[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ55030.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2c8mA.bssp"
#ERROR : Can't open dsspfile "2c7iC.bssp"
#ERROR : Can't open dsspfile "2c7iA.bssp"
#ERROR : Can't open dsspfile "2artA.bssp"
#ERROR : Can't open dsspfile "2c8mB.bssp"
#ERROR : Can't open dsspfile "2c7iB.bssp"
#ERROR : Can't open dsspfile "2c7iD.bssp"
#ERROR : Can't open dsspfile "2c8mD.bssp"
#ERROR : Can't open dsspfile "2arsA.bssp"
#ERROR : Can't open dsspfile "2e41A.bssp"
#ERROR : Can't open dsspfile "2e10B.bssp"
#ERROR : Can't open dsspfile "2ddzA.bssp"
#ERROR : Can't open dsspfile "2e5aA.bssp"
#ERROR : Can't open dsspfile "2ejfB.bssp"
#ERROR : Can't open dsspfile "2ejgB.bssp"
#ERROR : Can't open dsspfile "2dxtA.bssp"
#ERROR : Can't open dsspfile "2e41B.bssp"
#ERROR : Can't open dsspfile "2deqB.bssp"
#ERROR : Can't open dsspfile "2ddzE.bssp"
#ERROR : Can't open dsspfile "2ejgA.bssp"
#ERROR : Can't open dsspfile "3efsA.bssp"
#ERROR : Can't open dsspfile "2e65B.bssp"
#ERROR : Can't open dsspfile "3efrA.bssp"
#ERROR : Can't open dsspfile "2dxuB.bssp"
#ERROR : Can't open dsspfile "2eayB.bssp"
#ERROR : Can't open dsspfile "2dveA.bssp"
#ERROR : Can't open dsspfile "2djzA.bssp"
#ERROR : Can't open dsspfile "2djzB.bssp"
#ERROR : Can't open dsspfile "3bboE.bssp"
#ERROR : Can't open dsspfile "2deqA.bssp"
#ERROR : Can't open dsspfile "2e65A.bssp"
#ERROR : Can't open dsspfile "2e64A.bssp"
#ERROR : Can't open dsspfile "2dxuA.bssp"
#ERROR : Can't open dsspfile "2dzcB.bssp"
#ERROR : Can't open dsspfile "2ej9A.bssp"
#ERROR : Can't open dsspfile "2e1hA.bssp"
#ERROR : Can't open dsspfile "2eayA.bssp"
#ERROR : Can't open dsspfile "2e10A.bssp"
#ERROR : Can't open dsspfile "2dzcA.bssp"

## Summary of PDB Search
:236
    7e-31  16%  2c8mA  [x.x.x] LIPOATE-PROTEIN LIGASE A
    1e-30  15%  2c7iC  [x.x.x] PUTATIVE LIPOATE PROTEIN LIGASE
    4e-30  16%  2c7iA  [x.x.x] PUTATIVE LIPOATE PROTEIN LIGASE
    2e-29  16%  2artA  [x.x.x] LIPOATE-PROTEIN LIGASE A
    5e-29  16%  2c8mB  [x.x.x] LIPOATE-PROTEIN LIGASE A
    6e-29  16%  2c7iB  [x.x.x] PUTATIVE LIPOATE PROTEIN LIGASE
    1e-28  15%  2c7iD  [x.x.x] PUTATIVE LIPOATE PROTEIN LIGASE
    2e-27  15%  2c8mD  [x.x.x] LIPOATE-PROTEIN LIGASE A
    1e-25  16%  2arsA  [x.x.x] LIPOATE-PROTEIN LIGASE A
    9e-25  17%  2e41A  [x.x.x] BIOTIN--[ACETYL-COA-CARBOXYLASE] LIGASE
    1e-24  18%  2e10B  [x.x.x] BIOTIN PROTEIN LIGASE
