[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ55004.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cbgA.bssp"
#ERROR : Can't open dsspfile "3dr5A.bssp"
#ERROR : Can't open dsspfile "2avdA.bssp"
#ERROR : Can't open dsspfile "3c3yA.bssp"
#ERROR : Can't open dsspfile "2br5A.bssp"
#ERROR : Can't open dsspfile "2br5C.bssp"
#ERROR : Can't open dsspfile "3duwA.bssp"
#ERROR : Can't open dsspfile "3c3pC.bssp"
#ERROR : Can't open dsspfile "2admA.bssp"
#ERROR : Can't open dsspfile "3a25A.bssp"
#ERROR : Can't open dsspfile "3eeyB.bssp"
#ERROR : Can't open dsspfile "3c6kA.bssp"
#ERROR : Can't open dsspfile "3eeyA.bssp"
#ERROR : Can't open dsspfile "2br4A.bssp"
#ERROR : Can't open dsspfile "3c3pA.bssp"
#ERROR : Can't open dsspfile "1aqiA.bssp"
#ERROR : Can't open dsspfile "3eeyI.bssp"
#ERROR : Can't open dsspfile "1aqjB.bssp"
#ERROR : Can't open dsspfile "2cl5B.bssp"
#ERROR : Can't open dsspfile "3dulB.bssp"
#ERROR : Can't open dsspfile "2br5F.bssp"
#ERROR : Can't open dsspfile "1cmvB.bssp"
#ERROR : Can't open dsspfile "2br5D.bssp"
#ERROR : Can't open dsspfile "2br3A.bssp"
#ERROR : Can't open dsspfile "3c6mB.bssp"
#ERROR : Can't open dsspfile "2an3A.bssp"
#ERROR : Can't open dsspfile "1eizA.bssp"
#ERROR : Can't open dsspfile "2br3F.bssp"
#ERROR : Can't open dsspfile "3eeyG.bssp"
#ERROR : Can't open dsspfile "1aqjA.bssp"
#ERROR : Can't open dsspfile "3c6kD.bssp"
#ERROR : Can't open dsspfile "3dulA.bssp"
#ERROR : Can't open dsspfile "1dctA.bssp"
#ERROR : Can't open dsspfile "1dl5A.bssp"
#ERROR : Can't open dsspfile "3e05C.bssp"
#ERROR : Can't open dsspfile "3dxyA.bssp"
#ERROR : Can't open dsspfile "3bwyA.bssp"
#ERROR : Can't open dsspfile "3ckkA.bssp"
#ERROR : Can't open dsspfile "1eg2A.bssp"
#ERROR : Can't open dsspfile "2dulA.bssp"
#ERROR : Can't open dsspfile "2cl5A.bssp"
#ERROR : Can't open dsspfile "3eeyF.bssp"
#ERROR : Can't open dsspfile "3dxxA.bssp"
#ERROR : Can't open dsspfile "3eeyC.bssp"
#ERROR : Can't open dsspfile "2d16A.bssp"
#ERROR : Can't open dsspfile "3c6kB.bssp"
#ERROR : Can't open dsspfile "2br3B.bssp"
#ERROR : Can't open dsspfile "3e05F.bssp"
#ERROR : Can't open dsspfile "2an4B.bssp"
#ERROR : Can't open dsspfile "1dusA.bssp"
#ERROR : Can't open dsspfile "2ar0B.bssp"
#ERROR : Can't open dsspfile "2cmgA.bssp"
#ERROR : Can't open dsspfile "2b25B.bssp"
#ERROR : Can't open dsspfile "2b9eA.bssp"
#ERROR : Can't open dsspfile "2br5E.bssp"
#ERROR : Can't open dsspfile "2br4F.bssp"
#ERROR : Can't open dsspfile "2an3B.bssp"
#ERROR : Can't open dsspfile "3c6kC.bssp"
#ERROR : Can't open dsspfile "3b3gA.bssp"
#ERROR : Can't open dsspfile "1booA.bssp"
#ERROR : Can't open dsspfile "3egiD.bssp"
#ERROR : Can't open dsspfile "2br3D.bssp"
#ERROR : Can't open dsspfile "2bh2A.bssp"
#ERROR : Can't open dsspfile "2b2cA.bssp"
#ERROR : Can't open dsspfile "3c3pB.bssp"
#ERROR : Can't open dsspfile "3c6mD.bssp"
#ERROR : Can't open dsspfile "2dpmA.bssp"
#ERROR : Can't open dsspfile "3bkxA.bssp"
#ERROR : Can't open dsspfile "3egiB.bssp"
#ERROR : Can't open dsspfile "3cjqD.bssp"
#ERROR : Can't open dsspfile "3cvoA.bssp"
#ERROR : Can't open dsspfile "3c6mA.bssp"
#ERROR : Can't open dsspfile "3bwmA.bssp"
#ERROR : Can't open dsspfile "3e05H.bssp"
#ERROR : Can't open dsspfile "3egiA.bssp"
#ERROR : Can't open dsspfile "2b25A.bssp"
#ERROR : Can't open dsspfile "3cjtG.bssp"
#ERROR : Can't open dsspfile "2as0A.bssp"
#ERROR : Can't open dsspfile "2bm8A.bssp"
#ERROR : Can't open dsspfile "3bwcB.bssp"
#ERROR : Can't open dsspfile "2e58B.bssp"
#ERROR : Can't open dsspfile "1admA.bssp"
#ERROR : Can't open dsspfile "3bwbB.bssp"
#ERROR : Can't open dsspfile "2a14A.bssp"
#ERROR : Can't open dsspfile "3cjrA.bssp"
#ERROR : Can't open dsspfile "2bm8G.bssp"
#ERROR : Can't open dsspfile "3dxzA.bssp"
#ERROR : Can't open dsspfile "2e5wA.bssp"
#ERROR : Can't open dsspfile "2bm8B.bssp"
#ERROR : Can't open dsspfile "2aztB.bssp"
#ERROR : Can't open dsspfile "3cjtA.bssp"
#ERROR : Can't open dsspfile "3c0kA.bssp"
#ERROR : Can't open dsspfile "2ekmA.bssp"
#ERROR : Can't open dsspfile "2aowA.bssp"
#ERROR : Can't open dsspfile "2bm9B.bssp"
#ERROR : Can't open dsspfile "3cc2M.bssp"
#ERROR : Can't open dsspfile "2b3tA.bssp"
#ERROR : Can't open dsspfile "3bwbA.bssp"

## Summary of PDB Search
:219
    4e-25  40%  3cbgA  [x.x.x] O-METHYLTRANSFERASE
    5e-22  21%  3dr5A  [x.x.x] PUTATIVE O-METHYLTRANSFERASE
    1e-20  38%  2avdA  [x.x.x] CATECHOL-O-METHYLTRANSFERASE
    7e-18  32%  3c3yA  [x.x.x] O-METHYLTRANSFERASE
    2e-13  14%  2br5A  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    2e-13  15%  2br5C  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    5e-13  34%  3duwA  [x.x.x] O-METHYLTRANSFERASE, PUTATIVE
    2e-10  21%  3c3pC  [x.x.x] METHYLTRANSFERASE
    2e-10  14%  2admA  [c.66.1 - d.287.1] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    4e-10  14%  3a25A  [x.x.x] UNCHARACTERIZED PROTEIN PH0793
    1e-09  14%  3eeyB  [x.x.x] PUTATIVE RRNA METHYLASE
    1e-09  11%  3c6kA  [x.x.x] SPERMINE SYNTHASE
    3e-09  14%  3eeyA  [x.x.x] PUTATIVE RRNA METHYLASE
