[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ55194.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2a0nA.bssp"
#ERROR : Can't open dsspfile "3c4uA.bssp"
#ERROR : Can't open dsspfile "2e7fA.bssp"
#ERROR : Can't open dsspfile "3cepA.bssp"
#ERROR : Can't open dsspfile "1dquA.bssp"
#ERROR : Can't open dsspfile "2ekcB.bssp"
#ERROR : Can't open dsspfile "2bznB.bssp"
#ERROR : Can't open dsspfile "3bofB.bssp"
#ERROR : Can't open dsspfile "3dg9A.bssp"
#ERROR : Can't open dsspfile "2a7rA.bssp"
#ERROR : Can't open dsspfile "3bolB.bssp"
#ERROR : Can't open dsspfile "2a7rB.bssp"
#ERROR : Can't open dsspfile "2bznC.bssp"
#ERROR : Can't open dsspfile "2c6qG.bssp"
#ERROR : Can't open dsspfile "2bznA.bssp"
#ERROR : Can't open dsspfile "1ad1B.bssp"
#ERROR : Can't open dsspfile "2a7nA.bssp"
#ERROR : Can't open dsspfile "3bolA.bssp"
#ERROR : Can't open dsspfile "1a50A.bssp"
#ERROR : Can't open dsspfile "1ad4B.bssp"
#ERROR : Can't open dsspfile "1b3oB.bssp"
#ERROR : Can't open dsspfile "3dg6A.bssp"
#ERROR : Can't open dsspfile "2bleA.bssp"
#ERROR : Can't open dsspfile "2cffA.bssp"
#ERROR : Can't open dsspfile "1bksA.bssp"
#ERROR : Can't open dsspfile "1beuA.bssp"
#ERROR : Can't open dsspfile "2e09A.bssp"
#ERROR : Can't open dsspfile "2a1yA.bssp"
#ERROR : Can't open dsspfile "3b8iA.bssp"
#ERROR : Can't open dsspfile "2bwgB.bssp"
#ERROR : Can't open dsspfile "1chrA.bssp"
#ERROR : Can't open dsspfile "2a7rC.bssp"
#ERROR : Can't open dsspfile "3b8iC.bssp"
#ERROR : Can't open dsspfile "3b8iE.bssp"
#ERROR : Can't open dsspfile "2c6qA.bssp"
#ERROR : Can't open dsspfile "2bznD.bssp"
#ERROR : Can't open dsspfile "2c6qB.bssp"
#ERROR : Can't open dsspfile "1ak5A.bssp"
#ERROR : Can't open dsspfile "2bwgA.bssp"
#ERROR : Can't open dsspfile "3dz1A.bssp"
#ERROR : Can't open dsspfile "1b3oA.bssp"
#ERROR : Can't open dsspfile "1bwkA.bssp"
#ERROR : Can't open dsspfile "3dipB.bssp"
#ERROR : Can't open dsspfile "3ct2A.bssp"
#ERROR : Can't open dsspfile "3cb3B.bssp"
#ERROR : Can't open dsspfile "2clfA.bssp"
#ERROR : Can't open dsspfile "2agkA.bssp"
#ERROR : Can't open dsspfile "2bwgD.bssp"
#ERROR : Can't open dsspfile "3cu2A.bssp"
#ERROR : Can't open dsspfile "2a7rD.bssp"
#ERROR : Can't open dsspfile "2dzwB.bssp"
#ERROR : Can't open dsspfile "2dzpA.bssp"
#ERROR : Can't open dsspfile "3eb2B.bssp"
#ERROR : Can't open dsspfile "2dzuB.bssp"
#ERROR : Can't open dsspfile "2csbA.bssp"
#ERROR : Can't open dsspfile "2dzwA.bssp"
#ERROR : Can't open dsspfile "1dbtB.bssp"
#ERROR : Can't open dsspfile "2e28A.bssp"
#ERROR : Can't open dsspfile "3eisB.bssp"
#ERROR : Can't open dsspfile "1bwlA.bssp"
#ERROR : Can't open dsspfile "3b8iB.bssp"
#ERROR : Can't open dsspfile "2e09B.bssp"
#ERROR : Can't open dsspfile "2dzsB.bssp"
#ERROR : Can't open dsspfile "2dztB.bssp"
#ERROR : Can't open dsspfile "3cb3A.bssp"
#ERROR : Can't open dsspfile "2bdqA.bssp"
#ERROR : Can't open dsspfile "1djqA.bssp"
#ERROR : Can't open dsspfile "1c29A.bssp"
#ERROR : Can't open dsspfile "1djnA.bssp"
#ERROR : Can't open dsspfile "2dzuA.bssp"
#ERROR : Can't open dsspfile "2dzxB.bssp"
#ERROR : Can't open dsspfile "3b8iD.bssp"
#ERROR : Can't open dsspfile "2du2A.bssp"
#ERROR : Can't open dsspfile "2abbA.bssp"
#ERROR : Can't open dsspfile "2dzsA.bssp"
#ERROR : Can't open dsspfile "2dzpB.bssp"
#ERROR : Can't open dsspfile "3c6eA.bssp"
#ERROR : Can't open dsspfile "1dbtA.bssp"
#ERROR : Can't open dsspfile "1a53A.bssp"
#ERROR : Can't open dsspfile "2b4gB.bssp"
#ERROR : Can't open dsspfile "3dgbA.bssp"
#ERROR : Can't open dsspfile "2clhA.bssp"
#ERROR : Can't open dsspfile "2an2A.bssp"
#ERROR : Can't open dsspfile "2dqwA.bssp"
#ERROR : Can't open dsspfile "3bofA.bssp"
#ERROR : Can't open dsspfile "3dg3A.bssp"
#ERROR : Can't open dsspfile "3dtvD.bssp"
#ERROR : Can't open dsspfile "3dfhA.bssp"
#ERROR : Can't open dsspfile "2ehhC.bssp"
#ERROR : Can't open dsspfile "3eb2D.bssp"
#ERROR : Can't open dsspfile "2dw6A.bssp"
#ERROR : Can't open dsspfile "2e77B.bssp"
#ERROR : Can't open dsspfile "3daqA.bssp"
#ERROR : Can't open dsspfile "3e7gA.bssp"
#ERROR : Can't open dsspfile "1al8A.bssp"
#ERROR : Can't open dsspfile "2dqwB.bssp"
#ERROR : Can't open dsspfile "1bkhA.bssp"
#ERROR : Can't open dsspfile "3eb2A.bssp"
#ERROR : Can't open dsspfile "1bkhC.bssp"
#ERROR : Can't open dsspfile "2b4gA.bssp"
#ERROR : Can't open dsspfile "2dztA.bssp"
#ERROR : Can't open dsspfile "2dzvA.bssp"
#ERROR : Can't open dsspfile "3bw4A.bssp"
#ERROR : Can't open dsspfile "1dqwA.bssp"
#ERROR : Can't open dsspfile "2dzbB.bssp"
#ERROR : Can't open dsspfile "3ct7A.bssp"
#ERROR : Can't open dsspfile "2ehhA.bssp"
#ERROR : Can't open dsspfile "2dzxA.bssp"
#ERROR : Can't open dsspfile "2dzvB.bssp"
#ERROR : Can't open dsspfile "3c2zA.bssp"
#ERROR : Can't open dsspfile "2dp3A.bssp"
#ERROR : Can't open dsspfile "3c61A.bssp"
#ERROR : Can't open dsspfile "3b5vA.bssp"
#ERROR : Can't open dsspfile "2e68B.bssp"
#ERROR : Can't open dsspfile "3c5xA.bssp"
#ERROR : Can't open dsspfile "3bjsA.bssp"
#ERROR : Can't open dsspfile "2c3zA.bssp"
#ERROR : Can't open dsspfile "2e77C.bssp"
#ERROR : Can't open dsspfile "2djlA.bssp"
#ERROR : Can't open dsspfile "3bw2A.bssp"
#ERROR : Can't open dsspfile "2cu0B.bssp"
#ERROR : Can't open dsspfile "3bi8A.bssp"
#ERROR : Can't open dsspfile "2e68A.bssp"
#ERROR : Can't open dsspfile "2e77A.bssp"
#ERROR : Can't open dsspfile "1bkhB.bssp"
#ERROR : Can't open dsspfile "1eepA.bssp"
#ERROR : Can't open dsspfile "3di1B.bssp"
#ERROR : Can't open dsspfile "3bw3A.bssp"
#ERROR : Can't open dsspfile "3di1A.bssp"
#ERROR : Can't open dsspfile "1al7A.bssp"
#ERROR : Can't open dsspfile "1eepB.bssp"
#ERROR : Can't open dsspfile "2a6nA.bssp"
#ERROR : Can't open dsspfile "2a4aA.bssp"
#ERROR : Can't open dsspfile "3c3nA.bssp"
#ERROR : Can't open dsspfile "3bggA.bssp"
#ERROR : Can't open dsspfile "2a6lA.bssp"
#ERROR : Can't open dsspfile "3d0cB.bssp"
#ERROR : Can't open dsspfile "2btmA.bssp"
#ERROR : Can't open dsspfile "1b9bA.bssp"
#ERROR : Can't open dsspfile "2dw7A.bssp"
#ERROR : Can't open dsspfile "1btmA.bssp"
#ERROR : Can't open dsspfile "2cliA.bssp"
#ERROR : Can't open dsspfile "3dwjB.bssp"
#ERROR : Can't open dsspfile "3bllA.bssp"
#ERROR : Can't open dsspfile "3c52A.bssp"
#ERROR : Can't open dsspfile "3bpwB.bssp"
#ERROR : Can't open dsspfile "3cwoX.bssp"
#ERROR : Can't open dsspfile "3di0A.bssp"
#ERROR : Can't open dsspfile "2ekcA.bssp"
#ERROR : Can't open dsspfile "2cu0A.bssp"
#ERROR : Can't open dsspfile "2djxA.bssp"
#ERROR : Can't open dsspfile "1amkA.bssp"
#ERROR : Can't open dsspfile "3eisA.bssp"
#ERROR : Can't open dsspfile "3denA.bssp"
#ERROR : Can't open dsspfile "3e7sB.bssp"
#ERROR : Can't open dsspfile "2bbfA.bssp"
#ERROR : Can't open dsspfile "1aj0A.bssp"
#ERROR : Can't open dsspfile "1d3hA.bssp"
#ERROR : Can't open dsspfile "1ec7A.bssp"
#ERROR : Can't open dsspfile "1a5sA.bssp"
#ERROR : Can't open dsspfile "3e7sA.bssp"
#ERROR : Can't open dsspfile "3e7mA.bssp"
#ERROR : Can't open dsspfile "2dzbA.bssp"
#ERROR : Can't open dsspfile "3dqsA.bssp"
#ERROR : Can't open dsspfile "3dqtB.bssp"
#ERROR : Can't open dsspfile "3dwjA.bssp"
#ERROR : Can't open dsspfile "3di0B.bssp"
#ERROR : Can't open dsspfile "1efzA.bssp"
#ERROR : Can't open dsspfile "3d0cA.bssp"
#ERROR : Can't open dsspfile "3e65B.bssp"
#ERROR : Can't open dsspfile "3eahA.bssp"
#ERROR : Can't open dsspfile "1dtnA.bssp"
#ERROR : Can't open dsspfile "1dvjA.bssp"
#ERROR : Can't open dsspfile "3eahB.bssp"
#ERROR : Can't open dsspfile "1b4eA.bssp"
#ERROR : Can't open dsspfile "1df1A.bssp"
#ERROR : Can't open dsspfile "3ddmA.bssp"
#ERROR : Can't open dsspfile "3eisC.bssp"
#ERROR : Can't open dsspfile "1dwxA.bssp"
#ERROR : Can't open dsspfile "1dwxB.bssp"
#ERROR : Can't open dsspfile "2b7nA.bssp"
#ERROR : Can't open dsspfile "1ec7C.bssp"
#ERROR : Can't open dsspfile "1dvjC.bssp"
#ERROR : Can't open dsspfile "2aqwA.bssp"
#ERROR : Can't open dsspfile "3eegA.bssp"
#ERROR : Can't open dsspfile "3bsmA.bssp"
#ERROR : Can't open dsspfile "3dclB.bssp"
#ERROR : Can't open dsspfile "3bjsB.bssp"
#ERROR : Can't open dsspfile "3dipA.bssp"
#ERROR : Can't open dsspfile "3eegB.bssp"
#ERROR : Can't open dsspfile "1dvjB.bssp"
#ERROR : Can't open dsspfile "3barA.bssp"
#ERROR : Can't open dsspfile "3c56A.bssp"
#ERROR : Can't open dsspfile "3e7gC.bssp"
#ERROR : Can't open dsspfile "3c52B.bssp"
#ERROR : Can't open dsspfile "1ec7B.bssp"
#ERROR : Can't open dsspfile "1ad4A.bssp"
#ERROR : Can't open dsspfile "1e0tA.bssp"
#ERROR : Can't open dsspfile "2ashA.bssp"
#ERROR : Can't open dsspfile "2a5sA.bssp"
#ERROR : Can't open dsspfile "1e0uA.bssp"
#ERROR : Can't open dsspfile "1d3gA.bssp"
#ERROR : Can't open dsspfile "3bicB.bssp"
#ERROR : Can't open dsspfile "2e09B.bssp"
#ERROR : Can't open dsspfile "3bw2A.bssp"