    3e-24  13%  2ddzA  [x.x.x] 190AA LONG HYPOTHETICAL PROTEIN
    1e-23  16%  2e5aA  [x.x.x] LIPOYLTRANSFERASE 1
    3e-23  15%  2ejfB  [x.x.x] 235AA LONG HYPOTHETICAL BIOTIN--[ACETYL-COA-
    4e-23  18%  2ejgB  [x.x.x] 235AA LONG HYPOTHETICAL BIOTIN--[ACETYL-COA-
    7e-23  18%  2dxtA  [x.x.x] BIOTIN--[ACETYL-COA-CARBOXYLASE] LIGASE
    7e-23  18%  2e41B  [x.x.x] BIOTIN--[ACETYL-COA-CARBOXYLASE] LIGASE
    1e-22  18%  2deqB  [x.x.x] 235AA LONG HYPOTHETICAL BIOTIN--[ACETYL-COA-
    2e-22  11%  2ddzE  [x.x.x] 190AA LONG HYPOTHETICAL PROTEIN
    2e-22  18%  2ejgA  [x.x.x] 235AA LONG HYPOTHETICAL BIOTIN--[ACETYL-COA-
    3e-22  11%  3efsA  [x.x.x] BIOTIN [ACETYL-COA-CARBOXYLASE] LIGASE
    6e-22  19%  2e65B  [x.x.x] BIOTIN--[ACETYL-COA-CARBOXYLASE] LIGASE
    8e-22  11%  3efrA  [x.x.x] BIOTIN [ACETYL-COA-CARBOXYLASE] LIGASE
    1e-21  17%  2dxuB  [x.x.x] BIOTIN--[ACETYL-COA-CARBOXYLASE] LIGASE
    1e-21  13%  2eayB  [x.x.x] BIOTIN [ACETYL-COA-CARBOXYLASE] LIGASE
    2e-21  19%  2dveA  [x.x.x] BIOTIN PROTEIN LIGASE
    3e-21  18%  2djzA  [x.x.x] 235AA LONG HYPOTHETICAL BIOTIN-[ACETYL-COA-
    4e-21  18%  2djzB  [x.x.x] 235AA LONG HYPOTHETICAL BIOTIN-[ACETYL-COA-
    4e-21  15%  3bboE  [x.x.x] RIBOSOMAL PROTEIN L2
    8e-21  18%  2deqA  [x.x.x] 235AA LONG HYPOTHETICAL BIOTIN--[ACETYL-COA-
    1e-20  19%  2e65A  [x.x.x] BIOTIN--[ACETYL-COA-CARBOXYLASE] LIGASE
    1e-20  18%  2e64A  [x.x.x] BIOTIN--[ACETYL-COA-CARBOXYLASE] LIGASE
    2e-20  18%  2dxuA  [x.x.x] BIOTIN--[ACETYL-COA-CARBOXYLASE] LIGASE
    7e-20  20%  2dzcB  [x.x.x] BIOTIN--[ACETYL-COA-CARBOXYLASE] LIGASE
    9e-20  14%  2ej9A  [x.x.x] PUTATIVE BIOTIN LIGASE
    9e-20  19%  2e1hA  [x.x.x] 235AA LONG HYPOTHETICAL BIOTIN-[ACETYL-COA-
    4e-19  12%  2eayA  [x.x.x] BIOTIN [ACETYL-COA-CARBOXYLASE] LIGASE
    1e-18  20%  2e10A  [x.x.x] BIOTIN PROTEIN LIGASE
    6e-09  17%  2dzcA  [x.x.x] BIOTIN--[ACETYL-COA-CARBOXYLASE] LIGASE
:236

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxELLYHWLGESPVPYMEGWELQRQLHKRRVADQVPDTVLLLEHEPVYTAGKRTGPWDRPLTDPGAP
2c8mA           -------------ETPGNTRMSLAYDEAIYRSFQYGD-KPILRFYRHDRSVIIGYFQVAEEEVDLDYGIM
2c7iC           ---------------PGNTRMSLAYDEAIYRSFQYGD-KPILRFYRHDRSVIIGYFQVAEEEVYMKNGIM
2c7iA           ---------------PGNTRMSLAYDEAIYRSFQYGD-KPILRFYRHDRSVIIGYFQVAEEEVDLDYGIM
2artA           ---------------PGNTRMSLAYDEAIYRSFQYGD-KPILRFYRHDRSVIIGYFQVAEEEVDLDYGIM