    3e-09  11%  2br4A  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    4e-09  23%  3c3pA  [x.x.x] METHYLTRANSFERASE
    4e-09  14%  1aqiA  [c.66.1 - d.287.1] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    5e-09  14%  3eeyI  [x.x.x] PUTATIVE RRNA METHYLASE
    5e-09  10%  1aqjB  [c.66.1 - d.287.1] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    6e-09  19%  2cl5B  [x.x.x] CATECHOL O-METHYLTRANSFERASE
    6e-09  32%  3dulB  [x.x.x] O-METHYLTRANSFERASE, PUTATIVE
    6e-09  11%  2br5F  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    9e-09  12%  1cmvB  [b.57.1] HUMAN CYTOMEGALOVIRUS PROTEASE
    3e-08  12%  2br5D  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    4e-08  12%  2br3A  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    4e-08  12%  3c6mB  [x.x.x] SPERMINE SYNTHASE
    5e-08  15%  2an3A  [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE
    7e-08  12%  1eizA  [c.66.1] FTSJ
    8e-08  12%  2br3F  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    1e-07  14%  3eeyG  [x.x.x] PUTATIVE RRNA METHYLASE
    1e-07   7%  1aqjA  [c.66.1 - d.287.1] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    2e-07  10%  3c6kD  [x.x.x] SPERMINE SYNTHASE
    2e-07  35%  3dulA  [x.x.x] O-METHYLTRANSFERASE, PUTATIVE
    8e-07   7%  1dctA  [c.66.1] PROTEIN (MODIFICATION METHYLASE HAEIII)
    8e-07  20%  1dl5A  [c.66.1 - d.197.1] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE
    8e-07  11%  3e05C  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    9e-07  16%  3dxyA  [x.x.x] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
    9e-07  19%  3bwyA  [x.x.x] COMT PROTEIN
    9e-07  14%  3ckkA  [x.x.x] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
    1e-06   5%  1eg2A  [c.66.1] MODIFICATION METHYLASE RSRI
    1e-06  11%  2dulA  [x.x.x] N(2),N(2)-DIMETHYLGUANOSINE TRNA
    2e-06  15%  2cl5A  [x.x.x] CATECHOL O-METHYLTRANSFERASE
    2e-06  14%  3eeyF  [x.x.x] PUTATIVE RRNA METHYLASE
    3e-06  16%  3dxxA  [x.x.x] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
    4e-06  14%  3eeyC  [x.x.x] PUTATIVE RRNA METHYLASE
    5e-06  10%  2d16A  [x.x.x] HYPOTHETICAL PROTEIN PH1918
    5e-06  12%  3c6kB  [x.x.x] SPERMINE SYNTHASE
    6e-06  13%  2br3B  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    6e-06  14%  3e05F  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    8e-06  15%  2an4B  [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE
    1e-05  17%  1dusA  [c.66.1] MJ0882
    1e-05   9%  2ar0B  [x.x.x] TYPE I RESTRICTION ENZYME ECOKI M PROTEIN
    1e-05  14%  2cmgA  [x.x.x] SPERMIDINE SYNTHASE
    1e-05  11%  2b25B  [x.x.x] HYPOTHETICAL PROTEIN
    1e-05  13%  2b9eA  [x.x.x] NOL1/NOP2/SUN DOMAIN FAMILY, MEMBER 5 ISOFORM 2
    2e-05  11%  2br5E  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    2e-05  13%  2br4F  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    2e-05  15%  2an3B  [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE
    2e-05  11%  3c6kC  [x.x.x] SPERMINE SYNTHASE
    2e-05  14%  3b3gA  [x.x.x] HISTONE-ARGININE METHYLTRANSFERASE CARM1
    2e-05   9%  1booA  [c.66.1] PROTEIN (N-4 CYTOSINE-SPECIFIC METHYLTRANSFERASE
    2e-05  15%  3egiD  [x.x.x] TRIMETHYLGUANOSINE SYNTHASE HOMOLOG
    3e-05  11%  2br3D  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    3e-05  10%  2bh2A  [x.x.x] 23S RRNA (URACIL-5-)-METHYLTRANSFERASE RUMA
    3e-05  13%  2b2cA  [x.x.x] SPERMIDINE SYNTHASE
    3e-05  22%  3c3pB  [x.x.x] METHYLTRANSFERASE
    4e-05  11%  3c6mD  [x.x.x] SPERMINE SYNTHASE
    4e-05   7%  2dpmA  [c.66.1] PROTEIN (ADENINE-SPECIFIC METHYLTRANSFERASE
    4e-05  17%  3bkxA  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    4e-05  14%  3egiB  [x.x.x] TRIMETHYLGUANOSINE SYNTHASE HOMOLOG
    5e-05  22%  3cjqD  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    5e-05  11%  3cvoA  [x.x.x] METHYLTRANSFERASE-LIKE PROTEIN OF UNKNOWN
    6e-05  12%  3c6mA  [x.x.x] SPERMINE SYNTHASE
    9e-05  15%  3bwmA  [x.x.x] CATECHOL O-METHYLTRANSFERASE
    9e-05  13%  3e05H  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    9e-05  15%  3egiA  [x.x.x] TRIMETHYLGUANOSINE SYNTHASE HOMOLOG
    1e-04  10%  2b25A  [x.x.x] HYPOTHETICAL PROTEIN
    1e-04  21%  3cjtG  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    1e-04  19%  2as0A  [x.x.x] HYPOTHETICAL PROTEIN PH1915
    1e-04  11%  2bm8A  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    1e-04  10%  3bwcB  [x.x.x] SPERMIDINE SYNTHASE
    1e-04  10%  2e58B  [x.x.x] MNMC2
    2e-04   8%  1admA  [x.x.x] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    2e-04  15%  3bwbB  [x.x.x] SPERMIDINE SYNTHASE
    2e-04  11%  2a14A  [x.x.x] INDOLETHYLAMINE N-METHYLTRANSFERASE
    2e-04  23%  3cjrA  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    3e-04  11%  2bm8G  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    4e-04  15%  3dxzA  [x.x.x] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
    4e-04   8%  2e5wA  [x.x.x] PROBABLE SPERMIDINE SYNTHASE