## Summary of PDB Search
:256
    2e-35  52%  2a0nA  [x.x.x] IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE SUBUNIT
    6e-28  11%  3c4uA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE
    1e-25  13%  2e7fA  [x.x.x] 5-METHYLTETRAHYDROFOLATE CORRINOID/IRON SULFUR
    2e-25  14%  3cepA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    1e-24  14%  1dquA  [c.1.12] ISOCITRATE LYASE
    5e-23  10%  2ekcB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    7e-23  14%  2bznB  [x.x.x] GMP REDUCTASE 2
    2e-22   8%  3bofB  [x.x.x] 5-METHYLTETRAHYDROFOLATE S-HOMOCYSTEINE
    3e-22  16%  3dg9A  [x.x.x] ARYLMALONATE DECARBOXYLASE
    1e-21  14%  2a7rA  [x.x.x] GMP REDUCTASE 2
    1e-21  11%  3bolB  [x.x.x] 5-METHYLTETRAHYDROFOLATE S-HOMOCYSTEINE
    2e-21  15%  2a7rB  [x.x.x] GMP REDUCTASE 2
    3e-21  13%  2bznC  [x.x.x] GMP REDUCTASE 2
    4e-21  15%  2c6qG  [x.x.x] GMP REDUCTASE 2
    4e-21  13%  2bznA  [x.x.x] GMP REDUCTASE 2
    4e-21  12%  1ad1B  [c.1.21] DIHYDROPTEROATE SYNTHETASE
    2e-20  11%  2a7nA  [x.x.x] L(+)-MANDELATE DEHYDROGENASE
    2e-20  11%  3bolA  [x.x.x] 5-METHYLTETRAHYDROFOLATE S-HOMOCYSTEINE
    3e-20  10%  1a50A  [c.1.2] TRYPTOPHAN SYNTHASE (ALPHA CHAIN)
    4e-20  12%  1ad4B  [c.1.21] DIHYDROPTEROATE SYNTHETASE
    4e-20  20%  1b3oB  [c.1.5 - d.37.1 - d.37.1] PROTEIN (INOSINE MONOPHOSPHATE
    4e-20  11%  3dg6A  [x.x.x] MUCONATE CYCLOISOMERASE
    5e-20  15%  2bleA  [x.x.x] GMP REDUCTASE I
    7e-20  22%  2cffA  [x.x.x] 1-(5-PHOSPHORIBOSYL)-5-[(5-PHOSPHORIBOSYLAMINO)
    8e-20  12%  1bksA  [c.1.2] TRYPTOPHAN SYNTHASE
    1e-19  13%  1beuA  [c.1.2] TRYPTOPHAN SYNTHASE
    3e-19  14%  2e09A  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    3e-19  13%  2a1yA  [x.x.x] GMP REDUCTASE
    3e-19  13%  3b8iA  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    3e-19  15%  2bwgB  [x.x.x] GMP REDUCTASE I
    5e-19  12%  1chrA  [d.54.1 - c.1.11] CHLOROMUCONATE CYCLOISOMERASE
    6e-19  14%  2a7rC  [x.x.x] GMP REDUCTASE 2
    6e-19  13%  3b8iC  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    8e-19  15%  3b8iE  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    1e-18  14%  2c6qA  [x.x.x] GMP REDUCTASE 2
    2e-18  14%  2bznD  [x.x.x] GMP REDUCTASE 2
    2e-18  14%  2c6qB  [x.x.x] GMP REDUCTASE 2
    2e-18  14%  1ak5A  [x.x.x] INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
    2e-18  12%  2bwgA  [x.x.x] GMP REDUCTASE I
    3e-18  13%  3dz1A  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    3e-18  15%  1b3oA  [c.1.5] PROTEIN (INOSINE MONOPHOSPHATE DEHYDROGENASE 2)
    5e-18  12%  1bwkA  [c.1.4] PROTEIN (NADPH DEHYDROGENASE 1)
    6e-18  11%  3dipB  [x.x.x] ENOLASE
    6e-18  12%  3ct2A  [x.x.x] MUCONATE CYCLOISOMERASE
    1e-17  10%  3cb3B  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    1e-17  11%  2clfA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    1e-17  13%  2agkA  [x.x.x] 1-(5-PHOSPHORIBOSYL)-5-[(5-PHOSPHORIBOSYLAMINO)
    1e-17  17%  2bwgD  [x.x.x] GMP REDUCTASE I
    1e-17  10%  3cu2A  [x.x.x] RIBULOSE-5-PHOSPHATE 3-EPIMERASE
    3e-17  15%  2a7rD  [x.x.x] GMP REDUCTASE 2
    3e-17  22%  2dzwB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    3e-17  16%  2dzpA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    5e-17  18%  3eb2B  [x.x.x] PUTATIVE DIHYDRODIPICOLINATE SYNTHETASE
    6e-17  16%  2dzuB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    7e-17   6%  2csbA  [x.x.x] TOPOISOMERASE V
    8e-17  22%  2dzwA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    1e-16  12%  1dbtB  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    1e-16  19%  2e28A  [x.x.x] PYRUVATE KINASE
    2e-16  20%  3eisB  [x.x.x] ARYLMALONATE DECARBOXYLASE
    2e-16   8%  1bwlA  [c.1.4] PROTEIN (NADPH DEHYDROGENASE 1)
    2e-16  13%  3b8iB  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    2e-16  24%  2e09B  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    2e-16  22%  2dzsB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    2e-16  22%  2dztB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    3e-16  10%  3cb3A  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    3e-16  10%  2bdqA  [x.x.x] COPPER HOMEOSTASIS PROTEIN CUTC
    7e-16  11%  1djqA  [c.1.4 - c.4.1 - c.3.1] TRIMETHYLAMINE DEHYDROGENASE
    1e-15  14%  1c29A  [c.1.2] TRYPTOPHAN SYNTHASE
    1e-15  11%  1djnA  [c.1.4 - c.4.1 - c.3.1] TRIMETHYLAMINE DEHYDROGENASE
    2e-15  15%  2dzuA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    2e-15  21%  2dzxB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    2e-15  15%  3b8iD  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    2e-15  14%  2du2A  [x.x.x] LACTATE OXIDASE
    2e-15   9%  2abbA  [x.x.x] PENTAERYTHRITOL TETRANITRATE REDUCTASE
    4e-15  24%  2dzsA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    5e-15  23%  2dzpB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    6e-15   9%  3c6eA  [x.x.x] ENVELOPE PROTEIN E
    7e-15  12%  1dbtA  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    7e-15  17%  1a53A  [c.1.2 (1lbfA)] INDOLE-3-GLYCEROLPHOSPHATE SYNTHASE
    9e-15  15%  2b4gB  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    1e-14  12%  3dgbA  [x.x.x] MUCONATE CYCLOISOMERASE
    1e-14  10%  2clhA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    1e-14   8%  2an2A  [x.x.x] P332G A333S DOUBLE MUTANT OF NITRIC OXIDE
    1e-14  19%  2dqwA  [x.x.x] DIHYDROPTEROATE SYNTHASE
    1e-14  11%  3bofA  [x.x.x] 5-METHYLTETRAHYDROFOLATE S-HOMOCYSTEINE
    2e-14  11%  3dg3A  [x.x.x] MUCONATE CYCLOISOMERASE
    2e-14  20%  3dtvD  [x.x.x] ARYLMALONATE DECARBOXYLASE
    3e-14   9%  3dfhA  [x.x.x] MANDELATE RACEMASE
    3e-14  16%  2ehhC  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    3e-14  18%  3eb2D  [x.x.x] PUTATIVE DIHYDRODIPICOLINATE SYNTHETASE
    5e-14  12%  2dw6A  [x.x.x] BLL6730 PROTEIN
    8e-14  15%  2e77B  [x.x.x] LACTATE OXIDASE
    1e-13  18%  3daqA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    1e-13  15%  3e7gA  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    1e-13  21%  1al8A  [x.x.x] GLYCOLATE OXIDASE
    2e-13  19%  2dqwB  [x.x.x] DIHYDROPTEROATE SYNTHASE
    2e-13  11%  1bkhA  [d.54.1 - c.1.11] MUCONATE LACTONIZING ENZYME
    2e-13  20%  3eb2A  [x.x.x] PUTATIVE DIHYDRODIPICOLINATE SYNTHETASE
    2e-13  12%  1bkhC  [d.54.1 - c.1.11] MUCONATE LACTONIZING ENZYME
    3e-13  12%  2b4gA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    3e-13  24%  2dztA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    3e-13  17%  2dzvA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    4e-13  32%  3bw4A  [x.x.x] 2-NITROPROPANE DIOXYGENASE
    5e-13   5%  1dqwA  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    5e-13  21%  2dzbB  [x.x.x] DIHYDROPTEROATE SYNTHASE
    5e-13  10%  3ct7A  [x.x.x] D-ALLULOSE-6-PHOSPHATE 3-EPIMERASE
    5e-13  15%  2ehhA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    6e-13  12%  2dzxA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    6e-13  23%  2dzvB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    7e-13   7%  3c2zA  [x.x.x] QUEUINE TRNA-RIBOSYLTRANSFERASE
    8e-13  10%  2dp3A  [x.x.x] TRIOSEPHOSPHATE ISOMERASE
    1e-12  15%  3c61A  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    1e-12  20%  3b5vA  [x.x.x] RETROALDOLASE-22
    1e-12  13%  2e68B  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    2e-12   7%  3c5xA  [x.x.x] ENVELOPE PROTEIN E
    2e-12  13%  3bjsA  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    2e-12  17%  2c3zA  [x.x.x] INDOLE-3-GLYCEROL PHOSPHATE SYNTHASE
    2e-12  18%  2e77C  [x.x.x] LACTATE OXIDASE
    2e-12  16%  2djlA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    3e-12  32%  3bw2A  [x.x.x] 2-NITROPROPANE DIOXYGENASE
    3e-12  16%  2cu0B  [x.x.x] INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
    4e-12  15%  3bi8A  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    4e-12   9%  2e68A  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    5e-12  17%  2e77A  [x.x.x] LACTATE OXIDASE
    6e-12  11%  1bkhB  [d.54.1 - c.1.11] MUCONATE LACTONIZING ENZYME
    7e-12  18%  1eepA  [c.1.5] INOSINE 5'-MONOPHOSPHATE DEHYDROGENASE
    8e-12  18%  3di1B  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    1e-11  32%  3bw3A  [x.x.x] 2-NITROPROPANE DIOXYGENASE
    1e-11  18%  3di1A  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    2e-11  22%  1al7A  [x.x.x] GLYCOLATE OXIDASE
    2e-11  20%  1eepB  [c.1.5] INOSINE 5'-MONOPHOSPHATE DEHYDROGENASE
    3e-11  13%  2a6nA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    3e-11  10%  2a4aA  [x.x.x] DEOXYRIBOSE-PHOSPHATE ALDOLASE
