[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ54978.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bk9F.bssp"
#ERROR : Can't open dsspfile "2btzA.bssp"
#ERROR : Can't open dsspfile "1bxdA.bssp"
#ERROR : Can't open dsspfile "3d2rB.bssp"
#ERROR : Can't open dsspfile "2e0aB.bssp"
#ERROR : Can't open dsspfile "2bu8A.bssp"
#ERROR : Can't open dsspfile "2e0aA.bssp"
#ERROR : Can't open dsspfile "2bu7A.bssp"
#ERROR : Can't open dsspfile "2bu6A.bssp"
#ERROR : Can't open dsspfile "2bu2A.bssp"
#ERROR : Can't open dsspfile "3d2rA.bssp"
#ERROR : Can't open dsspfile "3crkB.bssp"
#ERROR : Can't open dsspfile "2crkA.bssp"
#ERROR : Can't open dsspfile "2c2aA.bssp"
#ERROR : Can't open dsspfile "3bh1A.bssp"
#ERROR : Can't open dsspfile "1b3qB.bssp"
#ERROR : Can't open dsspfile "3d36B.bssp"
#ERROR : Can't open dsspfile "2akpB.bssp"
#ERROR : Can't open dsspfile "2bu5A.bssp"
#ERROR : Can't open dsspfile "3cgzC.bssp"
#ERROR : Can't open dsspfile "3crlB.bssp"
#ERROR : Can't open dsspfile "2ch4A.bssp"
#ERROR : Can't open dsspfile "2dvyD.bssp"
#ERROR : Can't open dsspfile "3crlA.bssp"
#ERROR : Can't open dsspfile "1b3qA.bssp"
#ERROR : Can't open dsspfile "2ch4B.bssp"
#ERROR : Can't open dsspfile "3cgzB.bssp"
#ERROR : Can't open dsspfile "2avwA.bssp"
#ERROR : Can't open dsspfile "3dgeA.bssp"
#ERROR : Can't open dsspfile "2dvyA.bssp"
#ERROR : Can't open dsspfile "2dvyF.bssp"
#ERROR : Can't open dsspfile "1eh8A.bssp"
#ERROR : Can't open dsspfile "3cgzA.bssp"
#ERROR : Can't open dsspfile "3clqD.bssp"
#ERROR : Can't open dsspfile "1bknA.bssp"
#ERROR : Can't open dsspfile "1bknB.bssp"
#ERROR : Can't open dsspfile "3d6nA.bssp"
#ERROR : Can't open dsspfile "3bh1D.bssp"
#ERROR : Can't open dsspfile "3ehgA.bssp"
#ERROR : Can't open dsspfile "3cwvA.bssp"
#ERROR : Can't open dsspfile "1ah8A.bssp"
#ERROR : Can't open dsspfile "2akpA.bssp"
#ERROR : Can't open dsspfile "2dvyB.bssp"
#ERROR : Can't open dsspfile "2ccsA.bssp"
#ERROR : Can't open dsspfile "3crkA.bssp"
#ERROR : Can't open dsspfile "2cg9A.bssp"
#ERROR : Can't open dsspfile "2cg9B.bssp"
#ERROR : Can't open dsspfile "1ei1A.bssp"
#ERROR : Can't open dsspfile "1bdtA.bssp"
#ERROR : Can't open dsspfile "2dvyC.bssp"

## Summary of PDB Search
:1077
    9e-19  13%  3bk9F  [x.x.x] TRYPTOPHAN 2,3-DIOXYGENASE
    1e-12  11%  2btzA  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    2e-11  17%  1bxdA  [d.122.1] PROTEIN (OSMOLARITY SENSOR PROTEIN (ENVZ))
    1e-10  10%  3d2rB  [x.x.x] [PYRUVATE DEHYDROGENASE [LIPOAMIDE]] KINASE
    4e-10  12%  2e0aB  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOZYME 4
    9e-10  10%  2bu8A  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    2e-09  12%  2e0aA  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOZYME 4
    2e-09  17%  2bu7A  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    3e-09  12%  2bu6A  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    3e-09  10%  2bu2A  [x.x.x] PYRUVATE DEHYDROGENSAE KINASE ISOENZYME 2
    4e-09  11%  3d2rA  [x.x.x] [PYRUVATE DEHYDROGENASE [LIPOAMIDE]] KINASE
    6e-09  13%  3crkB  [x.x.x] PYRUVATE DEHYDROGENASE [LIPOAMIDE] KINASE
    6e-09   8%  2crkA  [a.83.1 - d.128.1] PROTEIN (CREATINE KINASE)
    8e-09  12%  2c2aA  [x.x.x] SENSOR HISTIDINE KINASE
    9e-09   6%  3bh1A  [x.x.x] UPF0371 PROTEIN DIP2346
    3e-08  16%  1b3qB  [a.30.2 - d.122.1 - b.40.7] PROTEIN (CHEMOTAXIS PROTEIN CHEA)
    9e-08  15%  3d36B  [x.x.x] SPORULATION KINASE B
    9e-08  15%  2akpB  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    1e-07  13%  2bu5A  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    3e-07  15%  3cgzC  [x.x.x] VIRULENCE SENSOR HISTIDINE KINASE PHOQ