    4e-04  11%  2bm8B  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    5e-04  16%  2aztB  [x.x.x] GLYCINE N-METHYLTRANSFERASE
    5e-04  22%  3cjtA  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    6e-04  13%  3c0kA  [x.x.x] UPF0064 PROTEIN YCCW
    7e-04  10%  2ekmA  [x.x.x] HYPOTHETICAL PROTEIN ST1511
    7e-04   6%  2aowA  [x.x.x] HISTAMINE N-METHYLTRANSFERASE
    7e-04  11%  2bm9B  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    8e-04   8%  3cc2M  [x.x.x] 50S RIBOSOMAL PROTEIN L15E
    8e-04  17%  2b3tA  [x.x.x] PROTEIN METHYLTRANSFERASE HEMK
    9e-04  10%  3bwbA  [x.x.x] SPERMIDINE SYNTHASE
:219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTRTSENLSPELHAYLVAHSTPVDEVLTDLAAETERLFPDHVGMQIAPEQGLFLTLLTQLIGARNIVEVG
3cbgA           --KGITGFDPSLYSYLQSISADDSFYLAQLRRETAHLPGAPMQIS--PEQAQFLGLLISLTGAKQVLEIG
3dr5A           -------------------------------------------------------------GSTGAIAIT
2avdA           --------DSRLWQYLLSRSMREHPALRSLRLLTLEQPQGD--SMMTCEQAQLLANLARLIQAKKALDLG
3c3yA           --------SEELCQYILRTSVREAGFLKELREANESH--PDSYMSTSPLAGQLMSFVLKLVNAKKTIEVG
2br5A           ----------------------AEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELG
2br5C           ----------------------AEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELG
3duwA           ----------AVDQYVSDVLIPKDSTLEEVLQVNAAANLPA--HDVSPTQGKFLQLLVQIQGARNILEIG
3c3pC           --------DSRIGAYLDGLLPEADPVVAAEQIARERNIPIV-----DRQTGRLLYLLARIKQPQLVVVPG
2admA           ---------------------------------------------TPPEVVDFMVSLAEAPRGGRVLEPA
3a25A           -----------------------------------------------------------------VVDMF
3eeyB           ---------------------------------------------------------------DTVVDAT
3c6kA           ----------------------------------------------------------------------
3eeyA           -----------------------------------------------------------------VVDAT
2br4A           -------------------DRWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELG
3c3pA           --------DSRIGAYLDGLLPEADPVVAAEQIARERNIP-----IVDRQTGRLLYLLARIKQPQLVVVPG
1aqiA           ---------------------------------------------TPPEVVDFMVSLAEAPRGGRVLEPA
3eeyI           -----------------------------------------------------------------VVDAT
1aqjB           ---------------------------------------------TPPEVVDFMVSLAEAPRGGRVLEPA
2cl5B           --------EQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWA-MNVGDAKGQIMDAVIREYSPSLVLELG
3dulB           ----------AVDQYVSDVLIPKDSTLEEVLQVNAAANLPAHDVSPTQGK--FLQLLVQIQGARNILEIG
2br5F           -------------PRDWPLDRWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELG
1cmvB           ---------------------------------------LEIVRRASEKSELVSRGPVSPLQPDKVVEFL
2br5D           --------------RDWPLDRWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELG
2br3A           --------------RDWPLDRWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELG
3c6mB           ----------------------------------------------------------------------
2an3A           -------------------------------------------VGPWKLRCLAQTFATGEVSGRTLIDIG
1eizA           --------------------------------------------RAWFKLDEIQQSDKLFKPGMTVVDLG
2br3F           --------------RDWPLDRWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELG
3eeyG           ---------------------------------------------------------------DTVVDAT
1aqjA           --------------------------------------------------------LAEAPRGGRVLEPA
3c6kD           ----------------------------------------------------------------------
3dulA           ----------AVDQYVSDVLIPKDSTLEEVLQVNAAANLPA--HDVSPTQGKFLQLLVQIQGARNILEIG
1dctA           -----------------------------------------------------------------LISLF
1dl5A           -----------------------------------------------------------------VLEIG
3e05C           ----------------------------PVIGIDDDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIG
3dxyA           ----------------------------------ENYWPV-MGVEFSED----MLDFPALFGREATLEIG
3bwyA           ----------------------EQRILNHVLQHAEPGNAQSVLENVGDKKGKIVDAVIQEHQPSVLLELG
3ckkA           --------------------------------------------PVKPEEMDWSELYPEFAQVE-FADIG
1eg2A           ----------------------------RMSRLNGNSLERVGHPTQKPAAVIERLVRALSHPGSTVLDFF
2dulA           -------------------------------------IPPVFYNPRMALNRDIVVVLLNILNPKIVLDAL
2cl5A           --------EQRILRYVQQNAKPGDQSVLEAIDTYCTQKEWA--MNVGDAKGQIMDAVIREYSPSLVLELG
3eeyF           -----------------------------------------------------------------VVDAT
3dxxA           ----------------------------------ENYWPVM-GVEFSED----MLDFPALFGREATLEIG
3eeyC           ---------------------------------------------------------------DTVVDAT
2d16A           ---------------------------------------EVIDIEKPEGVEVIIGQGNFSIFTVDRALLT
3c6kB           ----------------------------------------------------------------------
2br3B           --------------RDWPLDRWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELG
3e05F           ----------------------------------DDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIG
2an4B           -----------------------RAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIG
1dusA           ----------------------------------------------------------------DILDLG
2ar0B           ----------------------------------------------------TIIHLLKPQPREVVQDPA
2cmgA           --------------------------------------------LHIESELLAHMGGCTKKELKEVLIVD
2b25B           --------------------------------------------ITFPKDINMILSMMDINPGDTVLEAG
2b9eA           -------------------------------------------LILQDRASCLPAMLLDPPPGSHVIDAC
2br5E           --------------RDWPLDRWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELG
2br4F           --------------RDWPLDRWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELG
2an3B           -----------------------RAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIG
3c6kC           ----------------------------------------------------------------------
3b3gA           -------------------------------------------MQDYVRTGTYQRAILQNHTDFIVLDVG
1booA           -------------------------------------MGIKAHPARFPAKLPEFFIRMLTEPDDLVVDIF
3egiD           ---------------------PLGS---RLFSRFDDGREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAF
2br3D           --------------RDWPLDRWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELG
2bh2A           ---------------------------------------------------------------DRVLDLF
2b2cA           -----------------------------------------------YQEMLAHLPMFAHPDPKRVLIIG
3c3pB           --------------YLDGLLPEADPVVAAEQIARERNIPIV-----DRQTGRLLYLLARIKQPQLVVVPG
3c6mD           ----------------------------------------------------------------------
2dpmA           ---------------------------------------------------DMMSEVQRAARIL-YMLRV
3bkxA           --------------------------------------PTANARTIQRRQTAHRLAIAEAWQVKPILEIG
3egiB           ----------------------GSRLFSRFDDGIKLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAF
3cjqD           ---------------------------------------------------------------DKVLDLG
3cvoA           --------------------------------------------------------------AEVILEYG
3c6mA           ----------------------------------------------------------------------
3bwmA           -------KEQRILNHVLQHA---EPGNAQSVLEAIDTYCEQKEWNVGDKKGKIVDAVIQEHQPSVLLELG
3e05H           ----------------------------PVIGIDDDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIG
3egiA           ---------------------PLGSRLFSRFDDGIKLDREGWFVTPEKIAEHIAGRVSQSFKCDVVVDAF
2b25A           ---LAETTKFKKLFRLNNFGLLNVPFGKIVGKFPGQILRSSFGAITFPKDINMILSMMDINPGDTVLEAG
3cjtG           ----------------------------TWEGAEIPLVIEPGGTGHAETTRLALKALARLRPGDKVLDLG
2as0A           ------------------------------------IVDRGQKTGFFLDQRENRLALEKWVQPDRVLDVF
2bm8A           --------------RDWPLDRWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELG
3bwcB           ----------------------------------------------------------------------
2e58B           ILREFLRFAYNPEESGQEIADTADGSKTLIHKTYGEPYHSQTAIRESLYKFVRPSRILEKAKERKILDVG
1admA           ---------------------------------------------TPPEVVDFMVSLAEAPRGGRVLEPA
3bwbB           ----------------------------------------------------------------------
2a14A           ---------------------------------------------------LHKTFGPGGLQGDTLIDIG
3cjrA           ---------------------------------------------------------------DKVLDLG
2bm8G           --------------RDWPLDRWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELG
3dxzA           ----------------------------------ENYWPVM-GVEFSEDMLDFPALFGR--EAPVTLEIG
2e5wA           ------------------------------LLAIDGTVQLVTEGEKSYHEPLVHPAMLAHPNPRRVLIIG
2bm8B           --------------RDWPLDRWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELG
2aztB           ----------------RSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGVLDVA
3cjtA           ---------------------------------------------------------------DKVLDLG
3c0kA           ----------------------------------------------YLDQRDSRLATRRYVENKRVLNCF
2ekmA           -----------------------------------------------PEGTNVIIGQSHFIKTVYETLAS
2aowA           -----------------------------------------------------------------ILSIG
2bm9B           --------------RDWPLDRWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELG
3cc2M           ----------------------LAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVI-VARVS
2b3tA           -----------------------------------------------------------------ILDLG
3bwbA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TFTGYSSICLARGLPNDGTLLACDVSEEWTAVARRYWQRAGVADRIDLRLAPALDTLRALPEEPQFDLAF
3cbgA           VFRGYSALAMALQLPPDGQIIACDQDPNATAIAKKYWQKAGVAEKISLRLGATLEQLTQGKPLPEFDLIF
3dr5A           PAAGLVGLYILNGLADNTTLTCIDPESEHQRQAKALFREAGYSPSRVRFLLSRPLDVSRLANDS-YQLVF
2avdA           TFTGYSALALALALPADGRVVTCEVDAQPPELGRPLWRQAEAEHKIDLRLKPALDELLAAGEAGTFDVAV
3c3yA           VFTGYSLLLTALSIPDDGKITAIDFDREAYEIGLPFIRKAGVEHKINFIESDAMLALDNLLQGQEYDFGF
2br5A           VYNGGSLAWFRDLTKIMGI-DCQVIGIDRDLSRCQIPASDMENITLHQGDCSDLTTFEHLREMA-HPLIF