    3e-11  13%  3c3nA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    3e-11   8%  3bggA  [x.x.x] URIDINE 5'-MONOPHOSPHATE SYNTHASE
    4e-11  12%  2a6lA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    4e-11  19%  3d0cB  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    6e-11  12%  2btmA  [c.1.1] PROTEIN (TRIOSEPHOSPHATE ISOMERASE)
    7e-11  10%  1b9bA  [c.1.1] PROTEIN (TRIOSEPHOSPHATE ISOMERASE)
    7e-11  10%  2dw7A  [x.x.x] BLL6730 PROTEIN
    8e-11  12%  1btmA  [c.1.1] TRIOSEPHOSPHATE ISOMERASE
    9e-11  15%  2cliA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    9e-11  12%  3dwjB  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    1e-10  17%  3bllA  [x.x.x] QUEUINE TRNA-RIBOSYLTRANSFERASE
    1e-10  14%  3c52A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE
    2e-10   8%  3bpwB  [x.x.x] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    3e-10  33%  3cwoX  [x.x.x] BETA/ALPHA-BARREL PROTEIN BASED ON 1THF AND 1TMY
    3e-10  18%  3di0A  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    5e-10  16%  2ekcA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    6e-10  13%  2cu0A  [x.x.x] INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
    1e-09  15%  2djxA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    2e-09  11%  1amkA  [x.x.x] TRIOSE PHOSPHATE ISOMERASE
    2e-09  21%  3eisA  [x.x.x] ARYLMALONATE DECARBOXYLASE
    3e-09  12%  3denA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    3e-09  15%  3e7sB  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    4e-09  11%  2bbfA  [x.x.x] TRNA GUANINE TRANSGLYCOSYLASE
    5e-09  17%  1aj0A  [x.x.x] DIHYDROPTEROATE SYNTHASE
    6e-09  21%  1d3hA  [c.1.4] DIHYDROOROTATE DEHYDROGENASE
    1e-08   9%  1ec7A  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    1e-08  10%  1a5sA  [c.1.2] TRYPTOPHAN SYNTHASE (ALPHA CHAIN)
    6e-08  12%  3e7sA  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    7e-08  12%  3e7mA  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    1e-07  21%  2dzbA  [x.x.x] DIHYDROPTEROATE SYNTHASE
    1e-07  16%  3dqsA  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    2e-07  16%  3dqtB  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    9e-07  11%  3dwjA  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    1e-06  14%  3di0B  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    2e-06  11%  1efzA  [c.1.20] TRNA-GUANINE TRANSGLYCOSYLASE
    2e-06  20%  3d0cA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    2e-06  11%  3e65B  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    3e-06  11%  3eahA  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    3e-06  12%  1dtnA  [x.x.x] MANDELATE RACEMASE
    3e-06  11%  1dvjA  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    5e-06  15%  3eahB  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    5e-06  18%  1b4eA  [c.1.10] PROTEIN (5-AMINOLEVULINIC ACID DEHYDRATASE)
    5e-06   9%  1df1A  [d.174.1] NITRIC OXIDE SYNTHASE
    9e-06  11%  3ddmA  [x.x.x] PUTATIVE MANDELATE RACEMASE/MUCONATE LACTONIZING
    9e-06  20%  3eisC  [x.x.x] ARYLMALONATE DECARBOXYLASE
    1e-05  12%  1dwxA  [d.174.1] NITRIC OXIDE SYNTHASE
    1e-05   9%  1dwxB  [d.174.1] NITRIC OXIDE SYNTHASE
    1e-05  15%  2b7nA  [x.x.x] PROBABLE NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
    2e-05   9%  1ec7C  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    2e-05  13%  1dvjC  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    2e-05  10%  2aqwA  [x.x.x] PUTATIVE OROTIDINE-MONOPHOSPHATE-DECARBOXYLASE
    3e-05  18%  3eegA  [x.x.x] 2-ISOPROPYLMALATE SYNTHASE
    4e-05  14%  3bsmA  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    5e-05  14%  3dclB  [x.x.x] TM1086
    6e-05  13%  3bjsB  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    8e-05  14%  3dipA  [x.x.x] ENOLASE
    1e-04  16%  3eegB  [x.x.x] 2-ISOPROPYLMALATE SYNTHASE
    2e-04  10%  1dvjB  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    2e-04  10%  3barA  [x.x.x] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    3e-04  16%  3c56A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE
    3e-04  12%  3e7gC  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    4e-04  15%  3c52B  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE
    4e-04   9%  1ec7B  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    5e-04  19%  1ad4A  [c.1.21] DIHYDROPTEROATE SYNTHETASE
    7e-04  28%  1e0tA  [c.1.12 - b.58.1 - c.49.1] PYRUVATE KINASE
    8e-04  18%  2ashA  [x.x.x] QUEUINE TRNA-RIBOSYLTRANSFERASE
    0.001  15%  2a5sA  [x.x.x] N-METHYL-D-ASPARTATE RECEPTOR NMDAR2A SUBUNIT
    0.001  25%  1e0uA  [c.1.12 - b.58.1 - c.49.1] PYRUVATE KINASE
    0.001  33%  1d3gA  [c.1.4] DIHYDROOROTATE DEHYDROGENASE
    0.001  24%  3bicB  [x.x.x] METHYLMALONYL-COA MUTASE, MITOCHONDRIAL
    2e-04  15%  2e09B  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN(query 158->216)
    2e-04  25%  3bw2A  [x.x.x] 2-NITROPROPANE DIOXYGENASE(query 44->112)
:256

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSLAVRVIPCLDVDGGRVVKGVNFQNLRDAGDPVELARRYDAEGADELTFLDVTASSSNRETTYDVVRRT
2a0nA           --LAKRIIACLDVKDGRVVKGTNFENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKV
3c4uA           -----EILLKA-HKEGYGVGAFNFVNFEMLNAIFEAGNEENSPLFIQASEGAIKYMGIDMAVGMVKIMCE
2e7fA           ----MLIIGRINGMFGDIKRAIQER---DPAPVQEWARRQEEGGARALDLNVGPAVQDKVSAMEWLVEVT
3cepA           -----RYENLFAQLNDRREGA--FVPFVTLGDPLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLR
1dquA           VTQMAKYLDTVYVSGWQTASSTDEPSPDLADYPMNTVPNKVNHLWMAQLFHDRKQREERMTTPKDQRHKV
2ekcB           -----RISDKFTEKREKALVSYLMVGYPDYETSLKAFKEVLKNGTDILEIGFPFSDPVADGPTIQVAHEV
2bznB           ---VRKRFPQHTIMAGNVVTGEMVEELILSGAD---IIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADA
3bofB           -----FVVIGERINPAGRKKLWAEMQKGNEEIVIKEAKTQVEKGAEVLDVNFGIESQIDVRYVEKIVQTL
3dg9A           -----RLYPDLPFIASGLLGSVTPEGYDAIESVVDHARRLQKQGAAVVSLMGTSLSFRGAAFNAALTVAM
2a7rA           ---VRKRFPQHTIMAGNVVTGEMVEELILSGAD---IIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADA
3bolB           -----FVVIGERINPAGRKKLWAEMQKGNEEIVIKEAKTQVEKGAEVLDVNFGIESQIDVRYVEKIVQTL
2a7rB           ---VRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCT---TRKKTGVGYPQLSAVMECADA
2bznC           ---VRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCT---TRKKTGVGYPQLSAVMECADA
2c6qG           -----KRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIG---PGSVCTTRKKTGVGYPQLSAVMECADA
2bznA           -----KRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCT---TRKKTGVGYPQLSAVMECADA
1ad1B           ----------------KIMGILNV--TPNVESAVTRVKAMMDEGADIIDVGGVSTMITVEEELNRVLPVV
2a7nA           WRFKPKRLVDVSRVLGKRQSMPLLIGPTALNGALWPKGDLALARAATKAGIPFVLSTASNMSIEDLARQC
3bolA           -------VIGERINPAGRKKLWAEMQKGNEEIVIKEAKTQVEKGAEVLDVNFGIESQIDVRYVEKIVQTL
1a50A           -----AFVPFVTLGDP------------GIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLR
1ad4B           -------------------------NVTNVESAVTRVKAMMDEGADIIDVGGVMITVEEELNRVLPVVEA
1b3oB           ------KYPNLQVIGGNVVTAAQAKNLIDAGVD---ALRVGMGSGSICITQEVLACGRPQATAVYKVSEY
3dg6A           VHAAEHVLVRVHTDDGIVGVAEAPPRPFTYGETQTGIVAVEREVAHTRMARTVGNPTAKAAIDMAMWDAL
2bleA           -----AKFPEHTIMAGNVVTGEMVEELILSGAD---IIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADS
2cffA           -----LVVPAIDLFRGRMIKGRKENTIFYEKDPVELVEKLIEEGFTLIHVVDLSNAIENSGENLPVLEKL
1bksA           -----RYENLFAQLRREGAFVPFVTGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTI------
1beuA           -----RYENLFAQLNDRREGA--FVPFVTLGDPLKIIDTLIDAGADALELGVPFSDPLANGPTIQNANL-
2e09A           MFKDGSLIPYLTAGDPDKQSTLNFLLALDEYGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWI
2a1yA           -----IVNSRSECDTTVTLGKHKFKLPVVPANMQTIIDERIATYLAENNYFYIMHRFQPEKRISFIRDMQ
3b8iA           ---------------SHHELRAMFRALLDSSRCYHTASVFDPMGFELQVLAAPDFALITLSEFVEQATRI
2bwgB           ---VRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYP---QLSAVIECADS
1chrA           -----TIKIIVERYLAPHLLGTDAFNVSGALQTMARAVTGNASAAVEMALLDLKARALGVSIAELLGGPL
2a7rC           ---VRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIG---PGSVCTTRKKTGVGYPQLSAVMECADA
3b8iC           ---------------SHHELRAMFRALLDSSRCYHTARIAADLGFECGVLAAPDFALITLSEFVEQATRI
3b8iE           ---------------SHHELRAMFRALLDSSRCYHTASVFDPMGFECGILGGSVASLQTLSEFVEQATRI
2c6qA           ---VRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCT---TRKKTGVGYPQLSAVMECADA
2bznD           ---VRKRFPQHTIMAGNVVTGEMVEELILSGADII---KVGIGPGSVCTTRKKTGVGYPQLSAVMECADA
2c6qB           ---VRKRFPQHTIMAGNVVTGEMVEELILSGADII---KVGIGPGSVCTTRKKTGVGYPQLSAVMECADA
1ak5A           -----------TIGWIREKYGDKVKVGAGNIVDGEGFRYLADAGADFIKIGIGRGQATAVIDVVAEKYFE