2c8mB           --------------TPGNTRMSLAYDEAIYRSFQYGD-KPILRFYRHDRSVIIGYFQVAEEDYMKKNGIM
2c7iB           --------------TPGNTRMSLAYDEAIYRSFQYGD-KPILRFYRHDRSVIIGYFQVAEEDYMKKNGIM
2c7iD           ---------------PGNTRMSLAYDEAIYRSFQYGD-KPILRFYRHDRSVIIGYFQVAEEEVDLYMGIM
2c8mD           -----GRLLLLET--PGNTRMSLAYDEAIYRSFQYGD-KPILRFYRHDRSVIIGYFQVAEEEVDLDYGIM
2arsA           --------------ETPGNTRSLAYDEAIYRSFQYGD-KPILRFYRHDRSVIIGYFQVAEEDLDYKKNGI
2e41A           --------------------------------------LKTSIIVIYFQEITST-NEFAKTSYLEEGTVI
2e10B           --------------------------------------------MLGLKTSIIGRRVIYFQEFAKTSYLE
2ddzA           --------------------------------------YDGSAIRSHWAYRNFGILGDSLVVFRGKCNVK
2e5aA           ----------------NDVYHNLAVEDWIH-DHMNLEGKPVLFLWRNSPTVVIGRHQNPWLNLMREEGVK
2ejfB           --------------------------------------LKTSIIVIYFQEITST-NEFAKTSYLEEGTVI
2ejgB           --------------------------------------LKTSIIVIYFQEITST-NEFAKTSYLEEGTVI
2dxtA           --------------------------------------LKTSIIVIYFQEITST-NEFAKTSYLEEGTVI
2e41B           --------------------------------------LKTSIIVIYFQEITST-NEFAKTSYLEEGTVI
2deqB           --------------------------------------LKTSIIVIYFQEITST-NEFAKTSYLEEGTVI
2ddzE           -----------------SMELLIIKERRIDYDGSAIRSHWAYRNFILGDSLVVFRGKCNV---------K
2ejgA           --------------------------------------LKTSIIVIYFQEITST-NEFAKTSYLEEGTVI
3efsA           --------------------------------------------LIWLKEVDSTKEWNVSYGTALVADRQ
2e65B           -------------------------------------------RVIYFQEITST-NEFAKTSYLEEGTVI
3efrA           -------------------------------------------------------------------DRQ
2dxuB           --------------------------------------LKTSIIVIYFQEITST-NEFAKTSYLEEGTVI
2eayB           --------------------------------------------LIWLKEVDST-QERLKEWNVSYGTAL
2dveA           --------------------------------------LKTSIIVIYFQEITST-NEFAKTSYLEEGTVI
2djzA           --------------------------------------LKTSIIVIYFQEITST-NEFAKTSYLEEGTVI
2djzB           --------------------------------------LKTSIIVIYFQEITST-NEFAKTSYLEEGTVI
3bboE           ------------------------------------------------KTSTSSTRKSNPRNNLISGQRC
2deqA           --------------------------------------LKTSIIVIYFQEITST-NEFAKTSYLEEGTVI
2e65A           --------------------------------------LKTSIIVIYFQEITST-NEFAKTSYLEEGTVI
2e64A           -------------------------------------------RVIYFQEITST-NEFAKTSYLEEGTVI
