNTHASE
    3e-06  30%  3dlsE  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    3e-06  10%  1a0eA  [c.1.15] XYLOSE ISOMERASE
    4e-06  13%  1bcpA  [d.166.1] PERTUSSIS TOXIN
    4e-06  10%  3dpdA  [x.x.x] PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE
    5e-06  18%  3cs9B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    8e-06  12%  3dlxA  [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1
    1e-05  10%  2dlaC  [x.x.x] 397AA LONG HYPOTHETICAL PROTEIN
    1e-05  15%  3dlxC  [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1
    1e-05  10%  2ae4A  [x.x.x] GLUTARYL 7-AMINOCEPHALOSPORANIC ACID ACYLASE
    1e-05   9%  3c5yF  [x.x.x] RIBOSE/GALACTOSE ISOMERASE
    2e-05  18%  2cn8A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK2
    2e-05  29%  3dlsA  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    2e-05  16%  3cc6A  [x.x.x] PROTEIN TYROSINE KINASE 2 BETA
    3e-05  15%  3dkcA  [x.x.x] MET PROTO-ONCOGENE
    3e-05  11%  2ckqA  [x.x.x] CHOLINE KINASE ALPHA
    4e-05   9%  3cq9B  [x.x.x] UNCHARACTERIZED PROTEIN LP_1622
    4e-05   7%  3bg0C  [x.x.x] NUCLEOPORIN NUP145
    4e-05  30%  3dlsF  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    4e-05  26%  3dk3A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-05  12%  2a2yA  [x.x.x] DNA/RNA-BINDING PROTEIN ALBA 2
    5e-05  31%  3d5wA  [x.x.x] POLO-LIKE KINASE 1
    5e-05  21%  2ac5A  [x.x.x] MAP KINASE-INTERACTING SERINE/THREONINE KINASE 2
    5e-05  14%  3cpbA  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    6e-05  27%  3cs9A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    7e-05  17%  3dlxB  [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1
    1e-04  14%  3be2A  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    1e-04   8%  1a79A  [d.75.1 - c.52.2] TRNA ENDONUCLEASE
    4e-04  27%  2bajA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-04  18%  2cpkE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, CATALYTIC SUBUNIT
    5e-04  21%  2c3lA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-04  10%  3ek4A  [x.x.x] MYOSIN LIGHT CHAIN KINASE, GREEN FLUORESCENT
    6e-04  14%  2byvE  [x.x.x] RAP GUANINE NUCLEOTIDE EXCHANGE FACTOR 4
    6e-04  26%  3d4qA  [x.x.x] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    6e-04  24%  3b8eA  [x.x.x] SODIUM/POTASSIUM-TRANSPORTING ATPASE SUBUNIT[MASQUE :
    8e-04  22%  3b8qB  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
:603

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxFPDGEELPEYIGPYKIRRRIGQGGMGVVYQAVDPQDRLVAVKVLRAEVAGDDIARARLAREVMT
3dbsA           -------------------LEFKCADPTALSNETIGIIFKHGDMLILQILRIMEIWETESLDLCLLPYGC
3dxnA           -------------------DRYQRVKKLGSYGEVLLCKDKTGAERAIKIIKKSSVTTTSNSGALLDEVAV
2c3jA           -----------------------DLVQTLGEGEVQLAVNRVTEAVAVKIVDMK-------RENIKKEICI
3dk6A           ----------DKWE--MERTDITMKHKLGQFGEVYEGVWKKYLTVAVKT---------LEVEEFLKEAAV
2e2bA           ------NYDKWEME--RTDITMKHKLGGGQYGEVYEGVWKYSLTVAVKTLMEV--------EEFLKEAAV
2bmcA           -------------------FEIGRPLGKGKFGNVYLAREQSKFILALKVLFKAQLEKAGVEHQLRREVEI
2c47C           --------------------------RVGKKIELRLGKNLYTEYVAIKLEP-----IKSRAPQLHLEYRF
2bmcF           -------------------FEIGRPLGKGKFGNVYLAREQSKFILALKVLFKAQLEKAGVEHQLRREVEI
3bceA           -------------------LKRVKVLGSGAFGTVYKGIWPEGETVKIPVAIKILNETPKANVEFMDEALI
3e87A           -------------------FDYLKLLGKGTFGKVILVREATGRYYAMKILRKEVIIAKDEVAHTVTESRV
2e2bB           -------------PSSPNYDKWEMERTDITMKHKLGGGQYGEVYGVWKKYSLTVAVKTLEVEEFLKEAAV
2c47A           -------------------------FRVGKKIELRLGKNLYTEYVAIKLEP-----IKSRAPQLHLEYRF
3dkfA           -------------------VHFNEVIGRGHFGCVYHGTLKKIH-CAVKSLNRITDIGEVSQFLTEGIIMK
3csfA           -------------------CADPTALSNETIGIIFKHGDLRQDMLILQILRIMESIWETESLDLCLLPYG
3ei1A           ---------------TAQKPTAVNGCVTGHFTSAEDLNLAKNTRLEIYVVTAEGL-RPVKEVGMYGKIAV
3ckwA           ------------------PEE--LFTKLEKIGEVFKGIDNRTKVVAIKIIDLEEIED------IQQEITV
3bhhC           ---------------------MTDEYQLYEDIVVRRCVKLCTHEYAAKIINTKKL-SARDHQKLEREARI
3blrA           ----------CPFCDEVSKYEKLAKIGQGTFGEVFKARHKTGQKVALKKVLMENEKEGFPI-TALREIKI
1cmkE           ----------AQNTAHLDQFERIKTLGTGSFGRVMLVKHKEGNHFAMKILDKQKVVKLKQIEHTLNEKRI
3byvA           -------------------LVRGTVLGQEDPYAYLEATDETGESFELRLRLLRGIKNQKQAKVHLRFIFP
3bhhB           -------------------YQLYEDIGKSVVRRCVKLCTGHEYAAKIINTKKL---SARDHQKLEREARI
2eb3A           -------PNQALLRILKETEFKKIKVLGSAFGTVYKGLWIPEEKVKIPVAILREATSPKANKEILDEAYV
2cgxA           ----------------VEDWDLVQTLGEGAYGEVQLAVNRVTEAVAVKIVDMKRCPENIKK-----EICI
3c0iA           ------------------------------------------QQFAVKIVDVATSSPGLSTEDLKREASI
1cdkA           ----------AQNTAHLDQFERIKTLGTGSFGRVMLVKHKETNHFAMKILDKQKVVKLKQIEHTLNEKRI
3c0gA           ------------------------------------------QQFAVKIVDVATSSPGLSTEDLKREASI
3e5aA           -------------------FEIGRPLGKGKFGNVYLAREKQSFILALKVLFKAQLEKAGVEHQLRREVEI
3c5iD           ----------EVYKTMSKYKIAPQLLNTFNGGRIEEWLYGDPLRIDLKNPTIL---IGIANVLGKFHTLS
3dndA           ------WENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETNHYAMKILDKQKVVKLKQIEHTLNEKRI
2dwbA           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLFKAQLEKAGVEHQLRREVEI
2brmA           -------------------WDLVQTLGEGAYGEVQLAVNRVTEAVAVKIVDMCPE-NIKKEICINKMLNH
2bfxB           ----------AEMPKRKFTIDDFDIGRPLGKGNVYLAREQNKFIMALKVLFKSQLEKEGVEHQLRREIEI
3comB           -------------------PEEVFDVLEKLGGSVYKAIHKETQIVAIKQVP-----VESDLQEIIKEISI
2ckpB           -------------------YLWCKEFLPGAWRGLREDEFHISVINMLFQCSL----PKVLLRLMVLESVM
1apmE           ----------SQNTAQLDQFDRIKTLGTGSFGRVMLVKHKEGNHYAMKILDKQKVVKLKQIEHTLNEKRI
3bhhD           ---------------------MTDEYQLYEDIVVRRCVKLCTHEYAAKIINTKKLSAR-DHQKLEREARI
2a1sB           -------------------DFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKP---------FNRSSPDV
2bmcB           -------------------FEIGRPLGKGKFGNVYLAREQSKFILALKVLFKAQLEKAGVEHQLRREVEI
2ckoB           ---------PGAWRGLREDEFHISVIRGGLSNMLFQCSLPDTTATLGDEPRKVLLRLPDISAEIAEKMAT
1e7vA           ------------------PLWLEFKDPTALSNETIGIIDLRQDMLILQILRIMESIWETESLDLCLPYGC
3dkgA           -----------ELVQAVQHVVIGPIVHFNEVICVYHGTLLDKIHCAVKSLNRITDIGEVSQFL--TEGII
3c4yB           -------------------AQPMGEDWFLDFRVVFACQMATGKLYACKKLNKKRLKKRKGYQGAMVEKKI
3dajA           -------------------FDIGRPLGKGKFGNVYLARERQSFILALKVLFKTQLEKAGVEHQLRREVEI
3c5iA           ----------------------------------------------------------------------
3cqwA           -------------------FEYLKLLGKGTFGKVILVKEKATRYYAMKILKKEVIVAKDEVAHTLTENRV
3da6A           ---------GDSTFTVLKRYQNLKPIGSGGIVCAAYDAVLDRNVIKKLSRPFQNQTHAKRAYRELVLMKC
3dy7A           -------------------FEKISELGAGNGGVVFKVSHKPSGLVMARLIHLEI--KPAIRNQIIRELQV
3dkoA           ----------QFAKELDASCIKIERVIGAEFGEVCSGRLKLPGKRDVAVATLKVGYTEKQRRDFLCEASI
3c9wA           ----------GQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLKVRVAIKKISPFHQTYCQRTLREIKILLR
1e8wA           ------MASKKKPLWLEFKCADPTALSNETIGIIFKHGDRQDMLILQILRIMESIWETESLDLCLLPYGC
3e93A           ----------KTIWEVPERYQNLSPVGSGAYGSVCAAFDTKGLRVAVKKLSRPFQSIIHAK-RTYRELRL
2bkkA           ----------PELKKLIEKYRSVKDTEGMSPAKVYKLVGENEN-LYLKMTDSRYKGT---TYDVEREKDM
2chwA           -------------------LEFKCADPTALSNETIGIIFKHGDMLILQILRIMESIWETESLDCLLPYGC
3daeB           ---------------HIGNYQIVKTLGEGSFGKVKLAYHTTGQKVALKIINKKV----LAQGRIEREISY
3ckcA           -------------------TSISWSPSSQRTEWVYVRLGYDITQYNFFLDQTEGMTDA-ETLRQRAEIRF
3dk7B           -------------------ITMKHKLGGGQYGEVYEGVW---KKYSLTVAVKTLMEVE----EFLKEAAV
3cg2A           -------------------EVPERYQNLSPVGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRL
1e7uA           ------------------PLWLEFKDPTALSNETIGIIDLRQDMLILQILRIMESIWETESLDLLLPYGC
1e8xA           -------------------LEFKCADPTALSNETIGIIDLRQDMLILQILRIMSIWETESLDLCLLPYGC
3daeA           ---------------HIGNYQIVKTLGEGSFGKVKLAYHTTGQKVALKIINKKV----LAQGRIEREISY
3csvA           ----------------IRDFLATHGYADWNRTPRYQRLRSPTAKAVLDWSPGGDTQPFVDLAQYLRNLDI
3dfaA           -------------------YNIVCMLGKGSFGEVLKCKDRITQQEYAVKVINKASAKNKDTSTILREVEL
3cs9D           -------------------MERTDITMKHKLGGVYEGV----WTVAVKTLKE----DTMEVEEFLKEAAV
1e90A           ------------------PLWLEFKDPTALSNETIGIIDLRQDMLILQILRIMESIWETESLDLCLPYGC
3dqwA           ----------DAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTRVAIKTLKPGTMSPEAF----LQEAQVM
2bvaA           -----------------PGDPRSYLDNFIKIGIVCIATVRSSGKLV----------AVKKMDLLFNEVVI
2advA           ----------------------------------------------------------PIAAYKPRSNEI
3cquA           -------------------FEYLKLLGKGTFGKVILVKEKATRYYAMKILKKEVIVAKDEVAHTLTENRV
1bygA           ---------GWALN--MKELKLLQTIGKGEFGDVMLGDYGNKVAVKCIKND---------AQAFLAEASV
3dxpA           -------------------YRVDALAGTDVPVAKYALCEDESVIGRAFYIEFVSGRVLWDQSLPGSPAED
3dk6B           -------------------WEMERTDITMKHKEVYEGVW--------KKYSLTVAVKTLEVEEFLKEAAV
3e8cE           ----------AQNTAHLDQFERIKTLGTGSFGRVMLVKHETGNHYAMKILDKQKVVKLKQIEHTLNEKRI
3cuqA           ------------------------------------------------------------FKTNLEEFAS
3bdeB           -------------------SHSLEEKRFLVDAKKILSAIRGVHFEQLRQISPKIDYHFGFSEFADQAAYT
3cs9C           -------------------DKWEMERTDITMKHKLGGGQYGEVYEGVKKYSLTVAVKTLEVEEFLKEAAV
3dgkA           -------------------YDTGEELGSGKFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDIER
3bhyA           -------------------YEMGEELGSGQFAIVRKCRQKGTAAKFIKKRRLSSSRRGVSREEIEREVNI
1e8zA           ----------MASKKKPLWLEFKCADPTALSNETIGIIFKHGDLRQDMLILQILRIMESIWETESLLPYG
3cstA           -------------------LEFKCADPTALSNETIGIIFLRQDMLILQILRIMESIWETESLDLCLLPYG
3c5yE           ----------------------------------------------------------------------
2b5mA           ------------------PTAVNGCVTGHFTSAEDLNLLAKNTRLEIYVVTAEGL-RPVKEVGMYGKIAV
3dyhA           ---------------------------------------------PMQMFMQ----VYDEIQMFLLEELE
2ckoA           ---------PGAWRG-LREDEFHISVIRGGSNMLFQCSLPDTTATLGDEPRKVLLRLPDISAEIAEKMAT
1e8yA           -------------------LEFKCADPTALSNETIGIIFKHGDDLILQILRIMESIWTESLDLCLLPYGC
3bqrA           -------------------YEMGEELGSGQFAIVRKCRQKGTGAKFIKKRRLSSSRRGVSREEIEREVNI
2amuA           -------------------MKLSDFIKTEDFKKEK----------HVPVIEAEKVKKD---EKVQIVVTV
3c5yA           ----------------------------------------------------------------------
3bboU           ---------------------------------------------------------DEITTRG-YSI--
3e3pA           -------------------ERSRKEMD-RFQVEVQLGKESTGMSVAIKKVIQDPRFRNREL-QIMQDLAV
1b5dA           ----------------------------------------------------------------------
1a35A           ----------DNHKERIANEPPGLFRGRGNHPKMGMLKR--------RIMPEDIIINCSKDAKV-PSPPP
2bvaB           ------------------PRSYLDNFIKIGEGIVCIATVRSSKLVAVKKM----------DLLLFNEVVI
3dlsD           -------------------YSTMSPLGSGAFGFVWTAVDKENKEVVVKFIKKEKVLDCWILGKVTLEIAI
3bdeA           -------------------SHSLEEKRFLVDAKKILSAIRGVHFEQLRQISPKIDYHFGFSEFADQAAYT
3dk3B           -------------------ITMKHKLGGGQYGEVYEGV---WKKYSLTVAVK----TLMEVEEFLKEAAV
3dfcB           -------------------YDTGEELGSGKFAVVKKCREKSTAAKFIKKRRTKSSRRGVSREDIEREVSI
3dpkA           -------PYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGGAVLKVAVKMLKSTAHADEKEALMSELKI
3dneA           ------WENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETNHYAMKILDKQKVVKLKQIEHTLNEKRI
2dq7X           ----------DVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEE---AQIM
3a5cA           ----------------------------------------------------------------------
3dplC           ---------------PKDFTEGTLFSVNQEFSLIKNAKVKRGKINLIGRLQLTTERMREEENE--GIVQL
3dtwA           -----------------------QVIEADAFGIDKTC-----RTVAVKMLKEGA--THSEHRALMSELKI
3cokA           -------------------FKVGNLLGKGSFAGVYRAEIHTGLEVAIKMIDKK---AMYKAGMVQRVQNE
3dlsB           -------------------YSTMSPLGSGAFGFVWTAVDKENKEVVVKFIKKEWI-EDPKLGKVTLEIAI
1b5eA           ----------------------------------------------------------------------
3c5yB           ----------------------------------------------------------------------
3e8eI           ----------AQNTAHLDQFERIKTLGTGSFGRVMLVKHETGNHYAMKILDKQKVVKLKQIEHTLNEKRI
2ckeA           -------------------YDIGEELGSGQFAIVKKCREKSTAAKFIKKRQSRASRRGVSREEIEREVSI
248lA           ---------------------------------------------------------------MLRIDEG
3dk7A           -------------------ITMKHKLGGGQYGEVYEGVWKKYLTVAVKTLK--------EVEEFLKEAAV
3dtcA           -------------------LTLEEIIGIGGFGKVYRAFWIGDEVAVKAAT----------IENVRQEAKL
2ckeB           -------------------YDIGEELGSGQFAIVKKCREKSTAAKFIKKRQSRASRRGVSREEIEREVSI
3cp9A           ----------EFPRDRLKLGKPLQVIEADAFGIDKT---ATCRTVAVKMLKEGATHSEHRALMSELKILI
2a2aA           -------------------YDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVSEREVSI
3c5yL           ----------------------------------------------------------------------
3cq9D           ------------VKRGIQPVVVGDFVKDALVGAIVVKPDHTDTQLAIKSIF-----EQLQPDEVHLYGAT
3bymA           ----------DEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGS--MSPDAFLAEANLMK
3ck8A           -------------------------RTEWVYVRLGYDIT-----QYNFFLDQTEGMTDAETLRQRAEIRF
3dlsC           -------------------YSTMSPLGSGAFGFVWTAVDKENKEVVVKFIKKEKVIEDPKLGKVTLEIAI
3cpcA           ----------EFPRDRLKLGKPLQVIEADAFGIDKT---ATCRTVAVKMLKEGATHSE--HRALMSELKI
3cqzH           ----------------------------------------------------------------------
3dyhB           ------------------------------------------------------------IQMFLLEELE
3dlsE           -------------------YSTMSPLGSGAFGFVWTAVDKENKEVVVKFIKKEVWIEDPKLGKVTLEIAI
1a0eA           ----------------------------------------------------------------------
1bcpA           -----------------RPPEDVFQNGFTAWGNNDNVLELTGRSCQVG--SSNSAFVSTSSSRRYTEVYL
3dpdA           -------------------CADPTALSNETIGIIFKHGDDLRDMLILQILRIMESIWETESLDLCLPYGC
3cs9B           -------------------ITMKHKLGGGQYGEVYEGVWKKYLTVAVKTL-------TMEVEEFLKEAAV
3dlxA           ----------------------------------------------------------------------
2dlaC           -------------------------------------------MIMLDPFS---EKAKELLKGFGSINDF
3dlxC           ----------------------------------------------------------------------
2ae4A           ----------------------------------------------------------PIAAYKPRSNEI
3c5yF           ----------------------------------------------------------------------
2cn8A           -------------------LRDEYIMSKTLGSEVKLAFERKTCKKVAI----------KIISKNVETEIE
3dlsA           -------------------YSTMSPLGSGAFGFVWTAVDKENKEVVVKFIKKEKVLEDCKLGKVTLEIAI
3cc6A           -------------------VVLNRILGEGFFGEVYEGVKGEKINVAVKTCKKD--CTLDNKEKFMSEAVI
3dkcA           -------------------VHFNEVIGRGHFGCVYHGTLLDNDHCAVKSLNRITDIGEVSQFLTEGIIMK
2ckqA           -------------------SVMFAILAERSLGPKLYGIFPQGRLEQFIPLDTEELSLPDISAEIAEKMAT
3cq9B           -------------FDSIDAAELQTVKDALVGAIVVKPDQDHTDTQLAIKSIFEQLQPDEVHLYGATGGR-
3bg0C           -------------------RLPTELQRKFLFDDVYLDKEIEKVTIEARKSNPYPQISESSLLFKDALDYM
3dlsF           -------------------YSTMSPLGSGAFGFVWTAVDKENKEVVVKFIKKEVWIEDPKLGKVTLEIAI
3dk3A           -----------EME--RTDITMKHKLGGGQYGEVYEGVWKKYLTVAVKTLK--------EVEEFLKEAAV
2a2yA           ------VRKTKNVEDHV--LDVIVLFNQGIDEVILKGTGREIKAVDVYNSLKDRLGDGVQLVNV-QTGSE
3d5wA           -------PDVLVDPRTMKRYMRGRFLGKGGFAKCYEITD-------------------------------
2ac5A           -------------------QLQEDVLGEGAHARVQTCINLITSQEYAVKIIEKQPGHIR-SRVFREVEML
3cpbA           ----------EFPRDRLKLGKPLQVIEADAFGIDKT---ATCRTVAVKMLKEGA--THSEHRALMSELKI