    7e-07  15%  3crlB  [x.x.x] PYRUVATE DEHYDROGENASE [LIPOAMIDE] KINASE
    7e-07  14%  2ch4A  [x.x.x] CHEMOTAXIS PROTEIN CHEA
    7e-07  15%  2dvyD  [x.x.x] RESTRICTION ENDONUCLEASE PABI
    2e-06  14%  3crlA  [x.x.x] PYRUVATE DEHYDROGENASE [LIPOAMIDE] KINASE
    2e-06  18%  1b3qA  [a.30.2 - d.122.1 - b.40.7] PROTEIN (CHEMOTAXIS PROTEIN CHEA)
    2e-06  15%  2ch4B  [x.x.x] CHEMOTAXIS PROTEIN CHEA
    3e-06  16%  3cgzB  [x.x.x] VIRULENCE SENSOR HISTIDINE KINASE PHOQ
    8e-06   5%  2avwA  [x.x.x] IGG-DEGRADING PROTEASE
    8e-06  17%  3dgeA  [x.x.x] SENSOR PROTEIN
    8e-06  12%  2dvyA  [x.x.x] RESTRICTION ENDONUCLEASE PABI
    9e-06  15%  2dvyF  [x.x.x] RESTRICTION ENDONUCLEASE PABI
    1e-05  15%  1eh8A  [c.55.7 - a.4.2] O6-ALKYLGUANINE-DNA ALKYLTRANSFERASE
    1e-05  15%  3cgzA  [x.x.x] VIRULENCE SENSOR HISTIDINE KINASE PHOQ
    2e-05   7%  3clqD  [x.x.x] UNCHARACTERIZED PROTEIN
    3e-05  32%  1bknA  [d.122.1 - d.14.1] MUTL
    3e-05  27%  1bknB  [d.122.1 - d.14.1] MUTL
    3e-05  27%  3d6nA  [x.x.x] DIHYDROOROTASE
    3e-05   7%  3bh1D  [x.x.x] UPF0371 PROTEIN DIP2346
    4e-05  18%  3ehgA  [x.x.x] SENSOR KINASE (YOCF PROTEIN)
    4e-05  14%  3cwvA  [x.x.x] DNA GYRASE, B SUBUNIT, TRUNCATED
    7e-05  16%  1ah8A  [d.122.1] HEAT SHOCK PROTEIN 90
    9e-05  16%  2akpA  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    1e-04  15%  2dvyB  [x.x.x] RESTRICTION ENDONUCLEASE PABI
    2e-04  14%  2ccsA  [x.x.x] HEAT SHOCK PROTEIN HSP-90 ALPHA
    3e-04  13%  3crkA  [x.x.x] PYRUVATE DEHYDROGENASE [LIPOAMIDE] KINASE
    3e-04  16%  2cg9A  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    5e-04  14%  2cg9B  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    6e-04  15%  1ei1A  [d.122.1 - d.14.1] DNA GYRASE B
    7e-04   8%  1bdtA  [a.43.1] PROTEIN (GENE-REGULATING PROTEIN ARC)
    8e-04  12%  2dvyC  [x.x.x] RESTRICTION ENDONUCLEASE PABI
:1077

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bk9F           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
2crkA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
2bu5A           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
2avwA           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3clqD           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
3d6nA           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bk9F           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
2crkA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
2bu5A           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
2avwA           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3clqD           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
3d6nA           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bk9F           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
2crkA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
2bu5A           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
2avwA           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3clqD           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
3d6nA           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bk9F           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
2crkA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
2bu5A           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
2avwA           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3clqD           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
3d6nA           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bk9F           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