2bwgA           ---RSSLKSRAEVDLERTFTFRNSKQTYVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHP
3dz1A           ----------------------------DDVSIDRLTDFYAEVGCEGVTVLGILGEAAAEAEAVATRFIK
1b3oA           ------VLDSSQGNSIFQINMIKYIKDKYPNLQVIGGNVVTAAQAKNLDALRVGMGSRPQATAVYKVSEY
1bwkA           ----------------KIFNAIHEKKSFVWVQLWVLGWAAFPDNLARDGLRYDSASDNFMDAEQEAKAKK
3dipB           -----QTAPAIIGRAAENITSISSELLNPYVGFGSSSAEVRAASAVDIALWDLAGQRAGVPLHVALGGAA
3ct2A           -----SIKTNIDRFVAPLLIGQDASNINAAMLRLEQSIRGNAKSGIESALLDAQGKRLGLPVSELLGGRV
3cb3B           ---------ALIGEDPSDIAKLWDKLCWAGASAGRSGLSTQAIGAFDVALWDLKAKRAGLSLAKLLGSYR
2clfA           -----RYENLFAQLRREGAFVPFVTLDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLR
2agkA           -----KFIGCIDLHNGEVKQQHP---------SSYYAKLYKDRDVQGCHVIKLGPNN------DDAAREA
2bwgD           ---VRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYP---QLSAVIECADS
3cu2A           ----------------------------NWLQLNEEVTTLLENQINVLHFDIADGQFSSLFTVGAIGIK-
2a7rD           -----KRFPQHTIMAGNVVTGEMVEELILSG---ADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADA
2dzwB           ---------AKEFTEIAREEGIKTVFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTTEEPKTAYDLLRRA
2dzpA           MFKDGSLIPYLTAGDPNKQSTLNFLLALDEYGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWI
3eb2B           ------------------------------------------------------------------FHGV
2dzuB           MFKDGSLIPYLTAGDPDKQSTLNFLLALDEYGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWT
2csbA           ----------------------------------------------------------ERSSSAKNDEEL
2dzwA           ---------AKEFTEIAREEGIKTVFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTEEIPKTAYDLLRRA
1dbtB           ----------------------------DFASAEETLAFLAPFQQEPLFVKVGMELFYGPSIVKQLKERN
2e28A           ----------------------------------------------------------------------
3eisB           -----RLYPDLPFIASGLGLGSVTPEGYDAESVVDHARRLQKQGAAVVSLMGTSLSFYGAAFNAALTVAM
1bwlA           ------VWVQLWVLGWAAFPDNLARDGLRYDSASDNVFMDAEKANNPQHSLTKDEIKQYIKEYVQAAKNS
3b8iB           ---------------SHHELRAMFRALLDSSRCYHTASVFDPMSARLQVLAAPDFALITLSEFVEQATRI
2e09B           --------------------GIKTVFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTTEEPKTAYDLLRRA
2dzsB           -----------EFTEIAREEGIKTVFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTTEEPKTAYDLLRRA
2dztB           ------VFHAKEFTEIAREEGIKTVFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTTEEPKTAYDLLRRA
3cb3A           --------PALIGEDPSDIAKLWDKLCWAGASAGRSGLSTQAIGAFDVALWDLKAKRAGLSLAKLLGSYR
2bdqA           --------------------------REFCAENLTDLTRLDKAIISRVELCD-NLAVGGTTPSYGVIKEA
1djqA           -------------------------------------------WYGGAHAPNMESRATPRGPSQYASEFE
1c29A           -----AFVPFVTLGDPGIEQSLKIDTLIDAGDALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEM
1djnA           -------------------------------------------WYGGAHAPNMESRATPRGPSQYASEFE
2dzuA           MFKDGSLIPYLTAGDPDKQSTLNFLLALDEYGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWI
2dzxB           ------VFHAKEFTEIARAAGIKTVFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTTEEPKTAYDLLRRA
3b8iD           ---------------SHHELRAMFRALLDSSRCYHTASVFDPMGFECGILGGSVASLQTLSEFVEQATRI
2du2A           NNIYGASKQKISPDIEEIAGHSGLPVFVKGIQHPEDADMAIKRGASGIWVSNHGARQLPGSFDTLPAIAE
2abbA           VCNEWSADRIGIRVSPIGTFQNVDNGPNEEADALYLIEELAKRGIAYLHMSE-TDLAGGKPYSEAFRQKV
2dzsA           -------------------EGIKTVFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTEEIPKTAYDLLRRA
2dzpB           ----------------AREEGIKTVFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTTEIPKTAYDLLRRA
3c6eA           ------------SCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTESRCPTQGEPSLMVDR
1dbtA           ----------------------------DFASAEETLAFLAPFQQEFVKVGMELFYQEGPSIVKQLKERN
1a53A           ISLNERILEFNKRNITAIIAEYKRKSGLDVERDPIEYSKFMERYAVGLSILTEEKYFNGSYETLRKIAS-
2b4gB           ----------------------------SIGNGLVIDPANETVVIKPKQGFGGLGGKYVLPTALANVNAF
3dgbA           -----SIKTNIDRFVAPLLIGQDASNINAAMLRLEQSIRGNTFAGIESALLDAQGKRLGLPVSELLGGRV
2clhA           -----RYENLFAQLRREGAFVPFVTLGDGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLR
2an2A           AKMAWRNSNRCIGRLFW------NSLNVIDRRDVRTKEDVRDALFHHIETATNNGKIRPSITIFQVEIWN
2dqwA           -------------------------------RALERAREMVAEGAD---ILDLGAEEEEKRRLLPVLEAV
3bofA           ------VVIGERINPAGRKKLWAEMQKGNEEIVIKEAKTQVEKGAEVLDVNFGIESQIDVRYVEKIVQTL
3dg3A           -----HVLVRVHTDDGIVGVAEAPPRPFTYGETQTGIVAVEQYFAPALIGLTLTEREVAHTRMAAMWDAL
3dtvD           -----RLYPDLPFIASGLGLGSVTPEGYDAESVVDHARRLQKQGAAVVSLMGTSLSFRGAAFNAALTVAM
3dfhA           -----YLKPILIGKNANNIEDL-WQMMMVNAYWRNGPVINNAISGVDMALWDIKAKLAGMPLHQLFGGKS
2ehhC           ----------------------------------------------------------------------
3eb2D           ------------------------------------------------------------------FHGV
2dw6A           ----------------------VWAAMMINEKPGGHGERSVAVGTIDMAVWDAVAKIAGKPLFRLLAERH
2e77B           ----------------EIAGHSGLPVFVKGIQHPEDADMAIKRGASGIWVSNHGARQLYEAPGSFDTLPA
3daqA           -----------------------------------------------------------------LFEGV
3e7gA           --QAWRNAPRCIGRIQWSN--LQVFDARSCSTAREM-FEHICRHVRYSTNNGNIRSAITVFPQRSDGKHD
1al8A           ---AGQIDRSLSWKDVAWLQTITSLPILVKGITAEDARLAVQHGAAGIIVSNHGARQLDATIMALEEVVK
2dqwB           ----------LDLDRVRLL---GVLNLTPPERALERAREMVAEGADILDLGAESPVEEEKRRLLPVLE--
1bkhA           ---PEGIKANIDAHLAPALIGLAADNINAAMLKLLAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRV
3eb2A           -------------------------------------------------------------------HGV
1bkhC           ---------------------------LAADNINAAMLKLDAKSGIESALLDAQGKRLGLPVSELLGGRV
2b4gA           VKMPPYFDIAHFDMAAAVLNDFPLVKFITCVNSIGNGLVIDPANETVVIKPKQGFKYVLPTALANVNAFF
2dztA           --------------------GIKTVFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTEEIPKTAYDLLRRA
2dzvA           ------LIPYLTAGDPDKQSTLNFLLALDEYGAIELGIPFSDPIADGKTIQESHYRAFKLREAFWIVKEF
3bw4A           ----------------------------------------------------------------------
1dqwA           --VAAKLFNIMHEKQTNLCASLDVRTTKELLELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKY
2dzbB           ----------LDLDRVRLLGVLNLT--PDPERALERAREMVAEGAD---ILDLGAESTPVEEEKRRLLPV
3ct7A           ------------------------------LLKFKEQIEFIDSHADYFHIDIMDGHFVPNLTLPFFVSQV
2ehhA           ------------------------------------------------------------------FQGS
2dzxA           ------LIPYLTAGDPDKQSTLNFLLALDEYGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWI
2dzvB           ------------FTEIAREEGIKTVFLAAPNTPAERLKVIDDMTTGFVYLVSLYGTTEEPKTAYDLLRRA
3c2zA           -------TPAFMPVGAATVKALKPETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTD
2dp3A           ------------GKELGESKMLWKEVVIAYEPVWSIGTGVVATPEQAEEVHVGLRK------WFVEKVAA
3c61A           ----AEILNEFPQVQF-------ITCINSIGNGLVIDAETESVVIKPKQGFGGLGGRYVLPTALANVNAF
3b5vA           ----------------------------DVERDPIEYSKFMERYAVGLSITTEAKYFNGS---YETLRAI
2e68B           ----------------VLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTVNAFY
3c5xA           ------------SCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTESRCPTQGEPSLMVDR
3bjsA           ----------------------------------------------DMALWDIRGKAANMPLYELLGGSK
2c3zA           --------PIISLNERILEFNKRNITGLDVERDPIEYSKFMERYAVGLSILTEEKYFNGS---YETLRKI
2e77C           ---------------------------------PEDADMAIKRGASGIWVSNHGARQLYEAPGSFDTLPE
2djlA           ---------------------------NSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAF
3bw2A           ----------------------------------------------------------------------
2cu0B           ------------RQKVDADFIVGNIANPKAVDDLTFADAVKVGIGPGSICTTRIVAGVGVPQITAVVADR
3bi8A           ------------------------------------------------------------------FKGS
2e68A           --EEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKP
2e77A           ---------------------------------PEDADMAIKRGASGIWVSNHGARQLYEAFDTLPAIAE
1bkhB           -----GIKANIDAHLAPALIGLAADNINAAMLKLDAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRV
1eepA           ---IKTKYPNLDLIAGNIVTKEAALDLISVGAD---CLKVGIGPGSICTTRIVAGVGVPQITAICDVYEA
3di1B           ----------------------------------------------------------------HLFEGV
3bw3A           ----------------------------------------------------------------------
3di1A           -----------------------------------------------------------------LFEGV
1al7A           ----DVAWLQTITSLPILVKGVI---------TAEDARLAVQHGAAGIIVSNHGARQLDATIMALEEVVK
1eepB           ---IKTKYPNLDLIAGNIVTKEAALDLISVG---ADCLKVGIGPGSICTTRIVAGVGVPQITAICDVYEA
2a6nA           ------------------------------------------------------------------FTGS