3cs9A           -------------------ITMKHKLGGGQYGEVYEGVWKKYLTVAVKTLK--------EVEEFLKEAAV
3dlxB           ----------------------------------------------------------------------
3be2A           -------------------LKLGKPLGRGAFGQVIEADADTCRTVAVKMLKEGATHSEHRALMSELKILI
1a79A           --------------------NFLSLSLVEALYLINLGWYKDNKPLSFEELYEY---ARNVEERLCLKYLV
2bajA           ----------ELIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRL
2cpkE           ----------SQNTAQLDQFDRIKTLGTGSFGRVMLVKHESGNHYAMKILDKQKVVKLKQIEHTLNEKRI
2c3lA           --------------PFVEDWDLVQTLGEGAYGEVQLAVNRVT----------------------------
3ek4A           ----------------------------------------------------------------------
2byvE           ----------------------------------------------------------------------
3d4qA           ----------DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKML----------------------
3b8eA           ----------------------------------------------------------------------
3b8qB           -----------------------QVIEADAFGIDKT---ATCRTVAVKMLKEG--ATHSEHRALMSELKI


                         .         .         *         .         .         .         .:140
query           MRRVRSRNVAEVIDADTTAPLPWVVTEYIPGPTLDSTVTNHGPLRGRALTRVVTGLARALRDIHAAEIIH
3dbsA           ISTGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLNHWLKEKSPTEEKFRFVYSCAGYCVATFVLGI
3dxnA           LKQLDHPNIMKLYEFFEDKRNYYLVMEVYRGGELFDEIILRQKFSEVDAAVIMKQVLSGTTYLHKHNIVH
2c3jA           NKMLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVYLHGIGITH
3dk6A           MKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNEVSAVVLLYMATQISSAMEYLEKKNFIH
2e2bA           MKEIKHPNLVQLLGVCTREPPFYIITEFYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIH
2bmcA           QSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIH
2c47C           YKQLSATEGVPQVYYFGPGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLITRMEYVHTKENFL
2bmcF           QSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIH
3bceA           MASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVH
3e87A           LQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVY
2e2bB           MKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYECNRQEVNAVVLLYMATQISSAMEYLEKKNFIH
2c47A           YKQLSATEGVPQVYYFGPGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIY
3dkfA           DFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKFLASKKFVH
3csfA           ISTGDKIGMIEIVKDATTIAKIQQSTVGNTGFKDEVLNHWLKEKSPFQAAVERFVYSCAGYCVATFDNIM
3ei1A           MELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIIRAHGNVQDRIGRPSETGIIGIIDPECRMIGLR
3ckwA           LSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLL-EPGPLDETQIATILREILKGLDYLHSEKKIH
3bhhC           CRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVH
3blrA           LQLLKHENV--VNLIEICRTSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILH
1cmkE           LQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIY
3byvA           FDLVKDPQKKKMIRVMWVLSRFFLYPRMQSNLQTFGEVLLSHSSTHKSLVQLTLQVIRLLASLHHYGLVH
3bhhB           CRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVH
2eb3A           MASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVH
2cgxA           NKMLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVYLHGIGITH
3c0iA           CHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIH
1cdkA           LQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIY
3c0gA           CHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIH
3e5aA           QSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIH
3c5iD           RKRHLPEHWDRTPCIFKMMEKWKNQLFKYKNIEKYNCDIHKYIKESDKFIKFMKVYSKSDNLANTIVFCH
3dndA           LQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIY
2dwbA           QSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIH
2brmA           ENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVYLHGIGITHRDIKPE
2bfxB           QSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALHYCHERKVIH
3comB           MQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRRNKTLTEDEIATILQSTLKGLEYLHFMRKIH
2ckpB           FAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEFHGMKMPFNKEPKWLFGTMEKLSRSLLEPSPVVFCH
1apmE           LQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFAEPHARFYAAQIVLTFEYLHSLDLIY
3bhhD           CRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVH
2a1sB           KFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDIPEDQKKFIDQVVEKIEDLLQSEENKN
2bmcB           QSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIH
2ckoB           FHGMKMPFNKEPKWLFGTMEKYLKEVLRIKFTEESRIKKLHKLLSYNLPLELENLRSLLESTPSPVVFCH
1e7vA           ISTGDKIGMIEIVKDATTIAKIQQNTGAFKDEVLSHWLKEKCPIEEKFQAVERFVYSCAGYCVATFVLGI
3dkgA           MKDFSHPNVLSLLGICLRSEGSPLVVLPYMGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKFLASKKFVH
3c4yB           LAKVHSRFIVSLAYAFETKTDLCLVMTIMNGGDIRYHIYNVDEDNPGFAIFYTAQIVSGLEHLHQRNIIY
3dajA           QSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSRFDEQRTATYITELANALSYCHSKRVIH
3c5iA           --------------------------------------------------KFMKVYSKSDNLANTIVFCH
3cqwA           LQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVV
3da6A           VNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIH
3dy7A           LHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIM
3dkoA           MGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALDAFLRKHDGQF----------------TVIQLVGML
3c9wA           FRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLH
1e8wA           ISTGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLSHWLKEKCPIEEKERFVYSCAGYCVATFVLGI
3e93A           LKHMKHENVIGLLDVFTPARSLEEFNDVYLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIH
2bkkA           MLWLEGKLPVPKVLHFERHDGWSDISDCPYTNSLDSRLAELDYLLNNKDPRELYDFLKTEKPEEELVFSH
2chwA           ISTGDKIGMIEIVKDATTIAKIQQSTVGNTEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGI
3daeB           LRLLRHPHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKM------------------SEQEARRFF
3ckcA           LRALHYWYFLDLFGKAPFKEHFSNDLPVEKKGTELYTYIQNELNEIEADMYEPRQAPFGRADKAANWLLN
3dk7B           MKEIKHPNLVQLLGVCTREPPFYIIIEFMTYGNLLDYLCNRQEVSAVVLLYMATQISSAMEYLEKKNFIH
3cg2A           LKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIH
1e7uA           ISTGDKIGMIEIVKDATTIAKIQGNTGAFKDEVLSHWLKEKCPIEEKFQAAVERFVSCAGYCVATFVLGI
1e8xA           ISTGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFVLGI
3daeA           LRLLRHPHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKM------------------SEQEARRFF
3csvA           SAPEIYAEEHARGLLLIEDLGDALFTETRLAFSEYRYAILGDAAEDNRKRFEHRFAQILSAQLEGDVFVH
3dfaA           LKKLDHPNIMKLFEILEDSSSFYIVGELYTGELFDEII-KRKRFSEHDAARIIKQVFSGITYMHKHNIVH
3cs9D           MKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECQEVNAVVLLYMATQISSAMEYLEKKNFIH
1e90A           ISTGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLSHWLKEKCPQAAVERFVYSCAGYCVATFVLGI
3dqwA           KKLRHEKLVQLYAVVSEEPIYIVIEYMSKGSLLDFLKGEMGKYLRLPQLVDMAAQIASGMAYVERMNYVH
2bvaA           MRDYQHENVVEMYNSYLVGDELWVVMEFLEGGA-LTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIH
2advA           LWD--GYGVPHIYGVDAPSA--FYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVP
3cquA           LQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVV
1bygA           MTQLRHSNLVQLLGVIVEEGLYIVEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVH
3dxpA           ENRVIAAHTVDYQAIGLGDYGKPGNYFQRQIERWTKQYKLSTESIPADSLDWLPQHIPQEDADLTSIVHG
3dk6B           MKEIKHPNLVQLLGVCTREPPFYIIFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIH
3e8cE           LQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIY
3cuqA           KHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLE
3bdeB           RYNDHPDHVAFVRDRWVPEVEKFLEIDYVPL---------------------------------------
3cs9C           MKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQE---------------VNAVVLLYMA
3dgkA           EVSILKEIQHPNVEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFLKQILNGVYYLHSLQIAH
3bhyA           LREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFLKQILDGVHYLHSKRIAH
1e8zA           CISTGDKIGMIEIVKDATTIAKIQQSTVGNTGFKDELKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGI
3cstA           CISTGDKIGMIEIVKDATTIAKIQQSTVGNTGFKDEVLNHWLKEKSPTEEKFQAAYSCAGYCVATFVLGI
3c5yE           --------------------------------------------------KIALIIENSQ--AAKNAVVH
2b5mA           MELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITAHGNVQDRIGRPSETGIIGIIDPECRMIGLR
3dyhA           LKFDMDPNRVRYLRKMMDTTCLGGKYNRGLTVIDVAESLSLDGARRKRVLHDACVCGWMIEFLQAHYLVE
2ckoA           FHGMKMPFNKEPKWLFGTMEKYLKEVLRIKFTEESRIKKLHKLLSYNLPLELENLRSLLESTPSPVVFCH
1e8yA           ISTGDKIGMIEIVKDATTIAKIQQSTVGNTGFKDEVLNHWLKEKSPTEEKFQAAVYSCAGYCVATFVLGI
3bqrA           LREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFLKQILDGVHYLHSKRIAH
2amuA           GKEIPHPNTTEHHIRGDPYVYEVGRYEFNAHGESVQGPNIGAVYTEPTVTTVVSGTIIALSNIHGLWESS
3c5yA           -------------------------------------------------------LIIENSQAAKNAVVH
3bboU           --SMSVDKA-------------RRVIDQIRGRSYAETLMILELMPYRACYPIFKLIYSAAANSHNKQFNK
3e3pA           LHHPNIVQLQSYFYTLGERDRRDIYLNVVMEYVPDTLHRCCRNYYRRQVAPPPIRSIGCLHLPSVNVCHR
1b5dA           --------------------------WYKSKSLFVKDIPGETPKIWQQVASSKGEINSNYGWAIWSEDNY
1a35A           GHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKS
2bvaB           MRDYQHENVVEMYNSYLVGDELWVVMEFLEGGA-LTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIH
3dlsD           LSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDII
3bdeA           RYNDHPDHVAFVRDRWVPEVEKFLEIDYVPL---------------------------------------
3dk3B           MKEIKHPNLVQLLGVCTREPPFYIITEFMTNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIH
3dfcB           LKEIQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFLKQILNGVYYLHSLQIAH
3dpkA           MSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRQLSSRDLLHFSSQVAQGMAFLASKNCIHR
3dneA           LQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIY
2dq7X           KKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIH
3a5cA           ---------------------------------------------------------ASIYVGVTIAEYF
3dplC           RILRTQEAIIQIMKMRKKISNAQLQTELVEILKNMFLPQKKM-------------IKEQIEWLIEHKYIR
3dtwA           LIHIGHHLNVNLLGACTKPGGPLMVITEFCKFGNLSTYLRSKRNEFVPYKVAPEDLYKDFLTLEHLICYS
3cokA           VKIHCQLKHPSILELYNYFEDSNYVYLV----------LEMCHNGE----------------------MN
3dlsB           LSRVEHANIIKVLDFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIH
1b5eA           --------------------------WYKSKSLFVKDIPGETPKIWQQVASSKGEINSNYGWAIWSEDNY
3c5yB           -------------------------------------------------------LIIENSQAAKNAVVH
3e8eI           LQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIY
2ckeA           LRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYLHTKKIAH
248lA           LRLKIYKDTETAGAGHLLTKS-PSLNAAKSELDKAIGRNTNGVIAEKLFNQDVDAAVRGILRNAKLKPVY
3dk7A           MKEIKHPNLVQLLGVCTREPPFYIIIETYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIH
3dtcA           FAMLKHPNIIALRGVCLKELCLVMEFARGGPLNRVLSGKRIPPDILVNWAVQIARGMNYLHDEAIVPIIH
2ckeB           LRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYLHTKKIAH
3cp9A           HIGHHLNVVNLLGACTKPGGPLMVITEFCKFGNLSTYLRSKRNEFVPYKVAPEDLYKDFLTLEHLICYSF
2a2aA           LRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYLHTKKIAH
3c5yL           -------------------------------------------------------LIIENSQAAKNAVVH
3cq9D           GGRLDHLLANWLVLDPVFRQW-APQIKLIDKQNSVRFFLPGDYQITKEADKRYLALPDEKYQLDAAYNAY
3bymA           QLQHQRLVRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHR
3ck8A           LRALHYWYFLDLFKAPFKEHFSNDLPVEKKGTELYTYIQNELNEIEADM-----YEPRQAPFGRADKAAN
3dlsC           LSRVE-----------------------------------------------------------------
3cpcA           LIHIGHHLNVVNLGACTKPGGPLMVITEFCKFGNLSTYLRSKRNEFVPYKVAPEDLYKDFLTLEHLICYS
3cqzH           --------------------------------------------------------------LFDDIFQV
3dyhB           LKFDMDPNRVRYLR---------KMMDTTCLGVAESLLSLDDGARRKRVLHDACVCGWMIEFLQAHYLVE
3dlsE           LSRVE-----------------------------------------------------------------
1a0eA           ----------------------------------------------------------------------
1bcpA           EHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVD-TYGDNAGRILAGALATYQSEYLAH
3dpdA           ISTGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLG
3cs9B           MKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQE---------------VNAVVLLYMA
3dlxA           ----------------------------------------------------------------------
2dlaC           MDAIPKDDVIERIRVVKNEKLIDKFLDQDNVMDLAQFYALLGALSYSPYGIKANLIIYSERLKRKKEIKP
3dlxC           ----------------------------------------------------------------------
2ae4A           LWD--GYGVPHIYGVDAPSA--FYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVP
3c5yF           -------------------------------------------------------LIIENSQAAKNAVVH
2cn8A           ILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIH
3dlsA           LSRVE-----------------------------------------------------------------
3cc6A           MKNLDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYLESINCVH
3dkcA           DFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKFLASKKFVH
2ckqA           FHGMKMPFNKEPKWLFGTMEKYLKEVLRIKFTEESRIKKLHKLLSYNLPLELENLRSLLESTPSPVVFCH
3cq9B           LDHLLANWLVLDPVFRQWAPQIKLIDKQNSVRFFLPGDYQITKEADLAFVPLPHLTLPDEKYQDAAYNAY
3bg0C           EKTSSDYNLWKLSS--------ILFDPVSYPYKTDNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRN
3dlsF           LSRVE-----------------------------------------------------------------
3dk3A           MKEIKHPNL-------------------------------------------------------------
2a2yA           VRDRRRISYILLR---------------------------------------------------------
3d5wA           ----------------------------------------------------------------------
2ac5A           YQCQGHRNVLELIEFFEEEDRFYLVFEKMRGGSILSHIHKRRHFNELEASVVVQDVASALDFLHNKGIAH
3cpbA           LIHIGHHLNVVNLLGACTKPGGPLMVITEFCKFGNLSTYLRSKRNEFVPYKVAPEYKDFLTLEHLICYSF
3cs9A           MKEIK-----------------------------------------------------------------
3dlxB           ----------------------------------------------------------------------
3be2A           HIGHHLNVVNLLGACTKPGGPLMVITEFCKFGNLSTYLRSKRNEFVPYKVAPEDLYKDFLTLEHLICYSF
1a79A           YKDLRTRGYIVKTGLKYGADFRLYERGANIDKEHSVYLVKVLLSELTGFVRVAHSVRKKLLIAIVDAIVY
2bajA           LKHMKHENVIGLLDVFTPARSLEEFNDVYLVT------HLMGADLNDHVQFLIYQILRGLKYIHSADIIH
2cpkE           LQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYR
2c3lA           ----------------------------------------------------------------------
3ek4A           ------------------------AVRAIGRLSSLENVYDKQKNGIKANFKIRHNIEDGGVQLAYHYQQN
2byvE           -----------------------------------------------------------KRELAGVLIFE
3d4qA           ----------------------------------------------------------------------
3b8eA           ----------------------------------------------ESFKNMVPQQALVIRNGEKMSINA
3b8qB           LIH-------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RDLKPGNVIICNGEPIIIDFGIAYAVDGSKLTQTGTFVGTPSYLSPEVIEGSDLSPATDIHAWGATVAFA
3dbsA           GDRHNDNIMITTGNLFHIDFGHERVPFVLTPDFLFVMGTSGKQKFQDICVKAYLALRHHTNLLIILFSMM
3dxnA           RDLKPENLLLEKSDALIKIVDFGLSAHFERLGTA----YYIAPEVLRKKYDEKCDVWSCGVILYILLCGY
2c3jA           RDIKPENLLLDRDNLKISDFGLAFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAM
3dk6A           RDLAARNCLVGENHLVKVADFGLSRLMTGDTTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEI
2e2bA           RDLAARNCLVENHLVKVADFGLSRLTY----TAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEI
2bmcA           RDIKPENLLLGSGELKIADFGWSVTLDYLPPEMI-EGRMHDEKVDLWSL--------------GVLCYEF
2c47C           VGRPGQHAIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYF
2bmcF           RDIKPENLLLSAGELKIADFGWSVTLDYLP-PEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQE
3bceA           RDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNAGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWEL
3e87A           RDIKLENLMLKDGHIKITDFGLCKEGISDGATM--KFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEM
2e2bB           RDLAARNCVGENHLVKVADFGLST------YTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEI
2c47A           RDVKPENFLVIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYF
3dkfA           RDLAARNCLDEKFTVKVADFGLA----------RDMYKLPVKWMALESLQTQKFTTKSDVWSFGVLLWEL
3csfA           ITETGNLFHDFGHLGERVPFVLTPDFLFVMGTSG-KKTSPHFQKFQDICVKAYLALRHHTNLLIILFSMM
3ei1A           LYDGLFKVIPDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVY-----------------------
3ckwA           RDIKAANVLLSEHGEV---------------KLADFFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIEL
3bhhC           RDLKPENLLLCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKEAYGKPVDIWACGVILYIL
3blrA           RDMKAANVLITRDGVLKLADFGLARAFSLAPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEM
1cmkE           RDLKPENLLIDQQ---GYIQVTDFGFAKRVKG-RTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEM
3byvA           TYLRPVDILDQRGGVFLTGFEHLVRDGARVVSSPPELEARRATISYHRDRRTLMTFSFDAWALGLVIYWI
3bhhB           RDLKPENLLLASKCAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKEAYGKPVDIWACGVILYIL
2eb3A           RDLAARNVLVTPQHVKITDFG-------------RAKLVPIKWMALESILHRIYTHQSDVWSYGVTVWEL
2cgxA           RDIKPENLLLDRDNLKISDFGLAFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAM
3c0iA           RDVKPHCVLLNSAPVKLGGFGVAIQLGESGLV-AGGRVGTPHFMAPEVVKREPYGKPXXXXXXXXXXXXX
1cdkA           RDLKPENLLIQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEM
3c0gA           RDVKPHCVLLNSAPVKLGGFGVAIQLGESGLV-AGGRVGTPHFMAPEVVKREPYGKPXXXXXXXXXXXXX
3e5aA           RDIKPENLLLGSAGELKIADFGWS---VHAPSSRRTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEF
3c5iD           NDLQENNIINTNCLRLIDFEYSGFNFLATDIANFFIETSIDYSVSSYPFFEIDKKKYISYENRKLFITAY
3dndA           RDLKPENLLIDQQGYIQVTDFG----FAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEM
2dwbA           RDIKPENLLLSAGELKIADFGWSV-------HAPSSRTLCGTLDYLPPEIEGRHDEKVDLWSLGVLCYEF
2brmA           NLLLDERDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAG
2bfxB           RDIKPENLLMGYKGELKIADFGWSVHAPSLRR---RMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCYEF
3comB           RDIKAGNILNTEGHAKLADFGVA---GQLTDMAKRNVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEM
2ckpB           NDCQEGNILLLEQKLMLIDFEYSSYNYRGF-DIGNHFCEWMYDYSYEKYPFRANIRKYPTKKQQLHFISS
1apmE           RDLKPENLLIDQQ---GYIQVTDFGFAKRVKG-RTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEM
3bhhD           RDLKPENLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPVLRKEAYGKPVDIWACGVILYIL
2a1sB           LDLEPCTGFQKLIYQTLSWKYPKGIHVETLET---EKKERYIVISKVDEE--------------------
2bmcB           RDIKPENLLLGSAGELKIDFGWSVTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQYK
2ckoB           NDCQEGNILLLEGRENSEKQKLMYSSYNYRGFDIGNHFCEWMYDYSYEKYPFANIRKYPTKKQQLHFSYL
1e7vA           GDRHNDNIMIETGNLFHIDFGHIN-------KERVPFVLTPDFLFVMGTSGKTSLHFQKFQDVCVKAYLA
3dkgA           RDLAARNCMLDEKFTV-------------KVADFGLARLPVKWMALESLQTQKFTTKSDVWSFGVLLWEL
3c4yB           RDLKPENVLLDDGNVRISDLGLAVELKAGQTKTK-GYAGTPGFMAPELLLGEEYDFSVDYFALGVTLYEM
3dajA           RDIKPENLLLGSNGELKIADFGWSTLDYLPPEMIHDEKVDLWSLGVLCYEFL------------------
3c5iA           NDLQENNINTNCLRLIDFEYSGFNFLATDIANFF-IETSIDYSVSSYPFFEIDKKKYISYENRKLFITAY
3cqwA           YRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEM
3da6A           RDLKPSNIVVKSDCTLKILD-----------FGLARTVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEM
3dy7A           HRDVKPSNILVNSRGEICDFGVSGQL------IDSMANGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEM
3dkoA           RGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGPVRWTAPEAIQYRKFTSASDVWSYGIVMWEV
3c9wA           RDLKPSNLLLNTTCDLKICDFGLARVADPTRWYRAPEIMLNSKGYTKMLSNRPIFPGKHYLDQLNHILGI
1e8wA           GDRHNDNIMISETGNLFHIDFGNK--------ERVPFVLTPDFLFVMGTSGKKTSLHFQKFDVCVKAYLA
3e93A           RDLKP------SNLAVNEDELKILDFGLTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAEL
2bkkA           GDLGDSNIFVKDKVSGFIDLGRSGRADKWYDIAFCVRSIREDIGEEQYVDLLGIKPDWEKIKYYILL---
2chwA           GDRHNDNIMITTGNLFHIDFGHERVPFVLTPDFLFVMGTSGKQKFQDICVKAYLALRHHTNLLIILFSMM
3daeB           QQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGSPNYAAPEVISGK-LYAGPEVDVWSCGVILM
3ckcA           AGVYTGQTDYAAEEYASKVIGSAYKLCTNYSELFMADNDENENAMQEIILPIRQGVKTRN--YGGSTYLV
3dk7B           RDLAARNCLVGENHLVKVADFGLSRLMTGDTTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWIA
3cg2A           RDLKPSNLAVNDCELKILDFGLARTRWYRAPEIQTVDIWSVGCIMAELLTGRTLFPGTDHIQLKLILRLV
1e7uA           GDRHNDNIMISTGNLFHIDFGHIN-------KERVPFVLTPDFLFVMGTSGKKTSHFQKFQDVCVKAYLA
1e8xA           GDRHNDNIMISTGNLFHIDFGHVPFVLTPDFMGTSGKKTSLHFQKFQDVCVKAYLALRHHTNLLIILFSM
3daeA           QQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGSPNYAAPEVISGK-LYAGPEVDVWSCGVILM
3csvA           RDFHAQNLLWLPEREGLADFQDAGHRAYDLVSLLQDARRDVPAQVEAQIDHYIQATGVDESHFRSAYAVI
3dfaA           RDLKPENILLCDIKIIDFGLSTCFQQNTKMKDRIGTAYYIAPEVLRGTYDEKCDVWSAGVILYILLSGTP
3cs9D           RDLAARCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEI
1e90A           GDRHNDNIMISETGNLFHIDFGHIKERVPF------VLTPDFLFVMGTSGKKTSLHFQKFQDVCVKAYLA
3dqwA           RDLRAANILVGENLVCKVADFGLARLIEDNETARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTEL
2bvaA           RDIKSDSILLTHDGRVKLSDFGFCAQVE---VPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEM
2advA           ERAQQWYAQQSPFRANLDAFAAG----------INAYAQQNPDDISPDVRQVLPVSGADVVAHAHRLMNF
3cquA           YRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEM
1bygA           RDLAARNVLVSE--------------DNVAKVSDFGLLPVKWTAPEALREKKFSTKSDVWSFGILLWEIY
3dxpA           DYRLDNLFHPTEPRVLAVLDWELSTLGHPGDFGYHCSWHIAPGQFRGIAGLDHAALGIPDEASYRKLYEQ
3dk6B           RDLAARNCLVGENHLVKVADFGLSRLMTGDTTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEI
3e8cE           RDLKPENLLIDQQGYIQVTDFGFA----KRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEM
3cuqA           ELHQQVLKGRGIPVGGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEIKASLRQVLEHLLKEGLAWLDL
3bdeB           ----------------------------------------------------------------------
3cs9C           TQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGPIKWTAPESLAYNKFSIKSDVWAFGVLLWEI
3dgkA           FDLKPENIMLLVPKPRIKIIDFGLAHKIDFGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYIL
3bhyA           FDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGAS
1e8zA           GDRHNDNIMITTGNLFHIDFGHERVPFVLTPDFLFVMGTSGKK------------TSPHFQKFQDICVKA
3cstA           GDRHNDNIMITETGNLFHIDFGHE---------RVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYL
3c5yE           EALTTVAEPLG---HKVFNYGYTAEDKASLTYVNGLLLLNSGAADFVVTGGTGGSLAANAPGVFCGLVID
2b5mA           LYDGLFKVIPLRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKG
3dyhA           DDIMDNSVTRRGKPCWYRHPDVTVQCAINDGLLLKSWTHMMAMHFFADRP--------------------
2ckoA           NDCQEGNILLLEGRENSEKQKLEYSSYNYRGFDIGNHFCEWMYDYSYEKRKYPTKQQLHFISSYLPAFQN
1e8yA           GDRHNDNIMITETGNLFHIDFGHE---------RVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYL
3bqrA           FDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYIL
2amuA           QKIT------------------------------------------------------------------
3c5yA           EALTTVAEPLG---HKVFNYGYTAEDKASLTYVNGLLAGILLAADFVVTGGTGGSLAANAPGVFCGLVID
3bboU           ANLIISKAEVNKGITLKVKPR-------------------------------------------------
3e3pA           DIKPHNVLVNEADGTLKLCDFGSAKKLSPSEPNVAYICSRYYRAPELIFGNQHYTTAVDIWSVGCIFAEM
1b5dA           AQYDMCLAELGQNPDSGIMIYTRPSMQFDGMSDFMCTNTVQYLIRDKKINAVVNMRSNDVVWQKYVLDKL
1a35A           KEMKVRQRAVALYFIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRY
2bvaB           RDIKSDSILLHDGRVKLSDFGFCAQVEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGE
3dlsD           HRDIKDENIVIAEDFTIKLDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTL
3bdeA           ----------------------------------------------------------------------
3dk3B           RDLAARNCLVGENHLVKVADFGLSRMTGDTFTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEI
3dfcB           FDLKPENIMLLVPKPRIKIIDFGLAHKIDFGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYIL
3dpkA           DVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVRLPVKWMAP---ESIFDCVYTVQSDVWSYGILLWEI
3dneA           RDLKPENLLIDQQGYIQVTDFGFA----KRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEM
2dq7X           RDLRSANILVGNGLICKIADFGLARLIEDNETARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTEL
3a5cA           RDQGFSVALMADSTS---RWAEALREISSRLEEMPAEEGYPPYLAARLAAFYERAKVITLGGEEGAVTIV
3dplC           RDESDINTFI------------------------------------------------------------
3dtwA           FQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEI
3cokA           RYLKNRVKPSENEARHFMHQIITGMLYLHSHGILHRDLTLSNLLLTRNMNIKI--ADFGLATQLKESDVW
3dlsB           RDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTL
1b5eA           AQYDMCLAELGQNPDSRIMIYTRPSMNKDGMSDFMCTNTVQYLIRDKKINAVVNMRSNDYAWQKYVLDKL
3c5yB           EALTTVAEPLG---HKVFNYGYTAEDKASLTYVNGLLAGILGAADFVVTGGTGGSLAANAPGVFCGLVID
3e8eI           RDLKPENLLIDQQ----GYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEM
2ckeA           FDLKPENIMLNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYIL
248lA           DSLDAVRRAALNMVFQMGETGVAGFTNSLRMLQQKR----WDEAAVNLAKS-------------------
3dk7A           RDLAARNCLVGENHLVKVADFGLSRLMTGDTTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEI
3dtcA           RDLKSSNILILQKVENGDLSNKIL-------KITDFGLGAYAWMAPEVIRASMFSKGSDVWSYGVLLWEL
2ckeB           FDLKPENIMLLDKNPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYIL
3cp9A           QVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEI
2a2aA           FDLKPNIMLLDKNIPIPHIKLFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYIL
3c5yL           EALTTVAE---PLGHKVFNYGYTAEDKASLTYVNGLLAGILLNSGAADFVVTGGSLAANAPGVFCGLVID
3cq9D           PISWASNEFSGTGHFSFDAGVLA-----------------------------------------------
3bymA           DLRAANILVSDTLSCKIADFGLARLIEDNETAREGAKFPIKWTAPEAINYGTF-TIKSDVWSFGILLTEI
3ck8A           WLLRARLYLNAGVYTGQTDYAKAEEYSAYKLCTNYADNDENENAMQEIILPIRQDGVKTRNYGGSTYLVC
3dlsC           ----------------------------------------------------------------------
3cpcA           FQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEI
3cqzH           SEVDPGRYNKVRIEAASTTQDQCLFPVAAQDSLTVTIASTRSWRPPQAGDRSKFEEVSKVYSFGGLLMRL
3dyhB           DDIMDNSVTRRGKPCWYPDVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLLCRFNRVDYTTAVGQLY
3dlsE           ----------------------------------------------------------------------
1a0eA           ------------------EIPKVQFEG----KESTNPLAFKFYDPEEIIDGDHLKFSVAFWHTFVNEGRD
1bcpA           RRIPPENIRRVTRVYHNGIT---------GETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRM
3dpdA           IGDRHNDNIMITETGNHIDFGNKERVPFVLTPDMGTSGKKTSPHFQKFQDICVKAYLALRHHTNLLIILF
3cs9B           TQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGPIKWTAPESLAYNKFSIKSDVWAFGVLLWEI
3dlxA           ----------------YTDPVEAVKDIPDGATGGFGLCGIPENLIDALLKTGVKGLTAVSNNAGLLLRSK
2dlaC           EEISIDVSTAEYTMKISDFLDLVPDEKLANYYIYEGRV--------------------------------
3dlxC           ----------------YTDPVEAVKDDGATVLVGGGLCGIPENLIDALLKTVSNNAGVDNFGLGLLLRSK
2ae4A           ERAQQWY--------AQQSPDFRANLDAFAAGINAYAQQNPDDISPDVRQVLPVSGA-DVVAHAHRLMNF
3c5yF           EALTTVAE---PLGHKVFNY--------------------------------------------------
2cn8A           RDLKPENVLLSQEEDCLIKITDFGHSKILTSLMRTLCPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFIC
3dlsA           ----------------------------------------------------------------------
3cc6A           RDIAVRNILVASPECVKLGDFGLSRYIVTRLPIKWMSPESINFRRFT--------TASDVWMFAVCMWEI
3dkcA           RDLAARNCMLDKFTVKVADFGLARDMEFDSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWEL
2ckqA           NDCQEGNILLKQKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYSYEKYPFFRANIRKYPTKKQQLHFISSY
3cq9B           PISWASNEFSGTGHFSFDAGVLA-----------------------------------------------
3bg0C           SSNEIEQIFLSKLAIESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGGCSIDKNISKIYKGSPFEGL
3dlsF           ----------------------------------------------------------------------
3dk3A           ----------------------------------------------------------------------
2a2yA           ----------------------------------------------------------------------
3d5wA           ----------------------------------------------------------------------
2ac5A           RDLKPENILCE-----------------------------------------------------------
3cpbA           QVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIF
3cs9A           ----------------------------------------------------------------------
3dlxB           ----------------YTDPVEAVKDDGATVLVGGGLCGIPENLIDALLKTVSNNAGVDNFGLGLLLRSK
3be2A           QVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIF
1a79A           YNMT------------------------------------------------------------------
2bajA           RDLKPSNLAVEDCELKILDFGLA-----------------------------------------------
2cpkE           DLKPENLLIDQQGYIQVTDFGFAK-----RVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEM
2c3lA           ----------------------------------------------------------------------
3ek4A           TPIGDGPVLLPDNHYLSTKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPLVELDGDVNGHKFSVS
2byvE           SHAKGGTVLFNQGEEYIILKGSVNVVIYGK--GVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLR
3d4qA           ----------------------------------------------------------------------
3b8eA           EEVVVGDLVVKGGDRIPADLNGCK-VDNSSLT--------------------------------------
3b8qB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ATGNPPYGAGAFEVIFFRILNGEINLDGVPEPLRPIVQDAVQRDPRKRPTAEELVARTEQLNLDLPWMED
3dbsA           LMTGMPQLTSKDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGWTVQFNWFLHL---------------
3dxnA           PPFGGQTDQEILKRVEKGKFSFDPPDTQVSDEAKQLVKLMLTYEPSKRISAEEA--------LNHPWIVK
2c3jA           LAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLALLVENPSARITIPDI--------KKDRWYNK
3dk6A           ATYGMSPYPGIDPSQVYELLEKDYRPEGCPEKVYELMRACWQWNPSDRPSFAEIH---------------
2e2bA           ATYGMSPYPGIDLSQVYELLEKDYRMEGCPEKVYELMRACWQWNPSDRPSFAEIH---------------
2bmcA           LVGKPPFEANTYQETYKRISRVEFTFDFVTEGARDLISRLLKHNPSQRPMLREVLEH--------PWITA
2c47C           LRGSLPWQGLKADTLKERYQKIGDTKRNFPEEMATYLRYVRRLDFFEKPDYDYLRKTDLFDRSGFVFDYE
2bmcF           TYKRISRVEFTFPDFVTEGARDLISRLLKHNPLREVLEHPWITANSSKPSNCQ-----------------
3bceA           MTFGGKPYDGIPTREIPDLLEKGERLPICTIDVYMVMVKCWMIDADSRPKFKEL----------------
3e87A           MCGRLPFYNQDHERLFELILMEEIRFRTLSPEAKSLLAGLLKKDPKQRLGGGPS----------------
2e2bB           ATYGMSPYPGIDLSQVYELLEKDYRMEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETM---------
2c47A           LRGSLPWQGLKADTLKERYQKIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRSGFVFD
3dkfA           MTRGAPPYPDVNTFDITVYLLQGRRLEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTFIG---
3csfA           LMTGPQLTSKEDIEYIRDALTV----GKNEEDAKKYFLDQIEVCRDKGWTV-------------------
3ei1A           ----------------------------------------------------------------------
3ckwA           ARGEPPHSELHPMKVLFLIPKNNTLEGNYSKPLKEFVEACLNKEPSFRPTAKEL--------LKHKFILR
3bhhC           LVGYPPFWDEDQHKLYQQIKAGAYEWDTVTPEAKNLINQMLTINPAKRITAHEA--------LKHPWVCQ
3blrA           WTRSPIMQGNTEQHQLALISQLRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDA--------LNHDFFWS
1cmkE           AAGYPPFFADQPIQIYEKIVSGKVRFPHFSSDLKDLLRNLLQVDLTKRFGNLK-----------------
3byvA           WCADLPIGGSEWIFRSCKNIPQPVRALLEGFLRYPKEDRLLPLQAMETPEYEQLRTELSAA---------
3bhhB           LVGYPPFWDEDQHKLYQQIKAGAYDFDTVTPEAKNLINQMLTINPAKRITAHEA--------LKHPWVCQ
2eb3A           MTFGSKPYDGIPASEISSILEKGERLPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRY--
2cgxA           LAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLAILVENPSARITIPDI--------KKDRWYNK
3c0iA           XXXXXXXXXXK-ERLFEGIIKGKYKMNHISESAKDLVRRMLMLDPAERITVYEA--------LNHPWLKE
1cdkA           AAGYPPFFADQPIQIYEKIVSGKVRFSHFSSDLKDLLRNLLQVDLTKRFGNLK-----------------
3c0gA           XXXXXXXXXXK-ERLFEGIIKGKYKMNHISESAKDLVRRMLMLDPAERITVYEA--------LNHPWLKE
3e5aA           LVGKPPFEANTYQETYKRISRVEFFPDFVTEGARDLISRLLKHNPSQRPMLREV--------LEHPWITA
3c5iD           LSNYLDKVVPTPKLIDEILEAVEVQALGLLWGFWSIIRGYQTKSYNEFDFFLYAEQRLKMY---------
3dndA           AAGYPPFFADQPIQIYEKIVSGKVRFSHFSSDLKDLLRNLLQVDLTKRF---------------------
2dwbA           LVGKPPEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPLREVL----------------
2brmA           ELPWDQPSDSCQEYSDWKEKKTYLNPKKIDSAPLALLHKILVENPSARITIPDI--------KKDRWY--
2bfxB           LVGMPPFDSPSHTETHRRIVNVDLKFPFLSDGSKDLISKLLRYHPPQRLPLKGV--------MEHPWVKA
3comB           AEGKPPYADIHPMRAIFMIPTNPPPTFRKPDNFTDFVKQCLVKSPEQRATATQL--------LQHPFVRS
2ckpB           YLPAFQFENLSTEEKSIIKMLLEVNRFALASHFLWGLWAQARFDAYFHQK--------------------
1apmE           AAGYPPFFADQPIQIYEKIVSGKVRFPHFSSDLKDLLRNLLQVDLTKRFGNLK-----------------
3bhhD           LVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDAKNLINQMLTINPAKRITAHEA--------LKHPWVCQ
2a1sB           ----------------------------------------------------------------------
2bmcB           RISRVEFTFPDFVTEGARDLISRLLKHSQRPMLREVLEHPWITANSSKPSNCQ-----------------
2ckoB           PAFQNDFENLSTEEKSIIKEEMFALASHFLWGLWSIVQAKISSEFGYMDYAQARFDAYFHQKRKL-----
1e7vA           LRHH----TNLLIILFSMMLMTGMP-QLTSKEDIEYIRDALTVGKSEEDAKKYF----------------
3dkgA           MTRGAPPYPDVNTFDITVYLLQGRRLEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTFIG---
3c4yB           IAARGPFRARGEKVENKELKQRVLEQDKFSPASKDFCEALLQKDPEKRLGFRDG----------------
3dajA           -VGMPPFEAHTYQETYRRISRVEFTFDFVTEGARDLISRLLKHNASQRLTLAEV--------LEHPWIKA
3c5iA           LSNYLPTPKLIDEILEAVEVQALLLWGFWSIIRGYQTKFDFFLYAEQRLKMYD-----------------
3cqwA           MCGRLPFYNQDHEKLFELILMEEIFPRTLGPEAKSLLSGLLKKDPKQRLGGGS-----------------
3da6A           VRHKILFPGRDYIDQWNKVIE-------------------------------------------------
3dy7A           AVGRYPIPMAIFELLDYIVNEPPPKLGVFSLEFQDFVNKCLIKNPAERADLKQLM---------------
3dkoA           MSYGERPYWDMSNQDVIKAIEEGYRLPAPMAGLHQLMLDCWQKERAERPKFEQIVGILDKM-IRNP----
3c9wA           LGSPSQEDLNCIINLKARNYLLSLLFPNADSKALDLLDKMLTFNPHKRIEVEQA--------LAHPYLEQ
1e8wA           LRHHTNLLIILFS-----MMLMTGMPQLTSKEDIEYIRDALTVGKSEEDAKKYFLGWTVQFNWFLHL---
3e93A           LTGRTLFPGTDHIDQLKLILRLAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDL-------
2bkkA           ----------------------------------------------------------------------
2chwA           LMTGMPQLTSKEDIEYIRDALTVGKNEDAKKYFLDQIEVCRDKGWTVQFNWFL-----------HLVL--
3daeB           LCRRLPFDDESIPVLFKNISNGVYTLKFLSPGAAGLIKRMLIVNPLNRISIHEIM-QDDWFKVDLP----
3ckcA           CGTRVAGMPRMGTARAAMVQKFFSNLEDVPMLPADIPTKGLDTDEQIDAFAEHGIRTEDMIKAAGDDRAL
3dk7B           TYGMSPYPGIDPSQVYELLEKDYERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQ--------------
3cg2A           GTPGAELLKKISSESARNYIQSLTQMIGANPLAVDLLEKMLVLDSDKRITAAQALA--------------
1e7uA           LRHHTNLLIILFSMMLM---------TGMPKEDIEYIRDALTVGKSEEDAKKYF----------------
1e8xA           MLMTGMPQLTSKEDIEY--IRDALTVGKSEEDAKKYFLDQIEVCRDKGWT-----VQFNWFL--HLVL--
3daeA           LCRRLPFDDESIPVLFKNISNGVYTLKFLSPGAAGLIKRMLIVNPLNRISIHEIM-QDDWFKVDLP----
3csvA           AVQRNRI-LGIFARLSQR--FGKRHYIEFVPRVWAHFERGLAH-PALASAAEEILNALPA--PAPEVLER
3dfaA           PFYGKNEYDILKRVETGKYAFDLPQWRTISDDAKDLIRKMLTFHPSLRITATQC--------LEHPWIQK
3cs9D           ATYGMSPYPGIDLSQVYELLEKDYRMEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFE------TMFQE
1e90A           LRHHTNL----LIILFSMMLMTGMP-QLTSKEDIEYIRDALTVGKSEEDAKKYFLDQIEVC-RDKGWTVQ
3dqwA           TTKGRVPYPGMVNREVLDQVERGYRMPCCPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQ
2bvaA           VDGEPPYFNEAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAEL--------LKHPFLAK
2advA           LYVASPG---------------------------------------------------------------
3cquA           MCGRLPFYNQDHEKLFELILMEEIRFRTLGPEAKSLLSGLLKKDPKQRLGGGS-----------------
1bygA           SFGRVPYPRIPLKDVVPRVEKGYKAPDGCPPAVYEVMKNCWHLDAAMRPSFLQLREQLEHI---------
3dxpA           RTGRPITGDWNFYLAFSFRIAGILQGTASSAQALDAGKRARPAEGWEYAKK-------------------
3dk6B           ATYGMSPYPGIDPSQVYELLEKDYRMEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETM-FQESSISD
3e8cE           AAGYPPFFADQPIQIYEKIVSGKVRFSHFSSDLKDLLRNLLQVDLTKRFGNLKN----------------
3cuqA           QAPGEAH---------------------------------------------------------------
3bdeB           ----------------------------------------------------------------------
3cs9C           ATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMWQWNPSDRPSFAEIHQAFETM---------
3dgkA           LSGASPFLGDTKQETLANVSAVNEYFSNTSALAKDFIRRLLVKDPKKRMTIQDS--------LQHPWIKP
3bhyA           PFLGETKQETLTNISAVNYDFDEEYFSNTSELAKDFIRRLLVKDPKRRMTIAQS--------LEHSWIKA
1e8zA           YLALRHHTNLLIILFSMMLMTGMPQL--TSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVC-RDKGWTVQ
3cstA           ALRHHTNLLIILFSMMLMT----GMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVC-RDKGWTVQ
3c5yE           PTDAFLFGQINDGNAISPYSKGFGWAAELNLQDVYRKLFDGGYPRERAEIRKNRGILRELKDASCRDLT-
2b5mA           PWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHN----------------------------------
3dyhA           ----------------------------------------------------------------------
2ckoA           DFENLSTEEKSIIKEMLLEVNRFALASHFLWGLWSIVQAKISSEFGYMDYAQARFDAYFHQKRKLG----
1e8yA           ALRHHTNLLIILFSMMLMT----GMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVC-RDKGWTVQ
3bqrA           LSLGETKQETLTNISAVNYDFDEEYFSNTSELAKDFIRRLLVKDPKRRMTIAQS--------LEHSWIKA
2amuA           ----------------------------------------------------------------------
3c5yA           PTDAFLFGQINDGNAISPYSKG------------------------------------------------
3bboU           ----------------------------------------------------------------------
3e3pA           MLGEPIFRGDTDVDLYNSKGIPWSNVFSDHSLKDALLSALLQYLPEERMKPYEA--------LCHPYFDE
1b5dA           VSDLNAGDSTRQYKIIWNVGSLHV-----YSRHFYLVDHWWKTGETHISKKD------------------
1a35A           YNKVPVEKRVFKNLQLFMENKQPEDDRLNTGILNKHLQDLMEGLTASITLQQQL--------KELTAPDE
2bvaB           PPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLK--------------
3dlsD           VFEENPFCELEETVEAAIHPPYLV-----SKELMSLVSGLLQPVPERRTTLEKL--------VTDPWVTQ
3bdeA           ----------------------------------------------------------------------
3dk3B           ATYGMSPYPGIDPSQVYELLYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESS----
3dfcB           LSGASPFLGDTKQETLANVSAVNEYFSNTSALAKDFIRRLLVKDPKKRMTIQDS--------LQHPWIKP
3dpkA           FSLGLNPYPGILVNSKFYKLVKDGYQMAQPANIYSIMQACWALEPTHRPTFQQICSFLQE----------
3dneA           AAGYPPFFADQPIQIYEKIVSGKVRFSHFSSDLKDLLRNLLQVDLTKRFGNLK-----------------
2dq7X           VTKGRVPYPGMNNREVLEQVERGYRMPCPQISLHELMIHCWKKDPEERPTFEYLQSFLED----------
3a5cA           GAVSPPGGDMSEPVSTLRIVGAFWRLDASLAFRRHF----PAINWNGSYSLFTS----------------
3dplC           ----------------------------------------------------------------------
3dtwA           FSLGASPYPGVKIDEEFCRRLKEGAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNL---LQANAQ
3cokA           SLGCMFYTLLIGRPPFDTDTVKVVLASFLSIEAKDLIHQLLRRNPADRLSLSSV--------LDHPFM--
3dlsB           VFEENP-----FCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKL--------VTDPWVTQ
1b5eA           VSDLNAGDSTRQYKIIWNVGSLHV-----YSRHFYLVDHWWKTGETHISKKD------------------
3c5yB           PTDAFLF---------------------------------------------------------------
3e8eI           AAGYPPFFADQPIQIYEKIVSGKVRFSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDW
2ckeA           LSGASPFLGDTKQETLANITSVSYDFDEEFFSHTSFIRKLLVKETRKRLTIQEA--------LRHPWITP
248lA           ----------------------------------------------------------------------
3dk7A           ATYGMSPYPGIDPSQVYELLEKDYRMEGCPEKVYELMRACWQWNPSDRPSFAEIHQ--------------
3dtcA           LTGEVPFRGIDGLAVAYGVAMNKLALSTCPEPFAKLMEDCWNPDPHSRPSFTNILDQLT-----------
2ckeB           LSGASPFLGDTKQETLANITSVSYDFDEEFFSHTSFIRKLLVKETRKRLTIQEA--------LRHPWITP
3cp9A           FSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDEPSQRPTFSELVEHLGNL---LQANAQ
2a2aA           LSGASPFLGDTKQETLANITSVSYDFDEEFFSHTSFIRKLLVKETRKRLTIQEA--------LRHPWITP
3c5yL           PTDAFLFGQINDGNAISPYSKGFGWAAELNLQRDLTVLKTVDQDLLRAAIAGEK--------FAELFYPN
3cq9D           ----------------------------------------------------------------------
3bymA           VTHGRIPYPGMTNPEVIQNLERGYRMVNCPEELYQLMRLCWKERPEDRPTFDYLRSVLEDF---------
3ck8A           GTRVAGM---------------------------------------------------------------
3dlsC           ----------------------------------------------------------------------
3cpcA           FSLGASPYPGVKIDEEFCRRLKEGAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNL-LQAN--AQ
3cqzH           EENAYLL---------------------------------------------------------------
3dyhB           DVTSMFDSNKLDPDVSQPTTTDFAEFTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDD
3dlsE           ----------------------------------------------------------------------
1a0eA           PFGDPTADRPWNRYTDPMDKAFARVD---ALFEFCEKLNIEYFCFHDRDIAPEGKTLRETNKILDKVVER
1bcpA           APVVGACMARQAESSEEAMVLV------------------------------------------------
3dpdA           SMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGWTVQFN--------WFLHLVLG
3cs9B           ATYGMSPYPGIDLSQVYELLEKDYRMEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFE------TMFQE
3dlxA           QIKRMVSSYVENAEFERQYLSGELEVTPQGTLAERIRAGGAGVPAFYTPTGYGT----------------
2dlaC           ----------------------------------------------------------------------
3dlxC           QIKRMVSYVGENAEFERQYLSGELEVLTPQGTLAERIRAGGAGVPAFYTPTGYG----------------
2ae4A           LYVASPG---------------------------------------------------------------
3c5yF           ----------------------------------------------------------------------
2cn8A           LSGYPPFSEHVSLKDQITSGKYNFIPAEVSEKALDLVKKLLVVDPKARFTTEEA--------LRHPWLQD
3dlsA           ----------------------------------------------------------------------
3cc6A           LSFGKQPFFWLENKDVIGVLEKGDRLPLCPPVLYTLMTRCWDYDPSDRPRFTELVCSLSDVYQMEKDIAM
3dkcA           MTRGAPPYPDVNTFITVYLLQGRRLLQPEYCPDPLVMLKCWHPKAEMRPSFSELVSRISAIFSTFIGEHY
2ckqA           LPAFQNDFENLSTEEKSIIKEEMLLASHFLWGLWSIVQAKISSIEFGYMDYAQA--------RFDAYFHQ
3cq9B           ----------------------------------------------------------------------
3bg0C           FSLKELEEFSWLCLLNLTLCYGQIDLDKFSLPYDDPIGVI-FQLYAANENTEKLYKE--------VRQRT
3dlsF           ----------------------------------------------------------------------
3dk3A           ----------------------------------------------------------------------
2a2yA           ----------------------------------------------------------------------
3d5wA           ----------------------------------------------------------------------
2ac5A           ----------------------------------------------------------------------
3cpbA           SLGASPYPGVKIDEEFCRRLKEGTRMRYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNL-LQAN--AQ
3cs9A           ----------------------------------------------------------------------
3dlxB           QIKRVSSYVGENAEFERQYLSG------------------------------------------------
3be2A           SLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPETMLDCWHGEPSQRPTFSELVEHLGNL---------
1a79A           ----------------------------------------------------------------------
2bajA           ----------------------------------------------------------------------
2cpkE           AAGYPPFFADQPIQIYEKIVSGKVFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDW
2c3lA           ----------------------------------------------------------------------
3ek4A           GEGEGDATYGKLTLKFICT---------------------------------------------------
2byvE           VDKE----------DFNRILVEANTVRLKEHDQDVLVLEKVPAQQKYTVMSGTPEKIL----EHFLETIR
3d4qA           ----------------------------------------------------------------------
3b8eA           ----------------------------------------------------------------------
3b8qB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           EYRSSGMTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dbsA           ----------------------------------------------------------------------
3dxnA           ----------------------------------------------------------------------
2c3jA           PLK-------------------------------------------------------------------
3dk6A           ----------------------------------------------------------------------
2e2bA           ----------------------------------------------------------------------
2bmcA           ----------------------------------------------------------------------
2c47C           Y---------------------------------------------------------------------
2bmcF           ----------------------------------------------------------------------
3bceA           ----------------------------------------------------------------------
3e87A           ----------------------------------------------------------------------
2e2bB           ----------------------------------------------------------------------
2c47A           Y---------------------------------------------------------------------
3dkfA           ----------------------------------------------------------------------
3csfA           ----------------------------------------------------------------------
3ei1A           ----------------------------------------------------------------------
3ckwA           ----------------------------------------------------------------------
3bhhC           ----------------------------------------------------------------------
3blrA           ----------------------------------------------------------------------
1cmkE           ----------------------------------------------------------------------
3byvA           ----------------------------------------------------------------------
3bhhB           ----------------------------------------------------------------------
2eb3A           ----------------------------------------------------------------------
2cgxA           PLKKG-----------------------------------------------------------------
3c0iA           RDRYA-----------------------------------------------------------------
1cdkA           ----------------------------------------------------------------------
3c0gA           RDRYA-----------------------------------------------------------------