2dxuA           --------------------------------------LKTSIIVIYFQEITST-NEFAKTSYLEEGTVI
2dzcB           -------------------------------------------RVIYFQEITST-NEFAKTSYLEEGTVI
2ej9A           ----------------------------------------------------------------------
2e1hA           --------------------------------------LKTSIIVIYFQEITST-NEFAKTSYLEEGTVI
2eayA           --------------------------------------------LIWLKEVDSTQ-ERLKEWNVSYGTAL
2e10A           --------------------------------------LKTSIIVIYFQEITST-NEFAKTSYLEEGTVI
2dzcA           --------------------------------------LKTSIIVIYFQEITST-NEFAKTSYLEEGTVI


                         .         .         *         .         .         .         .:140
query           VIDIDRGGKITWHGPGQLTAYPIVKLPAPLDVVAYVRMLEEAIIRVIGDFGLSGMRVEGRTGVWLAAAPD
2c8mA           LARRYTGGGAVYHDLGDLNFSVVRSSDDM-DITSMFRTMNEAVVNSLRILGLDA-RPGELNDVSIP----
2c7iC           LARRYTGGGAVYHDLGDLNFSVVRSSDDM-DITSMFRTMNEAVVNSLRILGLDA-RPGELNDVS------
2c7iA           LARRYTGGGAVYHDLGDLNFSVVRSSDDM-DITSMFRTMNEAVVNSLRILGLDA-RPGELNDVS------
2artA           LARRYTGGGAVYHDLGDLNFSVVRSSD-DMDITSMFRTMNEAVVNSLRILGLDA-RPGELNDVSIP----
2c8mB           LARRYTGGGAVYHDLGDLNFSVVRSSDDM-DITSMFRTMNEAVVNSLRILGLDA-RPGELNDVSI-----
2c7iB           LARRYTGGGAVYHDLGDLNFSVVRSSDDM-DITSMFRTMNEAVVNSLRILGLDA-RPGELNDVS------
2c7iD           LARRYTGGGAVYHDLGDLNFSVVRSSDDM-DITSMFRTMNEAVVNSLRILGLDA-RPGELNDVS------
2c8mD           LARRYTGGGAVYHDLGDLNFSVVRSSDDM-DITSMFRTMNEAVVNSLRILGLDA-RPGELNDVSIP----
2arsA           LARRYTGGGAVYHDLGDLNFSVVRSSDDDI----TSFRTNEAVVNSLRILGLDA-RPGELNDVSIPVNKK
2e41A           VADHGALNRKWESPEGGLWLSIVLSPKPQKDLPKIVFLGAVGVVETLKEFSIDG-RIKWPNDVLV-----
2e10B           EGTVIVADKQTMSPEGGLWLSIVLSPKPQKDLPKIVFLGAVGVVETLKEFSIDG-RIKWPNDVLV-----
2ddzA           VEEMVDIEDLRLRIKGDDMVHYILELPDILLASSLQKLLIARLVELLWNYGIEASR--RGDDIYVN----
2e5aA           LARRRSGGGTVYHDMGNINLTFFTTK-KKYDRMENLKLVVRALKAVHPHLDVQATKRFDLLLD-------
2ejfB           VADHGALNRKWESPEGGLWLSIVLSPKPQKDLPKIVFLGAVGVVETLKEFSIDG-RIKWPNDVLV-----
2ejgB           VADKGALNRKWESPEGGLWLSIVLSPKVPQDLPKIVFLGAVGVVETLKEFSIDG-RIKWPNDVLV-----
2dxtA           VADHGRLNRKWESPEGGLWLSIVLSPKPQKDLPKIVFLGAVGVVETLKEFSIDG-RIKWPNAVLV-----
2e41B           VADHGALNRKWESPEGGLWLSIVLSPKVPQDLPKIVFLGAVGVVETLKEFSIDG-RIKWPNDVLV-----
2deqB           VADHGRLNRKWESPEGGLWLSIVLSPKPQKDLPKIVFLGAVGVVETLKEFSIDG-RIKWPNDVLV-----
2ddzE           VEEMVDIEDLRLRKEGDDMVHYILELFDILLASSLQKLLIARLVELLWNYGIEASR--RGDDIYV-----