2a4aA           ------------LTNKILKVIIEVGELKTEDLIIKTTLAVLNGNADFIKTSTGKVQINATPSSVEYIIKA
3c3nA           --FDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAF
3bggA           ---------------------IAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLT
2a6lA           -----------------------------------------------------------------MFTGS
3d0cB           ----------------------------------------------------------DYGEFSKRFSTI
2btmA           ---------------------------------IAYEPIWAIGTGKSSTPEDANSVCGHIRSVVSRLFGP
1b9bA           ----VEKQVREGFYGLDKEEAKRVVIAYEPVWAIGTGRVATPQQAQEVHA--------FIRKLLSEMYDE
2dw7A           -----------------------WAAMMINEKPGGHGERSVAVGTIDMAVWDAVAKIAGKPLFRLLAERH
1btmA           ---------------------------------IAYEPIWAIGTGKSSTPEDANSVCGHIRSVVSRLFGP
2cliA           ME---RYENLFAQLRREGAFVPFV----TLGDPLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLR
3dwjB           TKMAHRNAPRCIGRIQWSNLQVF--DARNCSTAQEMFQHICRHILYATNNGNIRSAITVFPQRSDGKHD-
3bllA           -----------NAALFGIQQGSVFENLR-----QQSADALAEIGFDGYAV---GGLSEGQDEMFRVLDFS
3c52A           LELTSKVVKMAHNAGVSVEAELGRLMGIVLVNPKEAEQFVKESQVDYLTSHGAFKFKGEPKLDFERLQEV
3bpwB           -------FVLVKTTNPDSAIFQKNLSLDNKQAYVIMAQEALNMSSYLNLEQNNENSYDEMNYIRTYFPNC
3cwoX           ----------------------------------------------------------------------
3di0A           -----------------------------------------------------------------LFEGV
2ekcA           -------------------VMKKYVLSFVPLGAPTSTRKRIKLICEAADEMTYFVSVTGYERIKKKVEEY
2cu0A           -----------------------------VGNIANPKAVDDLTFADAVKVGIGPGSIVPQITAVAMVADR
2djxA           -------------------------------SVGNGLVIDAESESVVIKPKQLGGKYILPTALANVNAFY
1amkA           ---------TAKVVLSQTSAIAAKLTKDAWN-QVVLAYEPVWAIGTGKVATPEQAQEVHLLLRKWVNIGT
3eisA           ----------------------------VIESVVDHARRLQKQGAAVVSLMGTSLSFYGAAFNAALTVAM
3denA           ------------------------------------------------------------------FTGS
3e7sB           ---AWRNAPRCVGRIQWGKL--QVFDARDCSSAQEM-FTYICNHIKYATNRGNLRSAITVFPQRAPGRGD
2bbfA           ---SRDAFDSRKEQAENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGG-LAVGEGQDEMFRVLDFS
1aj0A           -----HVMGILNVTPDSFSDGGTHNSLIDA---VKHANLMINAGATIIDVGGESTRPGAAEVSIPVVEAI
1d3hA           LTKVLQERDGLRRVHRPAVL-VKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQSTQTIREM
1ec7A           ---------------------------------LNEAIKIGKYLKGSLAYAEDPCGAEQGFSGREVMAEF
1a5sA           -----RYENLFAQRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLR
3e7sA           AKQAWRNAPRCVGRIQWGKLQVFRDCSSAQEMFTYICNHIKYATNRGNLRSAITV----FPQRAPG-RGD
3e7mA           TKMAWRNAPRCIGRIQWSNLQVF--DARNCSTAQEMFQ-HICRHILYATNNGNIRSAITVFPQRSDGKHD
2dzbA           -------------------------------RALERAREMVAEGAD---ILDLGAESEEEKRRLLPVLEA
3dqsA           AKQAWRNAPRCVGRIQWGKL--QVFDARDCSSAQEMFT-YICNHIKYATNRGNLRSAITVFPQRAPGRGD
3dqtB           AKQAWRNAPRCVGRIQWGKL--QVFDARDCSSAQEMFT-YICNHIKYATNRGNLRSAITVFPQRAPGRGD
3dwjA           ----------------------------DARNCSTAQEMFQHICRHYATNNGNIRSAITVFPQRSDGKHD
3di0B           ----------------------------NIEALKTHVNFLLENNAQAIIVNGTTATTDEKERILKTVID-
1efzA           --------------AENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGG-LAVGEGQDEMFRVLDFS
3d0cA           ----------------------------------------------------------------------
3e65B           ---AWRNAPRCIGRIQWSNLQVFRNCSTAQEMFQHICRHILYATNNGNIR-----SAITVFPQRSDGKHD
3eahA           --NAPRCVGRIQWGKLQVFDARDCRSAQE--MFTYICNHIKYATNRGNLRSAITV-----FPQRCPGRGD
1dtnA           -----VVRSIRQAVGDDFGIMVDYNQSLDVPAAIKRSQALQQEGVTWIEE-------PTLQHDYEGHQRI
1dvjA           ----------------NVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKPSTRPERLSRLR
3eahB           ---AWRNAPRCVGRIQWGKL--QVFDARDCRSAQEMFT-YICNHIKYATNRGNLRSAITVFPQRCPGRGD
1b4eA           ----------------------------------------------------------------------
1df1A           ---ATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYATNNNIRSAITVFPQRSDGKHD
3ddmA           ----------------------------------------------------------------------
3eisC           ---------------------------------VDHARRLQKQGAAVVSLMGTSLSFYGAAFNAALTVAM
1dwxA           --MAWRNAPRCIGRIQWSNL--QVFDARNCSTAQEMFQ-HICRHILYATNNGNIRSAITVFPQRSDGKHD
1dwxB           --LTLDELIFATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYATNNGNIRSAIGKHD
2b7nA           ----------------------------------------EAKNAMNAGADIVMCDNLSVLETKEIAAYR
1ec7C           ---------------------------------LNEAIKIGKYLKGSLAYAEDPCGAEQGFSGREVMAEF
1dvjC           ----------------------------------PGAEMFIQGAADEIARMGVDLGVKPSTRPERLSRLR
2aqwA           ----------------------------IVADETQKATELKIEQNNEFIGFVVGSNAFEEKIIRNKFPDS
3eegA           --------------------------LRDGLEKIIVAKALDELGVDVI----EAGFPVSSPGDFNSVVEI
3bsmA           -----------------------WQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKS
3dclB           ----VKVGDSAYGAGDHVEPGVSV----ARRKEEEIPLTLSCIGNEVIVSGDAKGSRGFVTGKHGGVNHV
3bjsB           -----------KVLGDEVDILTDANTAYTMADARRVLPVLAEIQAGWLEE------PFACNDFASYREVA
3dipA           LKDGLEPFRKIRAAVGQRIEIMCELHSLWGTAAARICNALADYGVLWVED------PIAKMDNIPAVADL
3eegB           ----------------------------------------------------------------------
1dvjB           ----------------------------------------------------------------RLSRLR
3barA           -----------------------------KQAYVIMAQEALNMSSYLNLEQNNEFIGFVVANSYDEMNYI
3c56A           ----------------------------------------------------------------------
3e7gC           ---AWRNAPRCIGRIQWSNL--QVFDARSCSTAREMFE-HICRHVRYSTNNGNIRSAITVFPQRSDGKHD
3c52B           --LTSKVVKMAHNAGVSVEAELGR-LMGILVNPKEAEQFVKESQVDYLAPAIGTSHGAFKFKGFERLQEV
1ec7B           ---------------------------------LNEAIKIGKYLKGSLAYAEDPCGAEQGFSGREVMAEF
1ad4A           ----------------------------NVESAVTRVKAMMDEGAD---IIDVGGVSTREEELNRVLPVV
1e0tA           ------------------------------------------------------------------MKKT
2ashA           ---------------------------------RESALQLTSIGFDGYAIGGLSIGEERSLT-LEMTEVT
2a5sA           ----------------------------------------------------------------------
1e0uA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
3bicB           ----------------------------------------------------------------------
2e09B           ----------------------------------------------------------------------
3bw2A           -------------------------------------------GGHQGTHRDSSEDDGAGIGLLSLLAQV


                         .         .         *         .         .         .         .:140
query           AEQVFIPLTVGGGVRSTEDVDRLLRAGADKVSINTAAVRRPELIREIAQEFGSQVLVLSADVRRTVNGTA
2a0nA           AEQIDIPFTVGGGIHDFETASELILRGADKVSINTAAVENPSLITQIAQTFGSQAVVVAIDAKRVD----
3c4uA           RYPHIPVALHLDHGTTFESCEKAVKAGFTSVMIDASHHAFEENLELTSKVVKMAHNA-------------
2e7fA           QEVSNLTLCLDSTNIKAIEAGLKKCKNRAMINSTNAEREKVEKLFPLAVEHGAALIGLTMNKTGIPK---
3cepA           AAAGVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQ
1dquA           ANVDYLDTGHGGLTAVMKLTKLFVERGAAGIHIESEHINRLVAIRAQADIMGTDLLAIARTDSEAATLIT
2ekcB           ALKNGIRFEDVLELSETLRKEFPDIPFLLMTYYNPIFRIGLEKFCRLSREKGIDGFIVPDLPPEEAEE-L
2bznB           AHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKY
3bofB           PYVSNVPLSLDIQNVDLTERALRAYPGRSLFNSAKVDEEELEMKINLLKKYGGTLIV-------------
3dg9A           REATGLPCTTMST----AVLNGLRALGVRRVALTAYIDDVNERLAAFLAEESLVPTG-----------CR
2a7rA           AHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKY
3bolB           PYVSNVPLSLD--IQNVDLTERALRAYPGRSLFNSAKVDELEMKINLLKKYGGTLIVLLMGKDVPK----
2a7rB           AHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYK-LFYGMSSEMAMKK
2bznC           AHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKY
2c6qG           AHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKY
2bznA           AHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKY
1ad1B           EAIVGFDVKISVDTFRSEVAEACLKLGVDIINDQWAGLYDHRMFQVVA-KYDAEIVLMHNGNGN------
2a7nA           DGDLWFQLYVIHREIAQGMVLKALHTGYTTLVLTTDVAVNGYRERDLHNRFKIPPFLTLKNFEGIDLGKM
3bolA           PYVSNVPLSL--DIQNVDLTERALRAYPGRSLFNSAKVEELEMKINLLKKYGGTLIVLL-----------
1a50A           AFAAGVTPQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFR-
1ad4B           IVGFDVK--ISVDTFRSEVAEACLKLGVDIINDQWAGLYDHRMFQVVAKYDAEIVLMHNGNGNRDEPVVE
1b3oB           ARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEDKGSIHKFVPYLIAGIQHSCQDIG
3dg6A           GQSLRLSVSEMLGGYTDRMRVSHMLGFDDPVKMVAEAERIRETYGINTFKVKVGRRPVQLDTAVVRARER
2bleA           AHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIRKLKLFYGMSSDTAM------N
2cffA           -SEFAEHIQIGGGIRSLDYAEKLRKLGYRRQIVSSKVLEDPSFLKSLREIDVEPVFSLVTRGG-------
1bksA           QNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNG-IDAFYARCEQVGVDSVLDVPVEE