3e5aA           ----------------------------------------------------------------------
3c5iD           ----------------------------------------------------------------------
3dndA           ----------------------------------------------------------------------
2dwbA           ----------------------------------------------------------------------
2brmA           ----------------------------------------------------------------------
2bfxB           ----------------------------------------------------------------------
3comB           ----------------------------------------------------------------------
2ckpB           ----------------------------------------------------------------------
1apmE           ----------------------------------------------------------------------
3bhhD           ----------------------------------------------------------------------
2a1sB           ----------------------------------------------------------------------
2bmcB           ----------------------------------------------------------------------
2ckoB           ----------------------------------------------------------------------
1e7vA           ----------------------------------------------------------------------
3dkgA           ----------------------------------------------------------------------
3c4yB           ----------------------------------------------------------------------
3dajA           ----------------------------------------------------------------------
3c5iA           ----------------------------------------------------------------------
3cqwA           ----------------------------------------------------------------------
3da6A           ----------------------------------------------------------------------
3dy7A           ----------------------------------------------------------------------
3dkoA           ----------------------------------------------------------------------
3c9wA           ----------------------------------------------------------------------
1e8wA           ----------------------------------------------------------------------
3e93A           ----------------------------------------------------------------------
2bkkA           ----------------------------------------------------------------------
2chwA           ----------------------------------------------------------------------
3daeB           ----------------------------------------------------------------------
3ckcA           LYSGVG----------------------------------------------------------------
3dk7B           ----------------------------------------------------------------------
3cg2A           ----------------------------------------------------------------------
1e7uA           ----------------------------------------------------------------------
1e8xA           ----------------------------------------------------------------------
3daeA           ----------------------------------------------------------------------
3csvA           ----------------------------------------------------------------------
3dfaA           ----------------------------------------------------------------------
3cs9D           ----------------------------------------------------------------------
1e90A           ----------------------------------------------------------------------
3dqwA           P---------------------------------------------------------------------
2bvaA           ----------------------------------------------------------------------
2advA           ----------------------------------------------------------------------
3cquA           ----------------------------------------------------------------------
1bygA           ----------------------------------------------------------------------
3dxpA           ----------------------------------------------------------------------
3dk6B           E---------------------------------------------------------------------
3e8cE           ----------------------------------------------------------------------
3cuqA           ----------------------------------------------------------------------
3bdeB           ----------------------------------------------------------------------
3cs9C           ----------------------------------------------------------------------
3dgkA           QF--------------------------------------------------------------------
3bhyA           ----------------------------------------------------------------------
1e8zA           ----------------------------------------------------------------------
3cstA           ----------------------------------------------------------------------
3c5yE           ----------------------------------------------------------------------
2b5mA           ----------------------------------------------------------------------
3dyhA           ----------------------------------------------------------------------
2ckoA           ----------------------------------------------------------------------
1e8yA           ----------------------------------------------------------------------
3bqrA           ----------------------------------------------------------------------
2amuA           ----------------------------------------------------------------------
3c5yA           ----------------------------------------------------------------------
3bboU           ----------------------------------------------------------------------
3e3pA           ----------------------------------------------------------------------
1b5dA           ----------------------------------------------------------------------
1a35A           ----------------------------------------------------------------------
2bvaB           ----------------------------------------------------------------------
3dlsD           PVNLADYT--------------------------------------------------------------
3bdeA           ----------------------------------------------------------------------
3dk3B           ----------------------------------------------------------------------
3dfcB           ----------------------------------------------------------------------
3dpkA           ----------------------------------------------------------------------
3dneA           ----------------------------------------------------------------------
2dq7X           ----------------------------------------------------------------------
3a5cA           ----------------------------------------------------------------------
3dplC           ----------------------------------------------------------------------
3dtwA           QDR-------------------------------------------------------------------
3cokA           ----------------------------------------------------------------------
3dlsB           PVNLADY---------------------------------------------------------------
1b5eA           ----------------------------------------------------------------------
3c5yB           ----------------------------------------------------------------------
3e8eI           I---------------------------------------------------------------------
2ckeA           ----------------------------------------------------------------------
248lA           ----------------------------------------------------------------------
3dk7A           ----------------------------------------------------------------------
3dtcA           ----------------------------------------------------------------------
2ckeB           ----------------------------------------------------------------------
3cp9A           QDR-------------------------------------------------------------------
2a2aA           ----------------------------------------------------------------------
3c5yL           CKDD------------------------------------------------------------------
3cq9D           ----------------------------------------------------------------------
3bymA           ----------------------------------------------------------------------
3ck8A           ----------------------------------------------------------------------
3dlsC           ----------------------------------------------------------------------
3cpcA           QDR-------------------------------------------------------------------
3cqzH           ----------------------------------------------------------------------
3dyhB           ----------------------------------------------------------------------
3dlsE           ----------------------------------------------------------------------
1a0eA           ----------------------------------------------------------------------
1bcpA           ----------------------------------------------------------------------
3dpdA           ----------------------------------------------------------------------
3cs9B           ----------------------------------------------------------------------
3dlxA           ----------------------------------------------------------------------
2dlaC           ----------------------------------------------------------------------
3dlxC           ----------------------------------------------------------------------
2ae4A           ----------------------------------------------------------------------
3c5yF           ----------------------------------------------------------------------
2cn8A           ----------------------------------------------------------------------
3dlsA           ----------------------------------------------------------------------
3cc6A           E---------------------------------------------------------------------
3dkcA           VHVNA-----------------------------------------------------------------
2ckqA           KRK-------------------------------------------------------------------
3cq9B           ----------------------------------------------------------------------
3bg0C           ----------------------------------------------------------------------
3dlsF           ----------------------------------------------------------------------
3dk3A           ----------------------------------------------------------------------
2a2yA           ----------------------------------------------------------------------
3d5wA           ----------------------------------------------------------------------
2ac5A           ----------------------------------------------------------------------
3cpbA           QDR-------------------------------------------------------------------
3cs9A           ----------------------------------------------------------------------
3dlxB           ----------------------------------------------------------------------
3be2A           ----------------------------------------------------------------------
1a79A           ----------------------------------------------------------------------
2bajA           ----------------------------------------------------------------------
2cpkE           ----------------------------------------------------------------------
2c3lA           ----------------------------------------------------------------------
3ek4A           ----------------------------------------------------------------------
2byvE           LEPSLNEA--------------------------------------------------------------
3d4qA           ----------------------------------------------------------------------
3b8eA           ----------------------------------------------------------------------
3b8qB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dbsA           ----------------------------------------------------------------------
3dxnA           ----------------------------------------------------------------------
2c3jA           ----------------------------------------------------------------------
3dk6A           ----------------------------------------------------------------------
2e2bA           ----------------------------------------------------------------------
2bmcA           ----------------------------------------------------------------------
2c47C           ----------------------------------------------------------------------
2bmcF           ----------------------------------------------------------------------
3bceA           ----------------------------------------------------------------------
3e87A           ----------------------------------------------------------------------
2e2bB           ----------------------------------------------------------------------
2c47A           ----------------------------------------------------------------------
3dkfA           ----------------------------------------------------------------------
3csfA           ----------------------------------------------------------------------
3ei1A           ----------------------------------------------------------------------
3ckwA           ----------------------------------------------------------------------
3bhhC           ----------------------------------------------------------------------
3blrA           ----------------------------------------------------------------------
1cmkE           ----------------------------------------------------------------------
3byvA           ----------------------------------------------------------------------
3bhhB           ----------------------------------------------------------------------
2eb3A           ----------------------------------------------------------------------
2cgxA           ----------------------------------------------------------------------
3c0iA           ----------------------------------------------------------------------
1cdkA           ----------------------------------------------------------------------
3c0gA           ----------------------------------------------------------------------
3e5aA           ----------------------------------------------------------------------
3c5iD           ----------------------------------------------------------------------
3dndA           ----------------------------------------------------------------------
2dwbA           ----------------------------------------------------------------------
2brmA           ----------------------------------------------------------------------
2bfxB           ----------------------------------------------------------------------
3comB           ----------------------------------------------------------------------
2ckpB           ----------------------------------------------------------------------
1apmE           ----------------------------------------------------------------------
3bhhD           ----------------------------------------------------------------------
2a1sB           ----------------------------------------------------------------------
2bmcB           ----------------------------------------------------------------------
2ckoB           ----------------------------------------------------------------------
1e7vA           ----------------------------------------------------------------------
3dkgA           ----------------------------------------------------------------------
3c4yB           ----------------------------------------------------------------------
3dajA           ----------------------------------------------------------------------
3c5iA           ----------------------------------------------------------------------
3cqwA           ----------------------------------------------------------------------
3da6A           ----------------------------------------------------------------------
3dy7A           ----------------------------------------------------------------------