2br5C           VYNGGSLAWFRDLTGIDCQVIGIDRDLSRCQIPASDMENITLHQGD----CSDLTTFEHLREMA-HPLIF
3duwA           TLGGYSTIWLARGLSSGGRVVTLEASEKHADIARSNIERANDRVEVRTGLALDSLQQIENEKYEPFDFIF
3c3pC           DGLGCASWWFARAISI-SSRVVIDPDRDNVEHARRLHDNGLIDRVELQVG----DPLGIAAGQRDIDILF
2admA           CAHGPFLRAFREAHGTGYRFVGVEIDPKALDLPPWAEGILADFLLWEPGEAFDLILGKAVKDLYKKAFST
3a25A           AGIGHLSLPIAVY--GKAKVIAIEKDPYTFKFLVENIHLNKVEDRMSAYNMDNRD----FPGENIADRIL
3eeyB           CGNGNDTAFLASLVGENGRVFGFDIQDKAIANTTKKLTDLNLIDRVTLIKDGHQNMDKYIDC--PVKAVM
3c6kA           ---------------KPKMVTMVEIDQMVIDGCKKYMRKVLDNDCYQVLIEDCIPVLKRYAKEGEFDYVI
3eeyA           CGNGNDTAFLASLVGENGRVFGFDIQDKAIANTTKKLTDLNLIDRVTLIKDGHQNMDKYIDC--PVKAVM
2br4A           VYNGGSLAWFRDLTKIDCQVIGIDRDLSRCQIPASDMENITLHQGDCSDLTTFEHLREM-----AHPLIF
3c3pA           DGLGCASWWFARAIS-ISSRVVIDPDRDNVEHARRLHDNGLIDRVELQVGD---------PLGIAAGQRD
1aqiA           CAHGPFLRAFREAHGTGYRFVGVEIDPKALDLPPWAEGILADFLLWEPGEAFDLILGNPPYGIVKAVKDL
3eeyI           CGNGNDTAFLASLVGENGRVFGFDIQDKAIANTTKKLTDLNLIDRVTLIKDGHQNMDKYIDC--PVKAVM
1aqjB           CAHGPFLRAFREAHGTGYRFVGVEIDPKALDLPPWAEGILADFLLWEPGEAFDLILGNPPYGIVFKAVKD
2cl5B           AYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDMVFLD
3dulB           TLGGYSTIWLARGLSSGGRVVTLEASEKHADIARSNIERANLNDRVEVRTGLALDSLQQIENEEPFDFIF
2br5F           VYNGGSLAWFRDLTKIMGIDCQVIGIDRDLSRCQIPASDMENITLHQGD--------CHLREMAHPLIFI
1cmvB           SGSYAGLSLSKHLCSVGRRRGTLAVYGRDPEWVTQRFPDLTAADRDG----LRAQWQRGDPFRSDSYGLL
2br5D           VYNGGSLAWFRDLTKIMGI--DCQVIGIDRDLSRCQIPASDMENITLHQGDCTFE---HLREMAHPLIFI
2br3A           VYNGGSLAWFRDLTKIMGIDCQVIGIDRDLSRCQIPASDMENITLHQGDCSD--LTTFEHLREMAHPLIF
3c6mB           ----------------PKMVTMVEIDQMVIDGCKKYMRKTLKGDCYQVLIEDCIPVLKRYAKEGRFDYVI
2an3A           SGPTVYQLLSACSHFEDIT--MTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACL----IEGKGECWQDK
1eizA           AAPGGWSQYVVTQIGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNM
2br3F           VYNGGSLAWFRDLTKIMGIVIGIDRDLSRCQIPASDMENITLHQGDCSDLTTFEH-----LREMAHPLIF
3eeyG           CGNGNDTAFLASLVGENGRVFGFDIQDKAIANTTKKLTDLNLIDRVTLIKDGHQNMDKYIDC--PVKAVM
1aqjA           CAHGPFLRAFREAHGTGYRFVGVEIDPKALDLPPWAEGILADFLLWEPGEAFDLI-----LGNPPYGIVA
3c6kD           ---------------------MVEIDQMVIDGCKKYMRKNLKGDCYQVLIEDCIPVLKRYAKEGEFDYVI
3dulA           TLGGYSTIWLARGLSSGGRVVTLEASEKHADIARSNIERANLNDRVEVRTGLALDSLQQIENEKPFDFIF
1dctA           SGAGGLDLGFQKAGFRIIC--ANEYDKSIWKTYESNHSAKLIKGDISKISSDEFPKCDGIIGGPPCQSWS
1dl5A           GGTGYNAAVMSRVVGEKGLVVSVEYSRKICEIAKRNVERLGIENVIFV----CGDGYYGVPEFSPYDVIF
3e05C           AGSASVSIEASNLMPNGRIF-ALERNPQYLGFIRDNLKKFVARNVTLVEA----FAPEGLDDLPDPDRVF
3dxyA           FGMGASLVAMAKDRP-EQDFLGIEVHSPGVGACLASAHEEGLSNLRVMC-HDAVEVLHKMIPDNSLRMVQ
3bwyA           AYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGMKDKVTLVVGASQDIIPQLKKKYDVDFLD
3ckkA           CGYGGLLVELSPLFP-DTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFTKMF
1eg2A           AGSGVTARVAIQ---EGRNSICTDAAPVFKEYYQKQLTFLRSYEIVAANFGAALQ---------------
2dulA           SATGIRGIRFALETP-AEEVWLNDISEDAYELMKRNVMLNFDGELRESK----GRAILKGEKTIVINHDD
2cl5A           AYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLD
3eeyF           CGNGNDTAFLASLVGENGRVFGFDIQDKAIANTTKKLTDLNLIDRVTLIKDGHQNMDKYIDC--PVKAVM
3dxxA           FGMGASLVAMAKDRP-EQDFLGIEVHSPGVGACLASAHEEGLSNLRVMC-HDAVEVLHKMIPDNSLRMVQ
3eeyC           CGNGNDTAFLASLVGENGRVFGFDIQDKAIANTTKKLTDLNLIDRVTLIKDGHQNMDKYIDC--PVKAVM
2d16A           AVPGIKFGIAMN-EAKPQLTRYTGNDPELEALAAKNAVKIGAGHVFNAYPINVLNTIKNHPAVAMIYGAS
3c6kB           ----------------PKMVTMVEIDQMVIDGCKKYMRKVLDNDCYQVLIEDCIPVLKRYAKEGRFDYVI
2br3B           VYNGGSLAWFRDLTKIMGIDCQVIGIDR--DLSRCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLIF
3e05F           AGSASVSIEASNLMPNG-RIFALERNPQYLGFIRDNLKKFVARNVTL----VEAFAPEGLDDLPDPDRVF
2an4B           SGPTVYQLLSAC--SHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACL---------------
1dusA           CGYGVIGIALADE----VKSTTADINRRAIKLAKENIKLNNLDNYDIRVVH---SDLYENVKDRKYNKPP
2ar0B           AGTAGFLIEADRYVKSHRAFIGLELVPGTRRLALNCLLHDIEGNLDHGGAIRLGNTLGSDGENLKAHIVA
2cmgA           GFDLELAHQLFK---YDTHIDFVQADEKILDSFISFFPHFHE-VKNNKNFTHAKQLLD--LDIKKYDLIF
2b25B           SGSGGMSLFLSKAVGSQGRVISFEVRKDHHDLAKKNYKHWRDSWKLSHVEEWPDNVDFIHKDISGATFDA
2b9eA           AAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHELLDPSC
2br5E           VYNGGSLAWFRDLTKIMGIDIGIDRDLSRCQIPASDMENITLHQGDCSDLTTFEH----LREMAHPLIFI
2br4F           VYNGGSLAWFRDLTKIMGI--DCQVIGIDRDLSRCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLFI
2an3B           SGPTVYQLLSACS--HFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACL---------------
3c6kC           ---------------------MVEIDQMVIDGCKKYMRKNLKGDCYQVLIEDCIPVLKRYAKEGEFDYVI
3b3gA           CGSGILSFFAAQ---AGARKIYAVEASTMAQHAEVLVKSNNLTDRVVIPGKVEEVSLPEQVDIIISEPMG
1booA           GGSNTTGLVAER---ESRKWISFEMKPEYVAASAFRFLDNNISEEK-------ITDIYNRILNGSLDLNS
3egiD           CGVGGNTIQFALTGRVI----AIDIDPVKIALARNNAEVYGIADKIEFICGDFLL-LASFLKADVVFLSP