2ejgA           VADHGALNRKWESPEGGLWLSIVLSPKPQKDLPKIVFLGAVGVVETLKEFSIDG-RIKWPNDVLV-----
3efsA           TKGRGRLGRKWLSQEGGLYFSFLLNPKEFENLLQLPLVLGLSVSEALEEITEIPFSLKWPNDVY------
2e65B           VADKQTMG--HGSPEGGLWLSIVLSPKPQKDLPKIVFLGAVGVVETLKEFSIDG-RIKWPNAVLV-----
3efrA           TKGRGGLGRKWLSQEGGLYFSFLLNPKEFENLLQLPLVLGLSVSEALEEITEIPFSLKWPNDVY------
2dxuB           VADHGALNRKWESPEGGLWLSIVLSPKVPQDLPKIVFLGAVGVVETLKEFSIDG-RIKWPNDVLV-----
2eayB           VADR------QTKQEGGLYFSFLLNPKEFENLLQLPLVLGLSVSEALEEITEIPFSLKWPNDVYF-----
2dveA           VADHGRLNAKWESPEGGLWLSIVLSPKVPKDLPKIVFLGAVGVVETLKEFSIDG-RIKWPNDVLV-----
2djzA           VADHGRLNRKWESPEGGLWLSIVLSPKVPKDLPKIVFLGAVGVVETLKEFSIDG-RIKWPNDVLV-----
2djzB           VADHGRLNRKWESPEGGLWLSIVLSPKVPKDLPKIVFLGAVGVVETLKEFSIDG-RIKWPNDVLV-----
3bboE           GKGRNARGIITARGGGHKRLYRKIDFRNEKDIYGKIVTIEYDPNRNAYICLIHYGDGEKRYILH---PRG
2deqA           VADHGRLNRKWESPEGGLWLSIVLSPKVPKDLPKIVFLGAVGVVETLKEFSIDG-RIKWPNDVLV-----
2e65A           VADKQTMGE---SPEGGLWLSIVLSPKVPQDLPKIVFLGAVGVVETLKEFSIDG-RIKWPNAVLV-----
2e64A           VADKQTME----SPEGGLWLSIVLSPKPQKDLPKIVFLGAVGVVETLKEFSIDG-RIKWPNDVLV-----
2dxuA           VADHGALNRKWESPEGGLWLSIVLSPKPQKDLPKIVFLGAVGVVETLKEFSIDG-RIKWPNDVLV-----
2dzcB           VADKQTMG----SPEGGLWLSIVLSPKVPQDLPKIVFLGAVGVVETLKEFSIDG-RIKWPNDVLV-----
2ej9A           -----RWGRVWYSDEGGLYFSMVLDSKLY-NPKVINLLVPICIIEVLKNYVDKELGLKFPNDIMVKVNDN
2e1hA           VADKQTMG--HESPEGGLWLSIVLSPKPQKDLPKIVFLGAVGVVETLKEFSIDG-RIKWPNDVL------
2eayA           VADRQTKEGGLY---FSFLLNPKE----FENLLQLPLVLGLSVSEALEEITEIPFSLKWPNDVYF-----
2e10A           VADKQTMG---ESPEGGLWLSIVLSPKK------IVFLGAVGVVETLKEFSIDG-RIKWPNDVLVN----
2dzcA           VADKQTMG----SPEGGLWLSIVLSPKVPQDLPKIVFLGAVGVVETLKEFSIDGRIKW-PNDVLVNYKKI


                         +         .         .         .         .         *         .:210
query           RGLPERKIAAIGCRIAKGVTMHGFALNCNNDLSWFDRIVPCGIRDAGVTSLTAELDRTVGVGDILEATEH
2c8mA           ----VNKKTDIMAGEKKGAKLWHAAMLVHTDLDMLSAVLKERVAN-------VTDFVDVSIDEVRNALIR
2c7iC           --IPVNKKTDIMAGEKKGAKLWHAAMLVHTDLDMLSAVLRE-------RVANVTDFVDVSIDEVRNALIR
2c7iA           --IPVNKKTDIMAGEKKGAKLWHAAMLVHTDLDMLSAVLKRE------RVANVTDFVDVSIDEVRNALIR
2artA           ----VNKKTDIMAGEKKGAKLWHAAMLVHTDLDMLSAVLKVPSTRERVANVTDFVD--VSIDEVRNALIR
2c8mB           ---PVNKKTDIMAGEKKGAKLWHAAMLVHTDLDMLSAVLKST--RERVANVTDFVDVS--IDEVRNALIR