3dkoA           ----------------------------------------------------------------------
3c9wA           ----------------------------------------------------------------------
1e8wA           ----------------------------------------------------------------------
3e93A           ----------------------------------------------------------------------
2bkkA           ----------------------------------------------------------------------
2chwA           ----------------------------------------------------------------------
3daeB           ----------------------------------------------------------------------
3ckcA           ----------------------------------------------------------------------
3dk7B           ----------------------------------------------------------------------
3cg2A           ----------------------------------------------------------------------
1e7uA           ----------------------------------------------------------------------
1e8xA           ----------------------------------------------------------------------
3daeA           ----------------------------------------------------------------------
3csvA           ----------------------------------------------------------------------
3dfaA           ----------------------------------------------------------------------
3cs9D           ----------------------------------------------------------------------
1e90A           ----------------------------------------------------------------------
3dqwA           ----------------------------------------------------------------------
2bvaA           ----------------------------------------------------------------------
2advA           ----------------------------------------------------------------------
3cquA           ----------------------------------------------------------------------
1bygA           ----------------------------------------------------------------------
3dxpA           ----------------------------------------------------------------------
3dk6B           ----------------------------------------------------------------------
3e8cE           ----------------------------------------------------------------------
3cuqA           ----------------------------------------------------------------------
3bdeB           ----------------------------------------------------------------------
3cs9C           ----------------------------------------------------------------------
3dgkA           ----------------------------------------------------------------------
3bhyA           ----------------------------------------------------------------------
1e8zA           ----------------------------------------------------------------------
3cstA           ----------------------------------------------------------------------
3c5yE           ----------------------------------------------------------------------
2b5mA           ----------------------------------------------------------------------
3dyhA           ----------------------------------------------------------------------
2ckoA           ----------------------------------------------------------------------
1e8yA           ----------------------------------------------------------------------
3bqrA           ----------------------------------------------------------------------
2amuA           ----------------------------------------------------------------------
3c5yA           ----------------------------------------------------------------------
3bboU           ----------------------------------------------------------------------
3e3pA           ----------------------------------------------------------------------
1b5dA           ----------------------------------------------------------------------
1a35A           ----------------------------------------------------------------------
2bvaB           ----------------------------------------------------------------------
3dlsD           ----------------------------------------------------------------------
3bdeA           ----------------------------------------------------------------------
3dk3B           ----------------------------------------------------------------------
3dfcB           ----------------------------------------------------------------------
3dpkA           ----------------------------------------------------------------------
3dneA           ----------------------------------------------------------------------
2dq7X           ----------------------------------------------------------------------
3a5cA           ----------------------------------------------------------------------
3dplC           ----------------------------------------------------------------------
3dtwA           ----------------------------------------------------------------------
3cokA           ----------------------------------------------------------------------
3dlsB           ----------------------------------------------------------------------
1b5eA           ----------------------------------------------------------------------
3c5yB           ----------------------------------------------------------------------
3e8eI           ----------------------------------------------------------------------
2ckeA           ----------------------------------------------------------------------
248lA           ----------------------------------------------------------------------
3dk7A           ----------------------------------------------------------------------
3dtcA           ----------------------------------------------------------------------
2ckeB           ----------------------------------------------------------------------
3cp9A           ----------------------------------------------------------------------
2a2aA           ----------------------------------------------------------------------
3c5yL           ----------------------------------------------------------------------
3cq9D           ----------------------------------------------------------------------
3bymA           ----------------------------------------------------------------------
3ck8A           ----------------------------------------------------------------------
3dlsC           ----------------------------------------------------------------------
3cpcA           ----------------------------------------------------------------------
3cqzH           ----------------------------------------------------------------------
3dyhB           ----------------------------------------------------------------------
3dlsE           ----------------------------------------------------------------------
1a0eA           ----------------------------------------------------------------------
1bcpA           ----------------------------------------------------------------------
3dpdA           ----------------------------------------------------------------------
3cs9B           ----------------------------------------------------------------------
3dlxA           ----------------------------------------------------------------------
2dlaC           ----------------------------------------------------------------------
3dlxC           ----------------------------------------------------------------------
2ae4A           ----------------------------------------------------------------------
3c5yF           ----------------------------------------------------------------------
2cn8A           ----------------------------------------------------------------------
3dlsA           ----------------------------------------------------------------------
3cc6A           ----------------------------------------------------------------------
3dkcA           ----------------------------------------------------------------------
2ckqA           ----------------------------------------------------------------------
3cq9B           ----------------------------------------------------------------------
3bg0C           ----------------------------------------------------------------------
3dlsF           ----------------------------------------------------------------------
3dk3A           ----------------------------------------------------------------------
2a2yA           ----------------------------------------------------------------------
3d5wA           ----------------------------------------------------------------------
2ac5A           ----------------------------------------------------------------------
3cpbA           ----------------------------------------------------------------------
3cs9A           ----------------------------------------------------------------------
3dlxB           ----------------------------------------------------------------------
3be2A           ----------------------------------------------------------------------
1a79A           ----------------------------------------------------------------------
2bajA           ----------------------------------------------------------------------
2cpkE           ----------------------------------------------------------------------
2c3lA           ----------------------------------------------------------------------
3ek4A           ----------------------------------------------------------------------
2byvE           ----------------------------------------------------------------------
3d4qA           ----------------------------------------------------------------------
3b8eA           ----------------------------------------------------------------------
3b8qB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dbsA           ----------------------------------------------------------------------
3dxnA           ----------------------------------------------------------------------
2c3jA           ----------------------------------------------------------------------
3dk6A           ----------------------------------------------------------------------
2e2bA           ----------------------------------------------------------------------
2bmcA           ----------------------------------------------------------------------
2c47C           ----------------------------------------------------------------------
2bmcF           ----------------------------------------------------------------------
3bceA           ----------------------------------------------------------------------
3e87A           ----------------------------------------------------------------------
2e2bB           ----------------------------------------------------------------------
2c47A           ----------------------------------------------------------------------
3dkfA           ----------------------------------------------------------------------
3csfA           ----------------------------------------------------------------------
3ei1A           ----------------------------------------------------------------------
3ckwA           ----------------------------------------------------------------------
3bhhC           ----------------------------------------------------------------------
3blrA           ----------------------------------------------------------------------
1cmkE           ----------------------------------------------------------------------
3byvA           ----------------------------------------------------------------------
3bhhB           ----------------------------------------------------------------------
2eb3A           ----------------------------------------------------------------------
2cgxA           ----------------------------------------------------------------------
3c0iA           ----------------------------------------------------------------------
1cdkA           ----------------------------------------------------------------------
3c0gA           ----------------------------------------------------------------------
3e5aA           ----------------------------------------------------------------------
3c5iD           ----------------------------------------------------------------------
3dndA           ----------------------------------------------------------------------
2dwbA           ----------------------------------------------------------------------
2brmA           ----------------------------------------------------------------------
2bfxB           ----------------------------------------------------------------------
3comB           ----------------------------------------------------------------------
2ckpB           ----------------------------------------------------------------------
1apmE           ----------------------------------------------------------------------
3bhhD           ----------------------------------------------------------------------
2a1sB           ----------------------------------------------------------------------
2bmcB           ----------------------------------------------------------------------
2ckoB           ----------------------------------------------------------------------
1e7vA           ----------------------------------------------------------------------
3dkgA           ----------------------------------------------------------------------
3c4yB           ----------------------------------------------------------------------
3dajA           ----------------------------------------------------------------------
3c5iA           ----------------------------------------------------------------------
3cqwA           ----------------------------------------------------------------------
3da6A           ----------------------------------------------------------------------
3dy7A           ----------------------------------------------------------------------
3dkoA           ----------------------------------------------------------------------
3c9wA           ----------------------------------------------------------------------
1e8wA           ----------------------------------------------------------------------
3e93A           ----------------------------------------------------------------------
2bkkA           ----------------------------------------------------------------------
2chwA           ----------------------------------------------------------------------
3daeB           ----------------------------------------------------------------------
3ckcA           ----------------------------------------------------------------------
3dk7B           ----------------------------------------------------------------------
3cg2A           ----------------------------------------------------------------------
1e7uA           ----------------------------------------------------------------------
1e8xA           ----------------------------------------------------------------------
3daeA           ----------------------------------------------------------------------
3csvA           ----------------------------------------------------------------------
3dfaA           ----------------------------------------------------------------------
3cs9D           ----------------------------------------------------------------------
1e90A           ----------------------------------------------------------------------
3dqwA           ----------------------------------------------------------------------
2bvaA           ----------------------------------------------------------------------
2advA           ----------------------------------------------------------------------