2crkA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
2bu5A           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
2avwA           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3clqD           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
3d6nA           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPLRVLRDGAMRIAAKDLPEAIVRMRETNVRPEEVKITP
3bk9F           ------------------------------------------------------------LRLDQLAQQP
2btzA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3d2rB           --------------------------------ENACERTSFAFLRQELPVRLANILKEIDILPTQLVNTS
2e0aB           ----------------------------------AFLRQELPVRLA-------NILKEIDILPTQLVNTS
2bu8A           ----------------------------------------------------------------------
2e0aA           ----------------------------------AFLRQELPVRLA-------NILKEIDILPTQLVNTS
2bu7A           ----------------------------------------------------------------------
2bu6A           --------------------------------SMKQFLDFACEKTSFTFLRQELPVREINLLPDRVLSTP
2bu2A           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
2crkA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
2bu5A           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
2avwA           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3clqD           --------------------------------AVTRIIQSKPILVG----FDKAINVPDTETTILHAGPP
1bknA           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
3d6nA           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LEVDSSDEFGEVARSFDEVHXXXXXXXXXXXXXXXNVNAMFVNLSRRSQSLVERQLRLIEHLEQSEQDEE
3bk9F           LSEPAHEMLFIIQAQTSELWLKLLAHELRAAIVHLWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGF
2btzA           ---------------------------------------------------------YKDTYGDDPVSNQ
1bxdA           ----------------------------------------------------------------------
3d2rB           SVQLVKSWYIQSLMDLVEFHEKSPDDQKALSDFVDTLIKVRNRHHNVVPTMAQGIIEYKACTVDPVTNQN
2e0aB           SVQLVKSWYIQSLMDLVEFHEKSPDDQKALSDFVDTLIKVRNRHHNVVPTMAQGIIEYKDACTVDPVTNQ
2bu8A           -----------------------------------------------------RMLINQHTLIFDGSTNP
2e0aA           SVQLVKSWYIQSLMDLVEFHEKSPDDQKALSDFVDTLIKVRNRHHNVVPTMAQGIIEYKDACTVDPVTNQ
2bu7A           ----------------------------------------------------------------------
2bu6A           SVQLVQVQSLLDIMEFLDKDPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSNQNIQ
2bu2A           ---------------------------------------------------------YKDTYGDDPVSNQ
3d2rA           ------------------------------------------------------QGIIEYKDACDPVTNQ
3crkB           ---------------------------------------------------------YKDTYGDDPVSNQ
2crkA           -------------------------------------------IIQDRHGGFKPTDKHKTDLNHENLKGG
2c2aA           ---------------------------------------------RTPLTAIKAYAETIYNSLGELDLST
3bh1A           ----------------------------------------------REKYIEMQSQHIRERREALGGK--
1b3qB           ---------------------------------------------------------LMDLMGELVIARS
3d36B           -------------------------------------------------------------EEQPLAADK
2akpB           ----------------------------------------------------------------------
2bu5A           ------------------------------------MAQGVLEYKDTYGDDPVSNQNIQYFLDRFYLSRI
3cgzC           ----------------------------------------------------------------------
3crlB           --------------------------------------------------------RFYLSRISIRMLIN
2ch4A           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
3crlA           -----------------------------------------------------NIQYFLDRFYLSRISIR