2c7iB           --IPVNKKTDIMAGEKKGAKLWHAAMLVHTDLDMLSAVLER------VANVTDFVDVS--IDEVRNALIR
2c7iD           --IPVNKKTDIMAGEKKGAKLWHAAMLVHTDLDMLSAVLERVANVTDFVDVSID--------EVRNALIR
2c8mD           ----VNKKTDIMAGEKKGAKLWHAAMLVHTDLDMLSAVLKRE------RVANVTDFVDVSIDEVRNALIR
2arsA           TDIAEKKIGAAGAR--KGAKLHAALVHTDLDLSAVLKSTRE-----RVANVTDFVDVS--IDEVRNALIR
2e41A           ---NYKAIAGVLVEGKGDKIVLGIGLNVNNKV------------PNGATSMKLELGSEVPLLSVFRSLIT
2e10B           ---NYKKIAGVLVEGKGDKIVLGIGLNVNNKV------------PNGATSMKLELGSEVPLLSVFRSLIT
2ddzA           ----GRKLSISIATVSPVSIKIHIGLNVKTVGVPPG-VDAIGLEELGID---------------------
2e5aA           ---GQFKISGTASKIGRNAAYHHCTLLCGTDGTFLSSLLYQGIRSNATASTPAEKDPTLTCEVVINAVAT
2ejfB           ---NYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKL------------ELGSEVPLLSVFRSLIT
2ejgB           ---NYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNG------------ATSMKLELGSEVPLLSVFRSLIT
2dxtA           ---NYKKIAGVLVEGKGDKIVLGIGLNVNNKV------------PNGATSMKLELGSEVPLLSVFRSLIT
2e41B           ---NYKAIAGVLVEGKGDKIVLGIGLNVNNK------------VPNGATSMKLELGSEVPLLSVFRSLIT
2deqB           ---NYKGIAGVLVEGKGDKIVLGIGLNVNNK------------VPNGATSMKLELGSEVPLLSVFRSLIT
2ddzE           ---NGRKLSISIATVSPVSIKIHIGLNVKTVGVPPG-VDAIGLEELGID---------------------
2ejgA           ---NYKKIAGVLVEGKGDKIVLGIGLNVNNKV------------PNGATSMKLELGSEVPLLSVFRSLIT
3efsA           --FQEKKVSGVLRELSKDKLIVGIGINVNQREIPEEIKDR-------ATTLYEITGKDWDRKEVLLKVLK
2e65B           ---NYKKIAGVLVEGKGDKIVLGIGLNVNNK------------VPNGATSMKLELGSEVPLLSVFRSLIT
3efrA           --FQEKKVSGVLRELSKDKLIVGIGINVNQREIPEEIKDR-------ATTLYEITGKDWDRKEVLLKVLK
2dxuB           ---NYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLEVFRSLITNLDRLYLNFLKNPDILNLVRD
2eayB           ---QEKKVSGVLCELSKDKLIVGIGINVNQREIPEEIKDR-------ATTLYEITGKDWDRKEVLLKVLK
2dveA           ---NYKKIAGVLVEGKGDKIVLGIGLNVNNK------------VPNGATSMKLELGSEVPLLSVFRSLIT
2djzA           ---NYKAIAGVLVEGKGDKIVLGIGLNVNNKV------------PNGATSMKLELGSEVPLLSVFRSLIT
2djzB           ---NYKAIAGVLVEGKGDKIVLGIGLNVNNKV------------PNGATSMKLELGSEVPLLSVFRSLIT
3bboE           AIIGDTIVSGTEVPIKMG---NALPLTDMPLGTAIHNI--------------------------------
2deqA           ---NYKGIAGVLVEGKGDKIVLGIGLNVNNK------------VPNGATSMKLELGSEVPLLSVFRSLIT
2e65A           ---NYKKIAGVLVEGKGDKIVLGIGLNVNNKV------------PNGATSMKLELGSEVPLLSVFRSLIT
2e64A           ---NYKAIAGVLVEGKGDKIVLGIGLNVNNKV------------PNGATSMKLELGSEVPLLSVFRSLIT