1beuA           -----RAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNG-IDAFYARCEQVGVDSVLVAD---
2e09A           VKALMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLA-----------
2a1yA           SRGLIASISVGVKEDEYEFVQQLAAEHLTPEYIIDIAHGHSNAVINMIQHIKKHLPE-------------
3b8iA           GRVARLPVIADADHGYGRTVVELERAGIAALTIEDTLLPAQFGRKSTDLICVEEGVGKIRAALEARVDPA
2bwgB           AHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIRKLKLFYGMSSDTAMNK-----
1chrA           RSAIPIAWT-LASGDTKRDLDSAVEMIERRRHNRFKVKLGFRSPQDDLIHMEALSNSLGSKAY-------
2a7rC           AHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSS-----EM
3b8iC           GRVARLPVIADADHGYGRTVVELERAGIAALTIEDTLLPAQFGRKSTDLICVEEGVGKIRAALEAR---V
3b8iE           GRVARLPVIADADHGYGRTVVELERAGIAALTIEDTLLPAQFGRKSTDLICVEEGVG---KIRAALEARV
2c6qA           AHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKL----------FYG
2bznD           AHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKY
2c6qB           AHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKL----------FYG
1ak5A           ETGIYIPVCSDGGIVYDYHMTLALAMGADFIMLGRYFARFEESPTRKVTINGSVMKEYWGEGS-----SR
2bwgA           ECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICDVANGYSEHFVEFVKLVRAKFPEHTIMAGN------
3dz1A           RAKSQVIVGVSAPGFAARRLARLSDAGAAGVIAPPPSLRTDEQITTYFRQIGDDVPWVLQDYPLT-LSVV
1b3oA           ARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEDKGSIHKFVPYLIAGIQHSCQDIG
1bwkA           ANNPQHSLTKDEIKQYIKEAKNSIAAGADGVEINSANGNRARFTLEVVDALVEAIGHEKVGLRLSPYGV-
3dipB           RDRVPVYATFMRDAG--VLAESLVAEGYAAMKIWPFDDFASITPHHISLTDLKDGLEPFRKIRAAV----
3ct2A           RDALPVAWTLASGDTAKDIAEAQKMLDLRRHRIFKLKIGAGDRDLAHVIAIKKAL---------------
3cb3B           DSVRCYNTSGGFLHTPIDQLMVNASASIERGIGGIKLKVGQPDGALDIA-------------RVTAVRKH
2clfA           A------FAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNG-IDAFYARCEQVGVDSVLVADVEE
2agkA           LQESPQFLQVGGGINDTNCLEWLKWASKVIVTSWLFTKEGHFQLKRLERLTELCGKDRIVVDLSCRKTQD
2bwgD           AHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIRKLKLFYGMSSDTAMNKHAEYR
3cu2A           YFPTHCFKDVHLVRNQLEVAKAVVANGANLVTLQLEQYHDFALTIEWLAKQKTTYANQVYPVL-------
2a7rD           AHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGKTV-------
2dzwB           KRICRNKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGREATEFLKKKVE-------------
2dzpA           VKELMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLA-----------
3eb2B           FPYLVSPVDAEGRVVMGRLCDDLIQAGVHGLTPLGSTGEFAYLGTAQREAVVRATIE------------A
2dzuB           PIVLMTYYNPIYRAGVRNFLAEAKASGVNGILVVDLPVFHAKEFTEIAREEGIKTVFLA-----------
2csbA           LELHQNFILLTGACSIDPTEDRYQNVIVRGVNFDERVQRLSTGGSPARYAIVYRRGWRAIAKALD----I
2dzwA           KRICRNKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGREATEFLKKKVE-------------
1dbtB           CELFLDLKLHDIPTTVNKAMKRLASLGVDLVNVHAAGGKKMMQAALEGLEEGTPAGKKRPSLIAVTQLTS
2e28A           KRKTKIVSTIGPASESVDKLVQLMEAGMNVARLNFSHGDHEEHGRRIA----------------NIREAA
3eisB           REATGLPCTTMS----TAVLNGLRALGVRRVALATAYIDDVNERLAAF--LAEESLVPTGRSLGITG---
1bwlA           IAAGADGVEINSAHGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGV-
3b8iB           GRVARLPVIADADHGYGRTVVELERAGIAALTIEDTLLPAQFGRKSTDLICVEEGVGKIRAALEARVDPA
2e09B           KRICRNKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGREATEFLKKKVE-------------
2dzsB           KRICRNKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGREATEFLKKKVE-------------
2dztB           KRICRNKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGREATEFLKKKVE-------------
3cb3A           DSVRCYNTSGGFLHTPIDQLMVNASASIERGIGGIKLKVGQPDGALDIARVTAVRKHLGDA---------
2bdqA           NQYLHEKGISVAVIRPRGGNFVYNDLELRIEEDILRAVELESDALVLGILTSNNHIDTEAIEQLLPAT--
1djqA           TLSYCKEMDLSDIAQVQQFAKRSRDAGFDIVYVYGAHSYLPLQFLNPYDKYGGSLENRARFWLETLEKVK
1c29A           LALIREKH---------PTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALR
1djnA           TLSYCKEMDLSDIAQVQQFAKRSRDAGFDIVYVYGAHSYLPLQFLNPYDKYGGSLENRARFWLETLEKVK
2dzuA           VKEFRRHSSTPIVLMTYNFLAEAKASGVNGILVVDLPVFHAKEFTEIAREEGIKTVFLA-----------
2dzxB           KRICRNKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGREATEFLKKKVEELLGI--------
3b8iD           GRVARLPVIADADHGYGRTVVELERAGIAALTIEDTLLPAQFRSTDLICVEEGV-----GKIRAALEARV
2du2A           RVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGAYSVLDYFQ--KDLTRVMQLTG
2abbA           RERFHGVIIGAGAYTAEKAEDLIGKGLIDAVAFGRDYIANPDLVARLQKKAELNPQRPESFYGGGAEG--
2dzsA           KRICRNKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGREATEFLKKKVE-------------
2dzpB           KRICRNKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGREATEFLKKKVE-------------
3c6eA           GWGNGCGLFGKGGIVTCAMFRCKKNMEGKVVQPENLEYTIVITPHSGEEHAGKHGKEIKITPQSTGYGTV
1dbtA           CELFLDLKLHDIPTTVNKAMKRLASLGVDLVNVHAAGGKKMMQAALEGLEEGTPAGKKRPSLIAVTQLTS
1a53A           --SVSIPILMKDFIVKESQIDDAYNLGADTVLLIVKILTERELESLLEYARSYGMEPL------------
2b4gB           FRRCPKLVFGCGGVYSGEEAFLHILAGASMVQVGTALHDEGPIIFARLNKELQEIMT-------------
3dgbA           RDALPVAWTLASGDTAKDIAEAQKMLDLRRHRIFKLKIGAVDRDLAHVIAIKK----------------A
2clhA           AFAAGVTPA-----QCFEMLALIREKHPTIPIGLLMYANLVDAFYARCEQVGVDSVLVADVPVEESAPFR
2an2A           HQLIRYAGYEGEAIGDPASCSLTAACELGWRGERTDFDLLPLIFRMKGDEQPVWY---------------
2dqwA           LS---LGVPVSVDTRKPEVAEEALKLGAHLLNDVTGLRDERMV--ALAARHGVAAVVMHMPVPDPATMMA
3bofA           PYVSNVPLSLDI--QNVDLTERALRAYPGRSLFNSAKVDELEMKINLLKKYGGTLIV-----------LL
3dg3A           GQSLRLSVSEMLGGYTDRMRVSHMLGFDDPVKMVAEAERIRETYGINTFKVKVGRRPVQLDTAVVRARER
3dtvD           REATGLPCTTMST----AVLNGLRALGVRRVALATAYIDDVN------ERLAAFLAEESLVPTGC-----
3dfhA           RDAIPVYTHATSDTMEGIYDLVEKGYKHIRCQLGFDQDQYMDNTLTMFKSLREKY---------------
2ehhC           ---LITPFKEGEVDYEANLIEFHVDNGTDAILVCGTTGESPTLTFEEHEKVIEFAVKRAAG---------
3eb2D           FPYLVSPVDAEGRVVMGRLCDDLIQAGVHGLTPLGSTGEFAYLGTAQREAVVRATI------------EA
2dw6A           GVKANPRVFVKGLSMLRGEMRGYLDRGVVKMAIGGAPIEEDRMRIEAVLEEIGKDAQLAVDANGRF----
2e77B           IAERVVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGAYSVLDYFQ--KDLTRVMQLTG
3daqA           GVALTTPFTNNKVEALKAHVNFLLENNAQAIIVNGTTAESPTLTTDEKELILKTVIDLVDK---------
3e7gA           FRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYGRFDVVPLVLQANG------------R
1al8A           AAQGRIPVFLDGGVRRGTDVFKALALGAAGVFIGRPVVFSLAAEGEAGVKKVLQMMR--DEFELTMALSG
2dqwB           -AVLSLGVPVSVDTRKPEVAEEALKLGAHLLNDVTGLRDERMVALAARHGVAAVVMHMPV--------PA
1bkhA           RDSLEVAWTLASG-DTARDIAEARHMLEIRRHRVFKLKIGANPVEQDLKHVVTIKRELGDSAS-------
3eb2A           FPYLVSPVDAEGRVVMGRLCDDLIQAGVHGLTPLGSTGEFAYLGTAQREAVVRATIEAAQRRVPVVAGVA
1bkhC           RDSLEVAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPV---------EQDLKHVVTIKREL----
2b4gA           RRCPDKLVFGCGGVYSGEEAFLHILAGASMVQVGTALHDEGPIIFARLNKELQEIMT-------------
2dztA           KRICRNKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGREATEFLKKKVE-------------
2dzvA           RRHSSTPIVLIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLA-----------
3bw4A           ----------------------------------------------------------------------
1dqwA           NFLLFEDRKFADIGNTVKLGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTK---------------E
2dzbB           LEAVSLGVPVSVDTRKPEVAEEALKLGAHLLNDVTGLRDERMVALAARHGVAAVVMHMPAHARYRDVVAE
3ct7A           KKLATKPLDCHLMVTRPQDYIAQLARAGADFITLHPETINGQAFRLIDEIRRHDMKVG------------
2ehhA           IVALITPFKEGEVEALGNLIEFHVDNGTDAILVCGTTGESPTLTFEEHEKVIEFAVKRAAG---------
2dzxA           VKEFRRHSSTPIVL---------------MTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEF-
2dzvB           KRICRNKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGREATEFLKKKVE-------------
3c2zA           SGGYQVEGVTRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSRKE
2dp3A           EGAQHIRIIYGGSANGSNCEKLGQCPNIDGFLVGGASL-KPEFMTMIDILT-------------------
3c61A           YRRCPKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALHEEGPAIFERLTAELLDVMAK------------
3b5vA           ASSVSIPILMADFIVKESQIDDAYNLGADTVALIVAILTEAELESLLAYARS------------------
2e68B           RRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIM--------------
3c5xA           GWGNGCGLFGKGGIVTCAMFRCKKNMEGKVVQPENLEYTIVITPHSGE----------------------
3bjsA           RRIPAYAGGIALGYQPKEEAQEYIARGYKALKLRIGDARVDIERVRHVRKVLGDEVDILTDANTAY----
2c3zA           ASSVSIPILMKDFIVKESQIDDAYNLGADTVLLIVKILTERELESLLEYARSYGMEPL------------
2e77C           RVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGAYSVLDYFQ-------------
2djlA           YRRCPKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMAR------------
3bw2A           ----------------------------------------------------------------------
2cu0B           AQEYGLYVIADGGIRYSGDIVKAIAAGADAVMLGNLLAGTKEAPGKEVIINGRK----------------