3cquA           ----------------------------------------------------------------------
1bygA           ----------------------------------------------------------------------
3dxpA           ----------------------------------------------------------------------
3dk6B           ----------------------------------------------------------------------
3e8cE           ----------------------------------------------------------------------
3cuqA           ----------------------------------------------------------------------
3bdeB           ----------------------------------------------------------------------
3cs9C           ----------------------------------------------------------------------
3dgkA           ----------------------------------------------------------------------
3bhyA           ----------------------------------------------------------------------
1e8zA           ----------------------------------------------------------------------
3cstA           ----------------------------------------------------------------------
3c5yE           ----------------------------------------------------------------------
2b5mA           ----------------------------------------------------------------------
3dyhA           ----------------------------------------------------------------------
2ckoA           ----------------------------------------------------------------------
1e8yA           ----------------------------------------------------------------------
3bqrA           ----------------------------------------------------------------------
2amuA           ----------------------------------------------------------------------
3c5yA           ----------------------------------------------------------------------
3bboU           ----------------------------------------------------------------------
3e3pA           ----------------------------------------------------------------------
1b5dA           ----------------------------------------------------------------------
1a35A           ----------------------------------------------------------------------
2bvaB           ----------------------------------------------------------------------
3dlsD           ----------------------------------------------------------------------
3bdeA           ----------------------------------------------------------------------
3dk3B           ----------------------------------------------------------------------
3dfcB           ----------------------------------------------------------------------
3dpkA           ----------------------------------------------------------------------
3dneA           ----------------------------------------------------------------------
2dq7X           ----------------------------------------------------------------------
3a5cA           ----------------------------------------------------------------------
3dplC           ----------------------------------------------------------------------
3dtwA           ----------------------------------------------------------------------
3cokA           ----------------------------------------------------------------------
3dlsB           ----------------------------------------------------------------------
1b5eA           ----------------------------------------------------------------------
3c5yB           ----------------------------------------------------------------------
3e8eI           ----------------------------------------------------------------------
2ckeA           ----------------------------------------------------------------------
248lA           ----------------------------------------------------------------------
3dk7A           ----------------------------------------------------------------------
3dtcA           ----------------------------------------------------------------------
2ckeB           ----------------------------------------------------------------------
3cp9A           ----------------------------------------------------------------------
2a2aA           ----------------------------------------------------------------------
3c5yL           ----------------------------------------------------------------------
3cq9D           ----------------------------------------------------------------------
3bymA           ----------------------------------------------------------------------
3ck8A           ----------------------------------------------------------------------
3dlsC           ----------------------------------------------------------------------
3cpcA           ----------------------------------------------------------------------
3cqzH           ----------------------------------------------------------------------
3dyhB           ----------------------------------------------------------------------
3dlsE           ----------------------------------------------------------------------
1a0eA           ----------------------------------------------------------------------
1bcpA           ----------------------------------------------------------------------
3dpdA           ----------------------------------------------------------------------
3cs9B           ----------------------------------------------------------------------
3dlxA           ----------------------------------------------------------------------
2dlaC           ----------------------------------------------------------------------
3dlxC           ----------------------------------------------------------------------
2ae4A           ----------------------------------------------------------------------
3c5yF           ----------------------------------------------------------------------
2cn8A           ----------------------------------------------------------------------
3dlsA           ----------------------------------------------------------------------
3cc6A           ----------------------------------------------------------------------
3dkcA           ----------------------------------------------------------------------
2ckqA           ----------------------------------------------------------------------
3cq9B           ----------------------------------------------------------------------
3bg0C           ----------------------------------------------------------------------
3dlsF           ----------------------------------------------------------------------
3dk3A           ----------------------------------------------------------------------
2a2yA           ----------------------------------------------------------------------
3d5wA           ----------------------------------------------------------------------
2ac5A           ----------------------------------------------------------------------
3cpbA           ----------------------------------------------------------------------
3cs9A           ----------------------------------------------------------------------
3dlxB           ----------------------------------------------------------------------
3be2A           ----------------------------------------------------------------------
1a79A           ----------------------------------------------------------------------
2bajA           ----------------------------------------------------------------------
2cpkE           ----------------------------------------------------------------------
2c3lA           ----------------------------------------------------------------------
3ek4A           ----------------------------------------------------------------------
2byvE           ----------------------------------------------------------------------
3d4qA           ----------------------------------------------------------------------
3b8eA           ----------------------------------------------------------------------
3b8qB           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dbsA           ----------------------------------------------------------------------
3dxnA           ----------------------------------------------------------------------
2c3jA           ----------------------------------------------------------------------
3dk6A           ----------------------------------------------------------------------
2e2bA           ----------------------------------------------------------------------
2bmcA           ----------------------------------------------------------------------
2c47C           ----------------------------------------------------------------------
2bmcF           ----------------------------------------------------------------------
3bceA           ----------------------------------------------------------------------
3e87A           ----------------------------------------------------------------------
2e2bB           ----------------------------------------------------------------------
2c47A           ----------------------------------------------------------------------
3dkfA           ----------------------------------------------------------------------
3csfA           ----------------------------------------------------------------------
3ei1A           ----------------------------------------------------------------------
3ckwA           ----------------------------------------------------------------------
3bhhC           ----------------------------------------------------------------------
3blrA           ----------------------------------------------------------------------
1cmkE           ----------------------------------------------------------------------
3byvA           ----------------------------------------------------------------------
3bhhB           ----------------------------------------------------------------------
2eb3A           ----------------------------------------------------------------------
2cgxA           ----------------------------------------------------------------------
3c0iA           ----------------------------------------------------------------------
1cdkA           ----------------------------------------------------------------------
3c0gA           ----------------------------------------------------------------------
3e5aA           ----------------------------------------------------------------------
3c5iD           ----------------------------------------------------------------------
3dndA           ----------------------------------------------------------------------
2dwbA           ----------------------------------------------------------------------
2brmA           ----------------------------------------------------------------------
2bfxB           ----------------------------------------------------------------------
3comB           ----------------------------------------------------------------------
2ckpB           ----------------------------------------------------------------------
1apmE           ----------------------------------------------------------------------
3bhhD           ----------------------------------------------------------------------
2a1sB           ----------------------------------------------------------------------
2bmcB           ----------------------------------------------------------------------
2ckoB           ----------------------------------------------------------------------
1e7vA           ----------------------------------------------------------------------
3dkgA           ----------------------------------------------------------------------
3c4yB           ----------------------------------------------------------------------
3dajA           ----------------------------------------------------------------------
3c5iA           ----------------------------------------------------------------------
3cqwA           ----------------------------------------------------------------------
3da6A           ----------------------------------------------------------------------
3dy7A           ----------------------------------------------------------------------
3dkoA           ----------------------------------------------------------------------
3c9wA           ----------------------------------------------------------------------
1e8wA           ----------------------------------------------------------------------
3e93A           ----------------------------------------------------------------------
2bkkA           ----------------------------------------------------------------------
2chwA           ----------------------------------------------------------------------
3daeB           ----------------------------------------------------------------------
3ckcA           ----------------------------------------------------------------------
3dk7B           ----------------------------------------------------------------------
3cg2A           ----------------------------------------------------------------------
1e7uA           ----------------------------------------------------------------------
1e8xA           ----------------------------------------------------------------------
3daeA           ----------------------------------------------------------------------
3csvA           ----------------------------------------------------------------------
3dfaA           ----------------------------------------------------------------------
3cs9D           ----------------------------------------------------------------------
1e90A           ----------------------------------------------------------------------
3dqwA           ----------------------------------------------------------------------
2bvaA           ----------------------------------------------------------------------
2advA           ----------------------------------------------------------------------
3cquA           ----------------------------------------------------------------------
1bygA           ----------------------------------------------------------------------
3dxpA           ----------------------------------------------------------------------
3dk6B           ----------------------------------------------------------------------
3e8cE           ----------------------------------------------------------------------
3cuqA           ----------------------------------------------------------------------
3bdeB           ----------------------------------------------------------------------
3cs9C           ----------------------------------------------------------------------
3dgkA           ----------------------------------------------------------------------
3bhyA           ----------------------------------------------------------------------
1e8zA           ----------------------------------------------------------------------
3cstA           ----------------------------------------------------------------------
3c5yE           ----------------------------------------------------------------------
2b5mA           ----------------------------------------------------------------------
3dyhA           ----------------------------------------------------------------------
2ckoA           ----------------------------------------------------------------------
1e8yA           ----------------------------------------------------------------------
3bqrA           ----------------------------------------------------------------------
2amuA           ----------------------------------------------------------------------
3c5yA           ----------------------------------------------------------------------
3bboU           ----------------------------------------------------------------------