2dxuA           ---NYKKIAGVLVEGKGDKIVLGIGLNVNNKV------------PNGATSMKLELGSEVPLLSVFRSLIT
2dzcB           ---NYKKIAGVLVEGKGDKIVLGIGLNVNNKV------------PNGATSMKLELGSEVPLLSVFRSLIT
2ej9A           ----YKKLGGILTELTDDYMIIGIGINVNNQIR--------NEIREIAISLKEITGKELDKVEILSNFLK
2e1hA           --VNYKGIAGVLVE---GKIVLGIGLNVNNKV------------PNGATSMKLELGSEVPLLSVFRSLIT
2eayA           ---QEKKVSGVLCELSKDKLIVGIGINVNQREIPEEIKDR-------ATTLYEITGKDWDRKEVLLKVLK
2e10A           ----YKKIAGVLVE---GKIVLGIGLNVNNKV------------PNGATSMKLELGSEVPLLSVFRSLIT
2dzcA           AGV----------LVEGDKIVLGIGLNVNNKV------------PNGATSMKLELGSEVPLLSVFRSLIT


                         .         .         .         +         .         .         .:280
query           HLAAVLGASSYRRIAGWPVLPEFxxx
2c8mA           GFSETLH-------------------
2c7iC           GFSETLH-------------------
2c7iA           GFSETLH-------------------
2artA           GFSETLH-------------------
2c8mB           GFSETLH-------------------
2c7iB           GFSETLH-------------------
2c7iD           GFSETLH-------------------
2c8mD           GFSETLH-------------------
2arsA           GFSETLH-------------------
2e41A           NLDRLYL-------------------
2e10B           NLDRLYL-------------------
2ddzA           --------------------------
2e5aA           EYATSHQ-------------------
2ejfB           NLDRLYL-------------------
2ejgB           NLDRLYL-------------------
2dxtA           NLDRLYL-------------------
2e41B           NLDRLYL-------------------
2deqB           NLDRLYL-------------------
2ddzE           --------------------------
2ejgA           NLDRLYL-------------------
3efsA           RISENL--------------------
2e65B           NLDRLYL-------------------
3efrA           RISENL--------------------
2dxuB           NMILGVRVKSFEGIA-----------
2eayB           RISENL--------------------
2dveA           NLDRLYL-------------------
2djzA           NLDRLYL-------------------
2djzB           NLDRLYL-------------------
3bboE           --------------------------
2deqA           NLDRLYL-------------------
2e65A           NLDRLYL-------------------
2e64A           NLDRLYL-------------------
2dxuA           NLDRLYL-------------------
2dzcB           NLDRLYL-------------------
2ej9A           TFESYLEKLKNKEIDDYEILKKY---
2e1hA           NLDRLYL-------------------
2eayA           RISENL--------------------
2e10A           NLDRLYL-------------------
2dzcA           NLDRLYLNFLKNPMDIL---------