3bi8A           GVAIITPFTNTGFDKLSELIEWHIKSKTDAIIVCGTTGEATTMTETERKETIKFVID------------K
2e68A           LFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYMPPYFD
2e77A           RVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGAYSVLDYFQ--KDLTRVMQLTG
1bkhB           RDSLEVAWTLASGDTARDIAEARHMLEIRRHRVFKLKINPVEQDLKHVVTIKREL---------------
1eepA           CNNTNICIIADGGIRFSGDVVKAIAAGADSVMIGNLFAGTKESPSEEIIYNGKKFKSMVPYSGKLKD---
3di1B           GVALTTPFTNNKVEALKTHVNFLLENNAQAIIVNGTTAESPTLTTDEKERILKTVID------------L
3bw3A           ----------------------------------------------------------------------
3di1A           GVALTTPFTNNKVEALKTHVNFLLENNAQAIIVNGTTAESPTLTTDEKERILKTVIDLVDK---------
1al7A           AAQGRIPVFLDGGVRRGTDVFKALALGAAGVFIGRPVVFSLAAEGEAGVKKVLQMMRDEFELTMALSGCR
1eepB           CNNTNICIIADGGIRFSGDVVKAIAAGADSVMIGNLFAGTKESPSEEIIYNGKKFK--------------
2a6nA           IVAIVTPMDEKGNVSLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLD------------L
2a4aA           IKEYIIGLKVSGGISDLNTASHYILLARRFLSDNFRIG-SSSLVIKLRKV--------------------
3c3nA           YRRCPKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMAR------------
3bggA           PGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEM---------------------
2a6lA           IVAIVTPMDEKGNVSLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLD------------L
3d0cB           SGINIVPFLEGTREIDWKGLEFLLQNGIEVIVPNGNTGEFYALTIEEAKQVATRVTELVNG---------
2btmA           EAAEAIRIQYGGSVKPDNIRDFLAQQQIDGALVGGASLEPASFLQLVEA---------------------
1b9bA           ETAGSIRILYGGSIKPDNFLGLIVQKDIDGGLVGGASLKESFILARIMR---------------------
2dw7A           GVKANPRVFVYGLSMLRGEMRGYLDRGYNVVKMKIGG-APIEEDRMRIEAVLEEI---------------
1btmA           EAAEAIRIQYGGSVKPDNIRDFLAQQQIDGPLVGGASLEPASFLQLVEA---------------------
2cliA           AFAAGVTPA-----QCFEMLALIREKHPIGLLMYANLVFNNGIFYARCEQVGVDSVLV-ADVPVEESAPF
3dwjB           FRLWNSQLIRYAGYQMPDGTIRGDAATLEFTQLCIDLGWKPRYGRFDVLPLVLQADGQDPEVFEILEVTM
3bllA           VPMLPDKPHYLMGVGKPDDIVGAVERGIDMFDCGQAFTWDGPINIRNA----------------------
3c52A           KRLTNIPLVLHGASAIPDNVRKSY-LDAGGDLKGSKGVPFEFLQESVKGGIN------------------
3bpwB           YILSPGIGAQNGDLHKTLTNGYHKSYEKILINIGRAITKNPYPQKAAQM---------------------
3cwoX           ---------------QQAMVIEAIKAGAKDIVNTAAVENPSLITQIAQTFGSQAVVVAIDAKRVDGEFMV
3di0A           GVALTTPFTNNKVEALKTHVNFLLENNAQAIIVNGTTAESPTLTTDEKERILKTVIDLVDK---------
2ekcA           RELCDKPVVVGFGVSKKEHA-REIGSFADGVVVGSALVKLAGQKKIEDLGNLVKELKEGLR---------
2cu0A           AQEYGLYVIADGGIRYSGDIVKAIAAGADAVMLGNLLAGTKEAPGKEVIINGRKYKQ--------YRGMG
2djxA           RRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIM--------------
1amkA           DVAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKPEFRIIDATR---------------------
3eisA           REATGLP----CTTMSTAVLNGLRALGVRRVALATAYIDDVN--ERLAAFLAEESLVPTGRSLGIM----
3denA           IVAIVTPMDEKGNVSLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLD------------L
3e7sB           FRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQA---------------
2bbfA           VPMLDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLP----------------------------------
1aj0A           AQRFEVWISV--DTSKPEVIRESAKVGAHIINDIRSL--SEPGALEAAAETGLPVCLMHMQGNP------
1d3hA           YALTQVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWPPVVGKVKRELEALL---------------
1ec7A           RRATGLPTATNMIATDWRQMGHTLSLQSVDIPLADPHFWTMQGSVRVCHEFGLTW---------------
1a5sA           AFAAGVTPA-----QCFEMLALIREKHPTLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFR
3e7sA           FRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQA---------------
3e7mA           FRLWNSQLIRYAGYQMPDGTIRGDAATLEFTQLCIDLGWKPRYGRFDVLPLVLQA---------------
2dzbA           VLSLGVPVSVDT--RKPEVAEEALKLGAH--LLNDVTGLRDERMVALAARHGVAA-----VVMHMPVPDP
3dqsA           FRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLP-----LLLQAP---------
3dqtB           FRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLP-----LLLQAP---------
3dwjA           FRLWNSQLIRYAGYQMPDGTIRGDAATLEFTQLCIDLGWKPRYGRFDVLPLVLQA---------------
3di0B           LVDKRVPVIAGTGTNDTEKSIQASILGADAIMLITPYYNKTKHFEAIADAVKLPVVLYNVPSRTNMTIEP
1efzA           VPMLPDDKHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGR-----------------------------
3d0cA           ---NIVPFLEGTREIDWKGLEFLLQNGIEVIVPNGNTGEFYALTIEEAKQVATRVTELVNGRATVVAGIG
3e65B           FRLWNSQLIRYAGYQMPDGTIRGDAATLEFTQLCIDLGWKPRYGRFDVLPLVLQA---------------
3eahA           FRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQA---------------
1dtnA           QSKLNVPVQMGENWLGPEEMFKALSIGCRLAMPDAMKIGGVTGWIRASA---------------------
1dvjA           EIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADN----------------------------
3eahB           FRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQA---------------
1b4eA           -------------------RQALDAAGFKDTAIMSYSTKFASSFYGPF-----REAAGSALKGDRKSYQM
1df1A           FRLWNSQLIRYAGYQMPDGTIRGDAATLEFTQLCIDLGWKPRYGRFDVLPLVLQA---------------
3ddmA           ------------------------GYRAFKLKVGFDDARDVRNALHVRELLGAA----------------
3eisC           REATGLPCTTMST----AVLNGLRALGVRRVALATAYIDDVN-------ERLAAFL---AEESLVPTGRS
1dwxA           FRLWNSQLIRYAGYQMPDGTIRGDAATLEFTQLCIDLGWKPRYGRFDVLPLVLQA---------------
1dwxB           FRLWNSQLIRYAGYQMPDGTIRGDAATLEFTQLCIDLGWKPRYGRFDVLPLVLQA---------------
2b7nA           DAHYPFVLLEASGNISLESINAYAKSGVDAISVGALIHQATFI---------------------------
1ec7C           RRATGLPTATNMIATDWRQMGHTLSLQSVDIPLHFWTMQGSVRVAQMCHEFGLTWGSHSN----------
1dvjC           EIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADN----------------------------
2aqwA           YILSPGIGAQNGDLYKTLKNGYNKDYEKLLINVGRAITKSPDPKKSSE----------------------
3eegA           TKAVTRPTICALTRAKEADINIAGEAFAKRSRIHTGIGSSDESTRENILEAVAAVKQAKKVVHEVEFFCE
3bsmA           RERVMTYAHCTGQTIEDGEVARHVELGYRAVRVQSSTEKYLNHAPKLFAA-----------VRE-----R
3dclB           LVHFEEEVLG--KLVGDKILIKAWGQGLKLLDHPDVKVNIDPDLFE------------KLGIQEKNGKIH
3bjsB           KITPLVPIAAGENHYTRFEFGQMLDAGVQVWQPDLSKCGGITEGIRIAA---------------------
3dipA           RRQTRAPICGGENLAGTRRFHEMLCAAIDFVMLDLTWCGGLSEGRKIAALAHTGPVALMAGLHLALHAPT
3eegB           -----------------ARVEAVIEAGADVVNIPDTTGYLPWQYGERIKY-----------LDNVSNIDK
1dvjB           EIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADN----------------------------
3barA           RTYFPNCYILSPGIGKTLTNGYHKSYEKILINIGRAITKNPYPQKAAQM---------------------
3c56A           -----------------ESCEKAVKAGFTSVMIDASHEENLELTSKVVKMAHNAGVSVEAELGRLMG---
3e7gC           FRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYGRFDVVPLVLQA---------------
3c52B           KRLTNIPLVLHGASAIPDNVRKSYL-DAGGDLKGSKGVPFEFLQESVK----------------------
1ec7B           RRATGLPTATNMIATDWRQMGHTLSLQSVDIPLHFWTMQGSVRVAQMCHEFGLTW---------------
1ad4A           EAIVGFDVKISVDTFRSEVAEACLKLGVDIINDQWAGLYDHRMFQVVAKYDAEIVLMHN-----------
1e0tA           K----IVCTIGPKTESEEMLAKMLDAGMNVMRLNFS----------------------------------
2ashA           VEFLPEDKPRFMGGGSPELILELVDRGVDMFDSVFP----------------------------------
2a5sA           --------------------------------------------------------------------TL
1e0uA           --------TIGPKTESEEMLAKMLDAGMNVMRLNFSHGQRIQNLRNVMSKTG------------------
1d3gA           -----VPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWPPVVGKVKREL-------------------
3bicB           ------ILVMCGGVIPPQDYEFLFEVGVSNVFGP--GTRIPKAAVQVLDD--------------------
2e09B           ----------------------------------------------------------------------
3bw2A           REAVDIPVVAAGGIMRGGQIAAVLAAGADAAQLGTAFLATDE----------------------------


                         +         .         .         .         .         *         .:210
query           TPSGFEITTHGGRQGTGIDAVEWVQQAEELGAGEILLNSMDADGTKSGFDLELIRAVRKAVNVPLIASGG
2a0nA           --GEFMVFTYSGKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGG
3c4uA           -----GVSVEAELGRVLVNPKEAEQFVKESQVAIGTSHGAFKFKGEPKLDFERLQEVKRLTNIPLVLHGA
2e7fA           --DSDTRLAFA---MELVAAADEFGLPMEDLYIDPLILPANVAQDHAPEVLKTLQQIKMLADPAPKTVLG
3cepA           A--ALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGHHLIEKLKEYHAAPALQGFG
1dquA           IDHRDHPFIIGSTNPDIQPLNDLMVMAEQAGKNGAELQAIEDEWLAKAGLKLFNDAVVDAINNSPLPNKK
2ekcB           KAVMKKYVLSFVPLGAPTSTRKRIKLICEAADEMTYFVSVGREKLPYERIKKKVEEYRELCDKPVVVGFG
2bznB           AS--EGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLK-----------------------------
3bofB           --LLMGKDVPKSFEERKEYFEKALKILERHDFSDVIFDPGVLPLGAEGKPVEVLKTIEFISSKGFNTTVG
3dg9A           SLGITGVEAMARVDTATLVDLCVRAFEAAPDSDGILL------SCGGLLTLDAIPEVERRLGVPVVSSSP
2a7rA           AGGVAEYRASEGKTVEVPFKGDVEHTIRDILGG--IRSTCTYVGAAKLKELSRRTTFIR-----------
3bolB           -----------SFEERKEYFEKALKILERHDFSDVIFDPGVLPLGAEGKPVEVLKTIEFISSKGFNTTVG