1b3qA           ------------------------------------------------------DLMGELVIARSRILET
2ch4B           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
2avwA           --------------------------------------------------------------WWFDQNKD
3dgeA           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3clqD           ITYE---NCGPKGAVQGALVFEGLAKDLADADRVARSGAITFSPCHEHDAVGSAGVTSPNYVHIIKNETY
1bknA           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
3d6nA           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------REKYIEMQSQHIRERREALG----
3ehgA           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
3crkA           ---------------------------------------------------------YKDTYGDDPVSNQ
2cg9A           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RLAELFQLDHLATRMRRNNENLLVLSGQDNTRKWAQPVPLVDVLRAAVSEVEQYARVNVRAPSHVSVLGR
3bk9F           RDV-LGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFRYLARFGHAIPQQ
2btzA           NIQYFLDFYLSRISIRMLINQHTLIFDKHIGSINCNVSEVVKDAYDMAKLLCDKYYNAANSKQPIHMVYV
1bxdA           -----------------------------------EMADLNAVLGEVIAAESGYERIETALYPGSIEVKM
3d2rB           LQYFLDRFYMNRISTRMLMNQHILIFSDSQTGNPSHIGSLCDQYYLSSPELKLTQVNGKFPDQPIHIVYV
2e0aB           NLQYLDRFYMNRISTRMLMNQHILIFSDSQTGNPSGSIDPNCDVVAVVQDAFECSRNGKFPDQPIHIVYV
2bu8A           AHPKHIGSIDPNCNVSEVVKDAYDMA-----KLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYH
2e0aA           NLQYLDRFYMNRISTRMLMNQHILIFSDSQTGNPSHIGSPNCDVVAVVQDAFECSRNGKFPDQPIHIVYV
2bu7A           ----------------------------------------------------------------------
2bu6A           YFLD--RFYLSRISIRMLINQHTLIFDKHIGSIDPNCNVSEKDAYDMAKLLCDKYINAANSKQPIHMVYV
2bu2A           NIQYFLDFYLSRISIRMLINQHTLIFDPKHIGSIDVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQ
3d2rA           NLQYFLDFYMNRISTRMLMNQHILIFSDSHIGSIDDVVAVVQDAFECSRMLCDQYYNGKFPDQPIHIVYV
3crkB           NIQYFLDFYLSRISIRMLINQHTLIFDHIGSIDPNDAYDMAKLLCDKYYMASPDLENATNATQPIHMVYV
2crkA           DDLDPHYVLSSRVRTGRSIKGYTLPPHCS----RGERRAVEKLSVEALNSLTGEFPLKSMTEQEQQQLID
2c2aA           LKEFLEVIIDQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNV
3bh1A           ---------LYLEMGGKLFDDMHASRVLPGFTPDNMLDRIKDEVEILVCINAKDLEISYEEDVLRLVDVF
1b3qB           RILETLKKYNIK-ELDESLSHLSRITLDQNVVMKIRMVPISFVFNRFPRMVRDLAKFIMRGEDTELDRTF
3d36B           RRQYARIAIEELDRAEAIITDYLTFAKPAP--ETPEKLNVKLEIERVIDILRPLANMSCVDIQATLAPFS
2akpB           ----------------------------------------------------------------------
2bu5A           SIRMLINQHTLIFDKHIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYV
3cgzC           -----------------------------------ELHPVAPLLDNLISALNKVYQISMDISPEISFVGE
3crlB           QHTLIFDGSTNPAHPKHIGSIDPNCSVSDVVKDAYDMAKLLDKYYMASPDLEIQEVNATNATQPIHMVYV
2ch4A           ----------------------------------SHMVPISFVFNRFPRMVRDLAKFIMRGEDTELDRTF
2dvyD           ----------------------------------------------------------------------
3crlA           ML--INQHTLIFDGSTNPAHPKHIGSIDPNCSVSDVVKDAYDMAKLLCDKYYMASPNATNATQPIHMVYV
1b3qA           LKKYNIKLDESLSHLSR------ITLDLQNVVMKIRMVPISFVFNRFPRMVRDLAKKMIMRGEDTELDRT
2ch4B           ----------------------------------SHMVPISFVFNRFPRMVRDLAKFIMRGEDTELDRTF
3cgzB           -----------------------------------ELHPVAPLLDNLISALNKVYQISMDISPEISFVGE
2avwA           QIKRYLEEHPEKQKINFNGEQMFDVKEAIDTKNHQLDSKLFEYFKEKAFPYLSTKHLGVFPDHVIDMFIN
3dgeA           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
1eh8A           ----------------------------------AAVLGGPEPLMQCTAWLNAYFHPEAIEEFPVPALHH
3cgzA           -----------------------------------ELHPVAPLLDNLISALNKVYQISMDISPEISFVGE
3clqD           GNTAFTNLSEQLAKVLRFGANDQSVPLLHDATFCPEGIDLRLLSQALHGDECHNRNVAGSLTPYVQTDFS