2br3D           VYNGGSLAWFRDLTKIMGIDCQVIGIDRDLSRCQIPASDMENITLHQGDCSDLTTFEH--LREMAHPLIF
2bh2A           CGMGNFTLPLAT---QAASVVGVEGVPALVEKGQQNARLNGLQNVTFY----HENLEEDVTKQPWAKNGF
2b2cA           GGDGGILREVLKHESV-EKVTMCEIDEMVIDVAKKFLPGMSCGFSHPKLDLFCGDGFEFLKNHKNEFDVI
3c3pB           DGLGCASWWFARAISI-SSRVVIDPDRDNVEHARRLHDNGLIDRVELQVGDPLGIAA----GQRDIDILF
3c6mD           ---GDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCKGDCYQVLIEDCIPVLKRYAKEGEFDYVI
2dpmA           NFNGLYRVNSKN---QFNVPYGRYKNPKIVDEELISAISVYINNNQLEIKVG--DFEKAIVDVRTGDYTH
3bkxA           CGQGDLSAVLADQVGSSGHVTGIDIASPDYGAPLTLGQAWNHLLA-------------------------
3egiB           CGVGGNTIQFALT----GRVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLLASFLKADVLSPPWA
3cjqD           TGSGVLAIAAEK---LGGKALGVDIDPMVLPQAEANAKRNGVRPRFLEGSLEAAL------PFGPFDLLV
3cvoA           SGGSTVVAAELPG----KHVTSVESDRAWARKAWLAANPPAEGTEVDIGPTGDWGHPVSDAKWRSYPDYP
3c6mA           ----------------PKMVTMVEIDQMVIDGCKKYVLDNLKGDCYQVLIEDCIPVLKRYAKEGEFDYVI
3bwmA           AYCGYSAVRMARLLSPGARLITIEINPAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVF
3e05H           AGSASVSIEASNLMPNGRI-FALERNPQYLGFIRDNLKKFVARNVTLV----EAFAPEGLDDLPDPDRVF
3egiA           CGVGGNTIQFALTGRVIA----IDIDPVKIALARNNAEVYGIADKIE----FICGDFLLLASFLKADVVF
2b25A           SGSGGMSLFLSKAVGSQGRVISFEVRKDHHDLAKKNYKHWRDSWKLSHVEEWPDNVDFIHKDISGATFDA
3cjtG           TGSGVLAIAAEK---LGGKALGVDIDPMVLPQAEANAKRNGVRPRF------LEGSLEAALPFGPFDLLV
2as0A           TYTGGFAIHAA--IAGADEVIGIDKSPRAIETAKENAKLNGVEDRKFIVGSAFEEEKLQKKGE-KFDIVV
2bm8A           VYNGGSLAWFRDLTKIMGIDCQVIGIDRDLSRCQIPASDME-NITLHQGDCSDLTTFEHLREMAHPLIFI
3bwcB           --------------GTVEHCDLVDIDGEVEQSKQHFPQISRSLADPRATVRVG----DGLAFVRQTPDNT
2e58B           FGLGYNLAVALKHLWEVNRVEIISFEKELLKEFPILPEPYREIHEFLLERVPEYE-----GERLSLKVLL
1admA           CAHGPFLRAFREAHGTGYRFVGVEIDPKALDLPPWAEGILADFLLWEP----GEAFDLILGNPPYGIVGE
3bwbB           ----------------VEHCDLVDIDGEVEQSKQHFPQISRSLARATVRVGDGLAFVRQTPDNTYVIIDT
2a14A           SGPTIYQVLAACDSFQD--ITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACE---------------
3cjrA           TGSGVLAIAAEK---LGGKALGVDIDPMVLPQAEANAKRNGVRPRF------LEGSLEAALPFGPFDLLV
2bm8G           VYNGGSLAWFRDLTKIMGIDCQVIGIDRD--LSRCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLII
3dxzA           FGMGASLVAMAK-DRPEQDFLGIEVHSPGVGACLASAHEEGLSNLRVMCHDAVEVLHKMIPDNS-LRMVQ
2e5wA           GGDGGAIREVLKHEEVEEVIMYIGIDGGILEKMLSDKHEKGKLIIGDGVKFI--------EENSGFDVII
2bm8B           VYNGGSLAWFRDLTKIMGIDCQVIGIDRDLSRCQIPASDMENITLHQGDCSDLTTFEH--LREMAHPLIF
2aztB           CGTGVDSIMLVEEGFS---VTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEATLDKDVPQEGGFDAVI
3cjtA           TGSGVLAIAAEK---LGGKALGVDIDPMVLPQAEANAKRNGVRPRFLEGSL------EAALPFGPFDLLV
3c0kA           SYTGGFAVSALG---GCSQVVSVDTSQEALDIARQNVELNKLDLSKAEFVRDDVFKLLRTYRDRKFDVIV
2ekmA           SSPHLKFGIAFCEASGKRLIRWDGNDEELIKLAQQTALKIGAGHTFVIYIKNGFPINVLNRIKNVEEVVR
2aowA           GGAGEIDLQILSKVQAQYP--GVCINNEVVEPSAEQIAKYKELVAKISNLENVKFAWHKETSSEYQSRML
2bm9B           VYNGGSLAWFRDLTKIMGQVIGIDRDLSRCQIPASDMENITLHQGDCSDLTTFEH----LREMAHPLIFI
3cc2M           VRKGSARKRRHKAGSKRQGVTRITRRKDIQRVAEERASRTFPNLRVVILIDPNHPAIQNDDDLSWICADD
2b3tA           TGTGAIALALASERP-DCEIIAVDRMPDAVSLAQRNAQHLAIKNIHILQSDWFSA-----LAGQQFAMIV
3bwbA           ----------------VEHCDLVDIDGEVEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVV


                         +         .         .         .         .         *         .:210
query           IDADKESYIAYWEELVPRVRPGGVLLADNVFSHSRVLDPAQTAARVQAIRDFNVHARDDTRVDLVILPIG
3cbgA           IDADKRNYPRYYEIGLNLLRRGGLMVIDNVLWHGKVTEVDPQEAQTQVLQQFNRDLAQDERVRISVIPLG
3dr5A           GQVSPD-LKALVDAAWPLLRRGGALVLADALLDGTIADQTRKDRDTQAARDADEYIRSIEGAHVARLPLG
2avdA           VDADKENCSAYYERCLQLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVYISLLPLG
3c3yA           VDADKPNYIKYHERLMKLVKVGGIVAYDNTLWGGTVAQPESEVPDREAVIELNKLLAADPRIEIVHLPLG
2br5A           IDNAHANTFNIMKWAVDHLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRDV------------------
2br5C           IDNAHANTFNIMKWAVDHLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRDV------------------
3duwA           IDADKQNNPAYFEWALKLSRPGTVIIGDNVVREGEVIDNTSNDPRVQGIRRFYELIAAEPRVSATALQGY
3c3pC           DCDVF--NGADVLERNRCLAKNALLI---------AVNALRRGLR-----EFNHHLSRRRDFFTTIVPVG
2admA           WKGKYNLYGAFLEKAVRLLKPGGVL----VFVVPATWLVLEDFALLREFLAREGKTSVYYLGEV------
3a25A           MGYVV-RTHEFIPKALSIAKDGAIIYHNTVPEKLMPREPFETFKRITKEYGYDVEKLNELKI--------
3eeyB           FNTRPETTIQALSKAMELLVTGGII---------------------------------------------
3c6kA           NDSTWEFLRLILDLSMKVLKQDGKYTQGNCVNLTEALSLYEEQLG----RLYCPVEFSKEIVCVPSYLEL
3eeyA           FNLRPETTIQALSKAMELLVTGGII---------------------------------------------
2br4A           IDDAHANTFIMKWAVDHLLEEGDYFIIEDMIPYWYRYAP---QLFSEYLGAFRDVLSMDMLYANASSQLD
3c3pA           IDICDVFNGADVLERNRCLAKNALLIAVNALRR-------------GALREFNHHLSRRRDFFTTIVPVG
1aqiA           YKKKYNLYGAFLEKAVRLLKPGGVLV--------------------------------------------
3eeyI           FNLRPETTIQALSKAMELLVTGGII---------------------------------------------