3e3pA           ----------------------------------------------------------------------
1b5dA           ----------------------------------------------------------------------
1a35A           ----------------------------------------------------------------------
2bvaB           ----------------------------------------------------------------------
3dlsD           ----------------------------------------------------------------------
3bdeA           ----------------------------------------------------------------------
3dk3B           ----------------------------------------------------------------------
3dfcB           ----------------------------------------------------------------------
3dpkA           ----------------------------------------------------------------------
3dneA           ----------------------------------------------------------------------
2dq7X           ----------------------------------------------------------------------
3a5cA           ----------------------------------------------------------------------
3dplC           ----------------------------------------------------------------------
3dtwA           ----------------------------------------------------------------------
3cokA           ----------------------------------------------------------------------
3dlsB           ----------------------------------------------------------------------
1b5eA           ----------------------------------------------------------------------
3c5yB           ----------------------------------------------------------------------
3e8eI           ----------------------------------------------------------------------
2ckeA           ----------------------------------------------------------------------
248lA           ----------------------------------------------------------------------
3dk7A           ----------------------------------------------------------------------
3dtcA           ----------------------------------------------------------------------
2ckeB           ----------------------------------------------------------------------
3cp9A           ----------------------------------------------------------------------
2a2aA           ----------------------------------------------------------------------
3c5yL           ----------------------------------------------------------------------
3cq9D           ----------------------------------------------------------------------
3bymA           ----------------------------------------------------------------------
3ck8A           ----------------------------------------------------------------------
3dlsC           ----------------------------------------------------------------------
3cpcA           ----------------------------------------------------------------------
3cqzH           ----------------------------------------------------------------------
3dyhB           ----------------------------------------------------------------------
3dlsE           ----------------------------------------------------------------------
1a0eA           ----------------------------------------------------------------------
1bcpA           ----------------------------------------------------------------------
3dpdA           ----------------------------------------------------------------------
3cs9B           ----------------------------------------------------------------------
3dlxA           ----------------------------------------------------------------------
2dlaC           ----------------------------------------------------------------------
3dlxC           ----------------------------------------------------------------------
2ae4A           ----------------------------------------------------------------------
3c5yF           ----------------------------------------------------------------------
2cn8A           ----------------------------------------------------------------------
3dlsA           ----------------------------------------------------------------------
3cc6A           ----------------------------------------------------------------------
3dkcA           ----------------------------------------------------------------------
2ckqA           ----------------------------------------------------------------------
3cq9B           ----------------------------------------------------------------------
3bg0C           ----------------------------------------------------------------------
3dlsF           ----------------------------------------------------------------------
3dk3A           ----------------------------------------------------------------------
2a2yA           ----------------------------------------------------------------------
3d5wA           ----------------------------------------------------------------------
2ac5A           ----------------------------------------------------------------------
3cpbA           ----------------------------------------------------------------------
3cs9A           ----------------------------------------------------------------------
3dlxB           ----------------------------------------------------------------------
3be2A           ----------------------------------------------------------------------
1a79A           ----------------------------------------------------------------------
2bajA           ----------------------------------------------------------------------
2cpkE           ----------------------------------------------------------------------
2c3lA           ----------------------------------------------------------------------
3ek4A           ----------------------------------------------------------------------
2byvE           ----------------------------------------------------------------------
3d4qA           ----------------------------------------------------------------------
3b8eA           ----------------------------------------------------------------------
3b8qB           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dbsA           -------------------------------------------
3dxnA           -------------------------------------------
2c3jA           -------------------------------------------
3dk6A           -------------------------------------------
2e2bA           -------------------------------------------
2bmcA           -------------------------------------------
2c47C           -------------------------------------------
2bmcF           -------------------------------------------
3bceA           -------------------------------------------
3e87A           -------------------------------------------
2e2bB           -------------------------------------------
2c47A           -------------------------------------------
3dkfA           -------------------------------------------
3csfA           -------------------------------------------
3ei1A           -------------------------------------------
3ckwA           -------------------------------------------
3bhhC           -------------------------------------------
3blrA           -------------------------------------------
1cmkE           -------------------------------------------
3byvA           -------------------------------------------
3bhhB           -------------------------------------------
2eb3A           -------------------------------------------
2cgxA           -------------------------------------------
3c0iA           -------------------------------------------
1cdkA           -------------------------------------------
3c0gA           -------------------------------------------
3e5aA           -------------------------------------------
3c5iD           -------------------------------------------
3dndA           -------------------------------------------
2dwbA           -------------------------------------------
2brmA           -------------------------------------------
2bfxB           -------------------------------------------
3comB           -------------------------------------------
2ckpB           -------------------------------------------
1apmE           -------------------------------------------
3bhhD           -------------------------------------------
2a1sB           -------------------------------------------
2bmcB           -------------------------------------------
2ckoB           -------------------------------------------
1e7vA           -------------------------------------------
3dkgA           -------------------------------------------
3c4yB           -------------------------------------------
3dajA           -------------------------------------------
3c5iA           -------------------------------------------
3cqwA           -------------------------------------------
3da6A           -------------------------------------------
3dy7A           -------------------------------------------
3dkoA           -------------------------------------------
3c9wA           -------------------------------------------
1e8wA           -------------------------------------------
3e93A           -------------------------------------------
2bkkA           -------------------------------------------
2chwA           -------------------------------------------
3daeB           -------------------------------------------
3ckcA           -------------------------------------------
3dk7B           -------------------------------------------
3cg2A           -------------------------------------------
1e7uA           -------------------------------------------
1e8xA           -------------------------------------------
3daeA           -------------------------------------------
3csvA           -------------------------------------------
3dfaA           -------------------------------------------
3cs9D           -------------------------------------------
1e90A           -------------------------------------------
3dqwA           -------------------------------------------
2bvaA           -------------------------------------------
2advA           -------------------------------------------
3cquA           -------------------------------------------
1bygA           -------------------------------------------
3dxpA           -------------------------------------------
3dk6B           -------------------------------------------
3e8cE           -------------------------------------------
3cuqA           -------------------------------------------
3bdeB           -------------------------------------------
3cs9C           -------------------------------------------
3dgkA           -------------------------------------------
3bhyA           -------------------------------------------
1e8zA           -------------------------------------------
3cstA           -------------------------------------------
3c5yE           -------------------------------------------
2b5mA           -------------------------------------------
3dyhA           -------------------------------------------
2ckoA           -------------------------------------------
1e8yA           -------------------------------------------
3bqrA           -------------------------------------------
2amuA           -------------------------------------------
3c5yA           -------------------------------------------
3bboU           -------------------------------------------
3e3pA           -------------------------------------------
1b5dA           -------------------------------------------
1a35A           -------------------------------------------
2bvaB           -------------------------------------------
3dlsD           -------------------------------------------
3bdeA           -------------------------------------------
3dk3B           -------------------------------------------
3dfcB           -------------------------------------------
3dpkA           -------------------------------------------
3dneA           -------------------------------------------
2dq7X           -------------------------------------------
3a5cA           -------------------------------------------
3dplC           -------------------------------------------
3dtwA           -------------------------------------------
3cokA           -------------------------------------------
3dlsB           -------------------------------------------
1b5eA           -------------------------------------------
3c5yB           -------------------------------------------
3e8eI           -------------------------------------------
2ckeA           -------------------------------------------
248lA           -------------------------------------------
3dk7A           -------------------------------------------
3dtcA           -------------------------------------------
2ckeB           -------------------------------------------
3cp9A           -------------------------------------------
2a2aA           -------------------------------------------
3c5yL           -------------------------------------------
3cq9D           -------------------------------------------
3bymA           -------------------------------------------
3ck8A           -------------------------------------------
3dlsC           -------------------------------------------
3cpcA           -------------------------------------------
3cqzH           -------------------------------------------
3dyhB           -------------------------------------------
3dlsE           -------------------------------------------
1a0eA           -------------------------------------------
1bcpA           -------------------------------------------
3dpdA           -------------------------------------------
3cs9B           -------------------------------------------
3dlxA           -------------------------------------------
2dlaC           -------------------------------------------
3dlxC           -------------------------------------------
2ae4A           -------------------------------------------
3c5yF           -------------------------------------------
2cn8A           -------------------------------------------
3dlsA           -------------------------------------------
3cc6A           -------------------------------------------
3dkcA           -------------------------------------------
2ckqA           -------------------------------------------
3cq9B           -------------------------------------------
3bg0C           -------------------------------------------
3dlsF           -------------------------------------------
3dk3A           -------------------------------------------
2a2yA           -------------------------------------------
3d5wA           -------------------------------------------
2ac5A           -------------------------------------------
3cpbA           -------------------------------------------
3cs9A           -------------------------------------------
3dlxB           -------------------------------------------
3be2A           -------------------------------------------
1a79A           -------------------------------------------
2bajA           -------------------------------------------
2cpkE           -------------------------------------------
2c3lA           -------------------------------------------
3ek4A           -------------------------------------------
2byvE           -------------------------------------------
3d4qA           -------------------------------------------
3b8eA           -------------------------------------------
3b8qB           -------------------------------------------