1bknA           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
3d6nA           ----------------------------------------------------------------------
3bh1D           -------GKLYLEMGGKLFDDMHASRVLPGFTPDNMLDRIKDEVEILVCINAKDLEISYEEDVLRLVDVF
3ehgA           -------------------------------------IRLKDELINIKQILEAAFIYEEEKWPENISLLN
3cwvA           -------------------------------------------------------------PGMYCGDVG
1ah8A           -------------------------------------------------------QAEITQLMSLIINTV
2akpA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
2ccsA           -------------------------------------------------------QAEIAQLMSLIINTF
3crkA           NIQYFLDFYLSRISIRMLINQHTLIFDPKHIGSIDPNCSVSDVVKDAYDMAKLLCDVNATNATQPIHMVY
2cg9A           -------------------------------------------------------QAEITQLMSLIINTV
2cg9B           -------------------------------------------------------QAEITQLMSLIINTV
1ei1A           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           PVNDVIHLIAELVENATVFSAHDTQVSVTAQAVDNGDIIIEITDSGIGMSAEELESANQKLAEPPVIDVA
3bk9F           YDDTLRPVFERIYENTDRYWREYSLC--------------------------------------------
2btzA           PSH-LYHMLFELFKNAMRATVESHESSLILPPIGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTA-----
1bxdA           HPLSIKRAVANMVVNAARYGNGWIKVSSGTE---PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTI
3d2rB           P-SHLHHMLFELFKNAMRATVEHQENQPSLTPIEKEDLTIKISDRGGGVPLRIIDRLFSYTYSTAPTPPL
2e0aB           P-SHLHHMLFELFKNAMRATVEHQENQPSLTVLGKEDLTIKISDRGGGVPLRIID----RLFSYTYSTAL
2bu8A           MLFELFKNAMRATVESHESSLILPPIKVMVA-LGEEDLSIKMSDRGGGVPLRKI----ERLFSYMYSTPL
2e0aA           P-SHLHHMLFELFKNAMRATVEHQENQEVIVVLGKEDLTIKISDRGGGVPLRIIDRLFSYTTAPTPNAPL
2bu7A           --SHLYHMLFELFKNAMRATVESHESSLILPPIGEEDLSIKMSDRGGGVPLRKIE----RLFSYMYST--
2bu6A           P-SHLYHMLFELFKNAMRATVESHESSLILPPIKVMDLSIKMSDRGGGVPLRKIERLFSYMYSTA-----
2bu2A           PIHMLYHMLFELFKNAMRATVESHESSLILPPIKV-MVALGEEDLSIKMSDRGGGVPLRKILFSYMYSTL
3d2rA           P-SHLHHMLFELFKNAMRATVEHQENQPSLTVLGKEDLTIKISDRGGGVPLRIIDRLFSYTYSTAPTAPL
3crkB           PSH-LYHMLFELFKNAMRATVESHESSLTMVALGEEDLSIKMSDRGGGVPLRKIE----RLFSYMYST--
2crkA           DHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQK
2c2aA           PCPVEAQVLLNLLNNGVKYSKKDAPDKYVKVILKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVD-----
3bh1A           R-DRGFLVEHVVLTQLENDNRLALAFIER---LQRLGIKVSRHRVIPGYPTDMDRIVSDEGFGLNEYAET
1b3qB           V-EEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLIIEVEDDGRGIDKEKIIRKAIFLFVPGFSTKE
3d36B           VIGEREKFLLNVMKNAIEAMPNGGTLQVYVSIDNG-RVLIRIADTGVGMTKEQLERLGEP---YFTTKGV
2akpB           -------IRYKSLSDPKQLE-TEPDLFIRIT-PKPEQKVLEIRDSGIGMTKAELI----NNLGTIAKSGT
2bu5A           P-SHLYHMLFELFKNAMRATVESHESSLILPPLGEEDLSIKMSDRGGGVPLRKIE----RLFSYMYSTA-
3cgzC           Q--NDFVEVMGVLDNACKYCLEFVEISARQ---TDDHLHIFVEDDGPGIPHTLRPGQGV-----------
3crlB           P-SHLYHMLFELFKNAMRATVESHESSLIMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTAPLAG-
2ch4A           V-EEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLLIDESKAATLSDQEILN----FLFVPGFSTKE
2dvyD           -------------EASVSFENGKIVVRLPIT-RPTSKIRVKKIENGVGIPVSTRKKSFPSDEWQISYARD
3crlA           PS-HLYHMLFELFKNAMRATVESHESSLTLPALGEEDLSIKMSDRGGGVPLRKIERLFSY---MYSTAPL
1b3qA           FVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLIIEVEDDGRGIDKEKII----RKAIEKGLFVP
2ch4B           V-EEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLVIEVEDDGRGIDKEKIISKAATLSDQEILNFL
3cgzB           Q-NDFVEVMGNVLDNA--CKYCLEFVEISARQTDDHLHIFVEDDGPGIPHSKRSTLRP------------
2avwA           GYRLSLTNHGPTPVKEGSKDPRGGIFDAVFTRGDQSKLLHDFKEKNLKEISDLIKKELTELGLSHTYANV