1aqjB           LYKKAFSTWKGKYNLGAFLEKAVRLLKPGGVLVFVVPATWLVLEDFALLREFLAR---------------
2cl5B           HWKDRYLPDTLLLEKCGLLRKGTVLL--------------------------------------------
3dulB           IDADKQNNPAYFEWALKLSRPGTVIIGDNV--------VREGEVIIRRFYELIAAEPRVSATA--LQTVG
2br5F           DNAHANTFNIMKWAVDHLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRD-------------------
1cmvB           GNSVDA---LYIRERLPKLRYDKQLVG-------------------------------------------
2br5D           DNAHANTFNIMKWAVDHLLEEGDYFI--------------------------------------------
2br3A           IDDAHANTFIMKWAVDHLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRDV---LSMDMLYANASSQLD
3c6mB           NDSTWEFLRLILDLSMKVLKQDGKYF---TQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLEL
2an3A           ERQLRARVKRVLPIDVHQPQPLG-----------------------------------------------
1eizA           SGTAMYLVELALEMCRDVLAPGGSFV--------------------------------------------
2br3F           IDAHANTFNIMKWAVDHLLEEGDYFI---IEDMIPYWYRYAPQLFSEYLGAFRDVLSMDMLYANASSQLD
3eeyG           FNLRPETTIQALSKAMELLVTGGII---------------------------------------------
1aqjA           VKD-------------------------------------------------------------------
3c6kD           NDSTWEFLRLILDLSMKVLKQDGKYFGNCVNLTEALSLYEEQLGRLCPVEFSKEIVCVPS------YLEL
3dulA           IDADKQNNPAYFEWALKLSRPGTVIIGDNVVRIRRFYELIAAEPRVSATALQTVGSKGYDGF--------
1dctA           EGGSLRGIDDPRGKLFYEYIRILKQKKPIFFLAENVKGMMAQRHNKAVQEFIQEFDNAGYDVHIILLNAN
1dl5A           VTVGVD---EVPETWFTQLKEGGVIVPINLKLSRRQPAFLFKKKDPYLVGNY------------------
3e05C           IGGSGGMLEEIIDAVDRRLKSEGVIVLNAVTLDTLTKAVEFLEDHGYMVEVACVNVAKTKGTEYKMFESH
3dxyA           LNKRRIVQVPFAELVKSKLQLGGVF---------------------------------------------
3bwyA           HWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGA--PDFLAHVRGSSCFECTHYQSFLEYREVVDGLEK
3ckkA           FLFPDIISPTLLAEYAYVLRVGGLVY--------------------------------------------
1eg2A           ----------------------------------------------------------------------
2dulA           ANRLMAERHRYF----------------------------------------------------------
2cl5A           HWKDRYLPDTLLLEKCGLLRKGTLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGL-----
3eeyF           FNLRPETTIQALSKAMELLVTGGII---------------------------------------------
3dxxA           LNKRRIVQVPFAELVKSKLQLGGVF---------------------------------------------
3eeyC           FNLRPETTIQALSKAMELLVTGGII---------------------------------------------
2d16A           ENPVVDGKAANKIETDEQKKERRELV--------------------------------------------
3c6kB           NDSTWEFLRLILDLSMKVLKQDGKYF---TQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLEL
2br3B           IDAHANTFNIMKWAVDHLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRDVLSM---------------
3e05F           IGGSGGMLEEIIDAVDRRLKSEGVIV--------------------------------------------
2an4B           ----------------------------------------------------------------------
1dusA           IRAGKEVLHRIIEEGKELLKDNGEIW--------------------------------------------
2ar0B           --TNPPFGSAAGTNITRTFVHPTSNKQLCFQHIIETLHP-------------------------------
2cmgA           CLQ--EPDIHRIDGLKRMLKEDGVFI--------------------------------------------
2b25B           VALDMLNPHVTLPVFYPHLKHGGVCA--------------------------------------------
2b9eA           SGVALAGFQQRALCHALTFPSLQRLV--------------------------------------------
2br5E           DNAHANTFNIMKWAVDHLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRDVLSMDMLYANA--------
2br4F           DDAHANTFNIMKWAVDHLLEEGDY----------------------------------------------
2an3B           ----------------------------------------------------------------------
3c6kC           NDLTAVPISLILDLSMKVLKQDGKYFT-------------------------------------------
3b3gA           YMLFNERMLESYLHAKKYLKPSGN----------------------------------------------
1booA           I---------------------------------------------------------------------
3egiD           PWGAETFDIRTSPDGFEIFRLSKKI---------------------------------------------
2br3D           IDDAHANTFIMKWAVDHLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRDVLSM---------------
2bh2A           DKVLLDPARAGAAGVMQQIPIRIVYVSCNPATLAR-----------------------------------
2b2cA           IT-----DSSYYELLRDALKEDGILS--------------------------------------------
3c3pB           DCD--VFNGADVLERNRCLAKNALLIAVNALRR-----------------EFNHHLSRRRDFFTTIVPVG
3c6mD           NTSTWEFLRLILDLSMKVLKQDGKYF---TQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLEL
2dpmA           EGFSFADQVRLRDAFKRLSDTGAYVM---------LSNSSSALVE-ELYKDFNIHYVEGKISEIIV----
3bkxA           ----------------------------------------------------------------------
3egiB           ETFDIRTSPDGFEIFRLSKKITNNI---------------------------------------------
3cjqD           ANLYAELHAALAPRYREALVPGGALLTGILKDRAPLV---------------------------------
3cvoA           LAVGRFRVGCALATAFSITRPVTLLDDYSQRRWQHQVEEFLGAPLIGRLAAFQVEPQPIPPGSLQLIR--
3c6mA           NDTTWEFLRLILDLSMKVLKQDGKYF---TQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLEL
3bwmA           LDHDRYLPDTLLLEECGLLRKGTVLLADNVICPGA--PDFLAHVRGSSCFECTHYQSFLEYREVVDGLEK
3e05H           IGGSGGMLEEIIDAVDRRLKSEGVIVL-------------------------------------------
3egiA           LSPPWATAETFDIRTSPDGRLSKKITNNIVYFL-------------------------------------
2b25A           VALDMLNPHVTLPVFYPHLKHGGVCA--------------------------------------------
3cjtG           ANLYAELHAALAPRYREALVPGGALLTGILKDRAPLVREAMAGAGFRPLEEAAEG---------------
2as0A           LDPGLRAYFNVNFAGLNLVKDGGILV--------------------------------------------
2bm8A           DNAHANTFNIMKWAVDHLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRDVLSMDMLYANA--------
3bwcB           YDVVIIDTEAFYKDVLRILKPDGIC----CNQGESIWLDLELIEKSRFIRETGFASVQY-----------
2e58B           GDARKRIKEVENFKADAVFHDAFSPYKNPELWTLDFLS--------------------------------
1admA           APIHVFKAVKDLYKKAFSTWKGKYNLYGAFLEK-------------------------------------
3bwbB           TDPAGLFGEAFYKDVLRILKPDGICC--------------------------------------------
2a14A           ----------------------------------------------------------------------
3cjrA           ANLYAELHAALAPRYREALVPGGALLTGILKDRAPLV---------------------------------
2bm8G           DNAHANTFNIMKWAVDHLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRD--VLSMDMLYANASSQLDR
3dxzA           LFFRRIVQVPFAELVKSKLQLGGVFH--------------------------------------------
2e5wA           VDSEMLFSEEFYKNAYRALNDPGIY----VTQAGSVYLFTDEFLTAYRKMRKVFDKVYYYSFPVIGYASP
2bm8B           IDNHANTFNIMKWAVDHLLEEGDYFI--------------------------------------------
2aztB           CLGDQSEHRLALKNIASMVRAGGLLV--------------------------------------------
3cjtA           ANLYAELHAALAPRYREALVPGGALLTGILKDRAPLV---------------------------------
3c0kA           DPLGACRGYKDINLAIQLLNEGGILL--------------------------------------------
2ekmA           IFGVVDGYTPLGIETEADIKERKELL--------------------------------------------
2aowA           EKKELQKWDFIHMIQMLYYVKDIPATLKFFH---SLLGT-------------------------------
2bm9B           DNAHANTFNIMKWAVDHLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRDVLSMDML------------
3cc2M           QADRVFRGLTGAGRRNRGLSGKGKGS--------------------------------------------
2b3tA           SNPDEQDPHLQQGDVRFEPLTALVAADSGMADIVHIIEQSR-----------------------------
3bwbA           IIDSKLFGEAFYKDVLRILKPDGICC--------------------------------------------


                         .         .         .         +         .         .         .:280
query           DGFTLARRR
3cbgA           DGMTLALKK
3dr5A           AGLTVVTKA
2avdA           DGLTLAFK-
3c3yA           DGITFCRR-
2br5A           ---------
2br5C           ---------
3duwA           DGFIAVVK-
3c3pC           NGVLLGYR-
2admA           ---------
3a25A           ---------
3eeyB           ---------
3c6kA           WVFYTVWKK
3eeyA           ---------
2br4A           RG-------
3c3pA           NGVLLGYR-
1aqiA           ---------
3eeyI           ---------
1aqjB           ---------
2cl5B           ---------
3dulB           DGFIAVVK-
2br5F           ---------
1cmvB           ---------
2br5D           ---------
2br3A           RG-------
3c6mB           WVFYTVWKK
2an3A           ---------
1eizA           ---------
2br3F           RGV------
3eeyG           ---------
1aqjA           ---------
3c6kD           WVFYTVWKK
3dulA           ---------
1dctA           D--------
1dl5A           ---------
3e05C           NPVYIITAW
3dxyA           ---------
3bwyA           AIYKG----
3ckkA           ---------
1eg2A           ---------
2dulA           ---------
2cl5A           ---------
3eeyF           ---------
3dxxA           ---------
3eeyC           ---------
2d16A           ---------
3c6kB           WVFYTVWKK
2br3B           ---------
3e05F           ---------
2an4B           ---------
1dusA           ---------
2ar0B           ---------
2cmgA           ---------
2b25B           ---------
2b9eA           ---------
2br5E           ---------
2br4F           ---------
2an3B           ---------
3c6kC           ---------
3b3gA           ---------
1booA           ---------
3egiD           ---------
2br3D           ---------
2bh2A           ---------
2b2cA           ---------
3c3pB           NGVLLGYR-
3c6mD           WVFYTVWKK
2dpmA           ---------
3bkxA           ---------
3egiB           ---------
3cjqD           ---------
3cvoA           ---------
3c6mA           WVFYTVWKK
3bwmA           AIYKG----
3e05H           ---------
3egiA           ---------
2b25A           ---------
3cjtG           ---------
2as0A           ---------
2bm8A           ---------
3bwcB           ---------
2e58B           ---------
1admA           ---------
3bwbB           ---------
2a14A           ---------
3cjrA           ---------
2bm8G           GVLR-----
3dxzA           ---------
2e5wA           WAFLVGVKG
2bm8B           ---------
2aztB           ---------
3cjtA           ---------
3c0kA           ---------
2ekmA           ---------
2aowA           ---------
2bm9B           ---------
3cc2M           ---------
2b3tA           ---------
3bwbA           ---------