3dgeA           --TRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDVLIIVEDNGIGIPDHAKDRIFEQFVDSSLTYEV
2dvyA           -----------LTSVEASVSFENGKIVVRLPITRPSKIRVKKIENGVGIPVSTR----------KKSFPS
2dvyF           -------------EASVSFENGKIVVRLPITR-PTSKIRVKKIENGVGIPVSTRKLRDYYIEWQISYARD
1eh8A           PVFQQESFTRQVLWKLLKVVKFGEVISYQQLA---ALAGNPKAARAVGGAMRGNP----VPILIPHRVVC
3cgzA           Q-----NDFVEVMGNVLDNACKYCLEFVEISRQTDDHLHIFVEDDGPGIPHTLRPG--------------
3clqD           R-EQLKEVFEFLGSSDYFSGPTWGAAKCALDAGHENSTIVTTCRNGVEFGIRVSGIGGNH-WFTGPAQRV
1bknA           ------SVVKELVENSLDAGATRIDIDI----ERGGAKLIRIRDNGCGIKKDEL----------------
1bknB           -VERPASVVKELVENSLDAGATR----IDIDIERGGAKLIRIRDNGCGIKKDELALA---LAEAIISLGF
3d6nA           -----------IVKNGYVIDPSQNLEGEFDILVENG-KIKKIDKNILVP-EAEIIDAKGLIVCPGFIDIH
3bh1D           R-DRGFLVEHVVLTQLENDNRLALAFIER---LQRLGIKVSRHRVIPGYPTDMDRGLNEYAETTRDLVVV
3ehgA           E-NILSMCLKEAVTNVVKHSQAKTCRVDIQQ--LWKEVVITVSDDGTFKGEENSFSKG------------
3cwvA           E-YGLHHLVYFLLDVAYEEARRGECRDVVLE--VGGDGSIALFCTSRTVTAENLVRVATGAGFLGRPPGD
1ah8A           YSN-KEIFLRELISNASDALDKIRYKSLSDPKQKPEQKVLEIRDSGIGMTKAELI----NNLGTIAKTKA
2akpA           --NASDALRYKSLSDPKQLETEPDLFIRITP--KPEQKVLEIRDSGIGMTKAELINNLGTIAKSG-TKAF
2dvyB           ------------VEASVSFENGKIVVRLPITR-PTSKIRVKKIENGVGIPVSTRKKSFPS----------
2ccsA           Y-SNKEIFLRELISNSSDALDKIRYETLTDPSPNKQDRTLTIVDTGIGMTKADLI----NNLGTIAKSGT
3crkA           VPSHLYHMLFELFKNAMRATVESHESSLTLPPIKEEDLSIKMSDRGGGVPLRKIERLFSYMYSTA-----
2cg9A           Y-SNKEIFLRELISNASDALDKIRYKSLSDPKQKPEQKVLEIRDSGIGMTKAELINNLGTIAKSG--TKA
2cg9B           Y-SNKEIFLRELISNASDALDKIRYKSLSDPKQKPEQKVLEIRDSGIGMTKAELI----NNLGTIAKSGT
1ei1A           ------HMVFEVVDNAIDEALAGHCKEIIVT--IHADNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLH
1bdtA           ------------------GMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQ---------------
2dvyC           -----------LTSVEASVSFENGKIVVRLPITRPSKIRVKKIENGVGIPVSTRK----KSFPSDE----


                         .         +         .         .         .         .         *:700
query           VSRRMGLFVVSRLANRHGIEVRLRPAHNGGITAAVRLPNDLLITPVEPTPPALTSGRGTTVxxxxxxxxx
3bk9F           ----------------------------------------------------------------------
2btzA           --PGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAWRHYQT---------
1bxdA           SGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVTRAQGTTKE--------------------
3d2rB           AGFGYGLPISRLYAKYFQGDLNLYSLSGYGTDAIIYLKALSSESIEKLPVFNKSAFKH------------
2e0aB           AGFGYGLPISRLYAKYFQGDLNLYSLSGYGTDAIIYLKALSSESIEKLPVFNKSA---------------
2bu8A           AGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAWRHY-----------
2e0aA           AGFGYGLPISRLYAKYFQGDLNLYSLSGYGTDAIIYLKALSSESIEKLPVFNKSAFKH------------
2bu7A           -APGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAWRHYQT---------
2bu6A           --PGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAWRHYQT---------
2bu2A           AGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAWRHYQT---------
3d2rA           AGFGYGLPISRLYAKYFQGDLNLYSLSGYGTDAIIYLK---ALSSESIEKLPVFNKS-------------
3crkB           -APGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAWRH------------
2crkA           IEEIKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLAHLSKFEEILTRLRLQKRGTSV---------
2c2aA           --TGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIP--------------------------------
3bh1A           TRDLGKLATCLSQVYHEHKRGVAAGYAKFETFPIWNLPLEHPVNLAYEAA--------------------
1b3qB           KVSEVSMDVVKNVVESLNGSMGIESEKDKGTKVTIRLP--------------------------------
3d36B           KGTGLGMMVVYRIIESMNGTIRIESEIHKGTTVSIYLP--------------------------------
2akpB           KAFMEALADVSMIGQFGVGFYSLFLVADRVQVISKSND--------------------------------
2bu5A           --PGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAWRHYQT---------
3cgzC           -----GLAVAREITEQYAGQIIASDSLLGGARMEVVFG--------------------------------
3crlB           --FGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAWRH------------
2ch4A           KVSEVGMDVVKNVVESLNGSISIESEKDKGTK--------------------------------------
2dvyD           GKYDYELSRMVRLAHEHGILTYNDIYELLKFADDVKSYLEDKGIRRESTNE-------------------
3crlA           AGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAWRH------------
1b3qA           GFSGVGMDVVKNVVESLNGSMGIESEKDKGTKVTIRLP--------------------------------
2ch4B           FVPGFSMDVVKNVVESLNGSISIESEKDKGTK--------------------------------------
3cgzB           -GQGVGLAVAREITEQYAGQIIASDSLLGGARMEVVFG--------------------------------
2avwA           RINHVINLWGADFDSNGNLKAIYVTDSDSNASIGMKKYFVGVNSAGKVAISAKEDNIGAQV---------
3dgeA           PGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIP--------------------------------
2dvyA           DENLRDYYIEWQISYARDYDYELSRAHEHGILTYNDIYE-------------------------------
2dvyF           GKYDYELSRMVRLAHEHGILTYNDIYELLKFADDVKSYLEDKGIRRESTNEE------------------
1eh8A           SSGAGGLAVKEWLLAHEGHRL-------------------------------------------------
3cgzA           --QGVGLAVAREITEQYAGQIIASDSLLGGARMEVVFG--------------------------------
3clqD           IGPFAGYTQEDAGLDGDSAITETYGVGGFAAAAPAIVP--LVGGTVAEALNYSKELEITTK---------
1bknA           ----------------------------------------------------------------------
1bknB           RGEALAISSVSRLTSRTAEQQEAWQAYMNVT---------------------------------------
3d6nA           VHLRDP-----GQTYKEDIESGSRCAVAGGFTTIVCMPN-------------------------------
3bh1D           TAPGPGSGKLLSQVYHEHKRGVAAGYAKFETFPIWNLP--------------------------------
3ehgA           ----HGLLGMRERLEFANGSLHIDT--ENGTKLTMAIPN-------------------------------
3cwvA           GWGWDSMLVVSLALSSRYQVDIWADGRQWRVMGEHGHPQGEGAAVTPMEPMPVSAERGVR----------
1ah8A           FMEALSAGADVSMIGQFGVGFYSLFLVADR----------------------------------------
2akpA           MEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKSND--------------------------------
2dvyB           ----------------------------------------------------------------------
2ccsA           KAFMEALQAISMIGQFGVGFYSAYLVAEKVTVITKHNDSSAGGSFTVRTDTGEPMGRGTKV---------
3crkA           --PGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSA---------------
2cg9A           FMEALSAGADVSMIGQFGVGFYSLFLVADR----------------------------------------
2cg9B           KAFMLSAGADVSMIGQFGVGFYSLFLVADRVQVISKSNDDE-----------------------------
1ei1A           AGGKFDDNSYKVSGGLHGVGVSVVNAQREGKIHRQIYEHGVPQAPLAVTGETEKTGTMVRF---------
1bdtA           ----------------------------------------------------------------------
2dvyC           --NLRDYYIEWQISYARDLSRMVRLAHEHGILTYNDIYELLDDVKSYLEDKGIRREST------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bk9F           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
2crkA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
2bu5A           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
2avwA           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3clqD           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
3d6nA           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bk9F           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
2crkA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
2bu5A           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
2avwA           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3clqD           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
3d6nA           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bk9F           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
2crkA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
2bu5A           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
2avwA           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3clqD           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
3d6nA           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bk9F           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
2crkA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
2bu5A           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
2avwA           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3clqD           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
3d6nA           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bk9F           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
2crkA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
2bu5A           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
2avwA           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3clqD           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
3d6nA           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxxxxx
3bk9F           ---------------------------
2btzA           ---------------------------
1bxdA           ---------------------------
3d2rB           ---------------------------
2e0aB           ---------------------------
2bu8A           ---------------------------
2e0aA           ---------------------------
2bu7A           ---------------------------
2bu6A           ---------------------------
2bu2A           ---------------------------
3d2rA           ---------------------------
3crkB           ---------------------------
2crkA           ---------------------------
2c2aA           ---------------------------
3bh1A           ---------------------------
1b3qB           ---------------------------
3d36B           ---------------------------
2akpB           ---------------------------
2bu5A           ---------------------------
3cgzC           ---------------------------
3crlB           ---------------------------
2ch4A           ---------------------------
2dvyD           ---------------------------
3crlA           ---------------------------
1b3qA           ---------------------------
2ch4B           ---------------------------
3cgzB           ---------------------------
2avwA           ---------------------------
3dgeA           ---------------------------
2dvyA           ---------------------------
2dvyF           ---------------------------
1eh8A           ---------------------------
3cgzA           ---------------------------
3clqD           ---------------------------
1bknA           ---------------------------
1bknB           ---------------------------
3d6nA           ---------------------------
3bh1D           ---------------------------
3ehgA           ---------------------------
3cwvA           ---------------------------
1ah8A           ---------------------------
2akpA           ---------------------------
2dvyB           ---------------------------
2ccsA           ---------------------------
3crkA           ---------------------------
2cg9A           ---------------------------
2cg9B           ---------------------------
1ei1A           ---------------------------
1bdtA           ---------------------------
2dvyC           ---------------------------