2a7rB           YAGGVAEYRSEGKTVEVPFKGDVEHTIRDILGG--IRSTCTYVGAAKLKEL---SRRTTFIRV-------
2bznC           AS--EGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLK-----------------------------
2c6qG           ASEG--KTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLK-----------------------------
2bznA           AS--EGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLK-----------------------------
1ad1B           -------RDEPVVEEMLTSLLAQAHQAKIAGIPKIWLDPGIGFAKTRNEEAEVMARLDELVATEYPVLLA
2a7nA           DKANLRDLWPHKLLVKGLLSAEDADRCIAEGADGVILNHGGRQLDCAISPMEVLAQSVAKTGKPVLIDSG
3bolA           ----MGKDVPKSFEERKEYFEKALKILERHDFSDVIFDPGVLPLGAEGKPVEVLKTIEFISSKGFNTTVG
1a50A           ---QAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENHHLIEKLKEYHAAPALQGFG
1ad4B           --------------EMLTSLLAQAHQAKIAGINKIWLDPGIGFAKTRNEEAEVMARLDELVATEYPVLLA
1b3oB           AKSLTQV--------RAMMYSGELKFEKRTSSAQ------------------------------------
3dg6A           FGDAIELYVDGNRGWSAAESLRAMREMADLDLLFA-------EELCPADDVLSRRRLVGQLDMPFIADES
2bleA           KHGVAEYRASEGKTVEVPYKGDVENTILDILGG--LRSTCTYVGAAKLKEL------SRRATFIRVTQQH
2cffA           -----RVAFKGWLAEEEIDPVSLLKRLKEYGLEEIVHTEIEKDGTLQEHDFSLTKKIAIEAEVKVLAAGG
1bksA           SAPFRQAALRHNIAPIFICPDDLLRQVASYGRGYTYLLALPLH--------HLIEKLKEYHAAPALQGFG
1beuA           VPVEESAPFRQAALRHNIAPIFIC--PPNADDDLLRQVASYGRGYTYLPLHHLIEKLKEYHAAPALQGFG
2e09A           ---------------APNTPDERLKVIDDMTTGFVYLVSLYGTEEIPKTAYDLLRRAKRICRNKVAVGFG
2a1yA           -SFVIAGNVGTPEAVRELENAGADATKVGIGPGKVCITKIKTGFGTGGWQLAALRWCAKAASKPIIADGG
3b8iA           LT---IIARTNAELIDVDAVIQRTLAYQEAGADGICLVGV--------RDFAHLEAIAEHLHIPLMLVTY
2bwgB           --HVAEYRASEGKTVEVPYKGDVENTILDILGG--LRSTCTYVGAAKLKELSRRATFIR-----------
1chrA           ------LRVDVNQAWDEQVASVYIPELEALGVELI-------EQPVGRENTQALRRLSDNNRVAIMADES
2a7rC           AMKKYGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTF---------------------
3b8iC           DPALTIIARTNAELIDVDAVIQRTLAYQEAGADGICLVGV--------RDFAHLEAIAEHLHIPLMLVTY
3b8iE           DPALTIIARTNAELIDVDAVIQRTLAYQEAGADGICLVGV--------RDFAHLEAIAEHLHIPLMLVTY
2c6qA           MSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTKLKELSRRTTFIRV-------
2bznD           AS--EGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLK-----------------------------
2c6qB           MSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDIGIRSTCTYVGAAKLKELSRRTTF-------
1ak5A           GVDSYVPYAGKLKDNVEASLNKVKSTMCNCGALTI-----------------------------------
2bwgA           -------VVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGG
3dz1A           TPKVIRQIVDSASCVLKHEDWPGLEKITTLRGFQKDGSLRPLSIL-CGNGGLFLD--FEERGADGATGYC
1b3oA           AKSLTQV--------RAMMYSGELKFEKRTSSAQ------------------------------------
1bwkA           ----FNSMSGGAETGIVAQYAYVAGELEKRAKAGKRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGN
3dipB           -GQRIEIMCELHSLWGTHAAARICNALADYGVLWV------EDPIAKMDNIPAVADLRRQTRAPICGGEN
3ct2A           -GDSASVRVDVNQAWDEAVALRACRILGGNGIDLI-------EQPISRNNRAGMVRLNASSPAPIMADES
3cb3B           LGDAVPLMVDANQQWDRPTAQRMCRIFEPFNLVWI-------EEPLDAYDHEGHAALALQFDTPIATGEM
2clfA           SAPFRQAALRHNIAPIFICPDDLLRQVASYGRGYTYLLSHHLIEK-----------LKEYHAAPALQGFG
2agkA           GR--WIVAMNKWQTLTDLELNADTFRELRKYTNEFLIHAGGIDE---LLVSKLFEWTKDYDDLKIVYAGG
2bwgD           ASEGKTVPYKGDVENTILDILGGLRSTTYVGAAKL-----------------------------------
3cu2A           ---IGACLCPETPISELEPYLDQIDVIQLLTLDPRNGTKYPSELILDRVIQVEKRLGNRRVEKLINIDGS
2a7rD           ----EVPFKGDVEHTIRDILGGIRSTCTYVGAAKL-----------------------------------
2dzwB           ----------------------------------------------------------------------
2dzpA           ---------------APNTPDERLKVIDDMTTGFVYLVSLYGTEEIPKTAYDLLRRAKRICRNKVAVGFG
3eb2B           AQRRVPVVAGVASTSVA-DAVAQAKLYEKLGADGILAILEAYFPLKDAQIESYFRAIADAVEIPVVIYTN
2dzuB           ---------------APNTPDERLKVIDDMTTGFVYLVSLYGTTEIPKTAYDLLRRAKRICRNKVAVGFG
2csbA           DEEDVPAIEVRAVKRNPLQPALYRILVRYGRVD------LPVTVDEVPPEAGEFERLIERYDVPIDE---
2dzwA           ----------------------------------------------------------------------
1dbtB           TSEQIMKDE-LLIEKSLIDTVVHYSKQAEESGLDGVVCSVHEAKAIYQAVSPSFLTVTPGIRMSEDAAND
2e28A           KRTGRTVAILLDTKGPEIRTHNMENGAIELKEGSKLVSEVLGTPEKISVTYPSLIDDVSVGAKILLDDGL
3eisB           --------VEAMARVDTATLVDLCVRAFEAAP--------DSDGSGGLLTLDAIPEVERRLGVPVVSSSP
1bwlA           ----FNSMSGGAETGIVAQYAYVAGELEKRAKAGKRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGN
3b8iB           LT---IIARTNAELIDVDAVIQRTLAYQEAGADGICLVGV--------RDFAHLEAIAEHLHIPLMLVTY
2e09B           ----------------------------------------------------------------------
2dzsB           ----------------------------------------------------------------------
2dztB           ----------------------------------------------------------------------
3cb3A           ----VPLMVDANQQWDRPTAQRMCRIFEPFNLVWI-------EEPLDAYDHEGHAALALQFDTPIATGEM
2bdqA           ---QGLPLVFHAFDVIPKSDQKKSIDQLVALGFTRILLHGSSNGEPIIENIHIKALVEYANNRIEIVGGG
1djqA           HAVGGVDTVYGPGQIEAEVDGQKFVEMADSLVAEWGEDAGPSRFYQQGHTIPWVKLVKQVSKKPVLGVGR
1c29A           -----HNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGPLHLIEKLKEYHAAPALQGFG
1djnA           HAVGGVDTVYGPGQIEAEVDGQKFVEMADSLVDMWGEDAGPSRFYQQGHTIPWVKLVKQVSKKPVLGVGR
2dzuA           ---------------APNTPDERLKVIDDMTTGFVYLVSLYGTEEIPKTAYDLLRRAKRICRNKVAVGFG
2dzxB           ----------------------------------------------------------------------
3b8iD           DPALTIIARTNAELIDVDAVIQRTLAYQEAGADGICLVGV--------RDFAHLEAIAEHLHIPLMLVTY
2du2A           SQNVEDLKGLDLFDNPYGY--EY-----------------------------------------------
2abbA           ----------------------------------------------------------------------
2dzsA           ----------------------------------------------------------------------
2dzpB           ----------------------------------------------------------------------
3c6eA           TMECSPRTLDFEMVLLQMENKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFPHAKKQDVVVLGS
1dbtA           TSEQ-IMKDELLIEKSLIDTVVHYSKQAEESGLDGVVCSVHEAKAIYQAVSPSFLTVTPGIRMSEDAAND
1a53A           ---------------IEINDENDLDIALRIGARFIGINSRDLETLEINKENQRKLISMIPSNVVKVAESG
2b4gB           ----------------------------------------------------------------------
3dgbA           LGDSASVRVDVNQAWDEAVALRACRILGGNGIDLI-------EQPISRNNRAGMVRLNASSPAPIMADES
2clhA           QAA-LRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTG-----HHLIEKLKEYHAAPALQGFG
2an2A           ----------------------------------------------------------------------
2dqwA           HARY-----RDVVAEVKAFLEAQARRALSAGVPQVVLDPGFGFGKLLEHNLALLRRLDEIVALGHPVLVG
3bofA           MGKDVPKSFEERKE----YFEKALKILERHDFSDVIFDPGVLPLGAEGKPVEVLKTIEFISSKGFNTTVG
3dg3A           FGDAIELYVDGNRGWSAAESLRAMREMADLDLLFA-------EELCPADDVLSRRRLVGQLDMPFIADES
3dtvD           -RSLGITGVEAMARVDTATLVDLCVRAFEAAP--------DSDGSGGLLTLDAIPEVERRLGVPVVSSSP
3dfhA           -GNQFHILHDVHERLFPNQAIQFAKEVEQYKPYFI-------EDILPPNQTEWLDNIRSQSSVSLGLGEL
2ehhC           ----RIKVIAGTGGNATHEAVHLTAHAKEVGADGALVVVPYYNKPTQRGLYEHFKTVAQEVDIPIIIYNI
3eb2D           AQRRVPVVAGVAST-SVADAVAQAKLYEKLGADGILAILEAYFPLKDAQIESYFRAIADAVEIPVVIYTN
2dw6A           ---------------NLETGIAYAKMLRDYPLFWY-------EEVGDPLDYALQAALAEFYPGPMATGEN
2e77B           SQNVEDLKGLDLFDNPYGY--EY-----------------------------------------------
3daqA           ----RVPVIAGTGTNDTEKSIQASIQAKALGADAIMLITPYYNKTNQRGLVKHFEAIADAVKLPVVLYN-
3e7gA           DPELFEIPPDLVLEVMEHPKYEW-FRELELKALPAVANMLLEVG--------------------------
1al8A           CRSLKEISRS------------------------------------------------------------
2dqwB           HARYRDVVAEV-----KAFLEAQARRALSAGVPQVVLDPGFGFGKLLEHNLALLRRLD------------
1bkhA           ------VRVDVNQYWDESQAIRACQVLGDNGIDLI-------EQPISRINRGGQVRLNQRTPAPIMADES
3eb2A           STSV-------------ADAVAQAKLYEKLGADGILAILEAYFPLKDAQIESYFRAIADAVEIPVVIYTN
1bkhC           -GDSASVRVDVNQYWDESQAIRACQVLGDNGIDLI-------EQPISRINRGGQVRLNQRTPAPIMADES
2b4gA           ----------------------------------------------------------------------
2dztA           ----------------------------------------------------------------------
2dzvA           ---------------APNTPAERLKVIDDMTTGFVYLVSLYGTEEIPKTAYDLLRRAKRICRNKVAVGFG
3bw4A           -------------EAAGADAV--IAQGVEAGGHQGTHRDSSEDDGAGIGLLSLLAQVREAVDIPVVAAGG
1dqwA           PRGLLMLAELSCKGSLSTGEYTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDAL
2dzbB           VKA---------------FLEAQARRALSAGVPQVVLDPGFGFGKLLEHNLALLRRLDEIVALGHPVLVG
3ct7A           ------LILNPETPVEAMKYYIHKADKITVMTVDPGFAGQPFIPEMLDKLAELKAWREREGLEYEIEVDG
2ehhA           ----RIKVIAGTGGNATHEAVHLTAHAKEVGADGALVVVPYYNKPTQRGLYEHFKTVAQEVDIPIIIYNI
2dzxA           TEIARAAGIKTVFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTEEIPKTAYDLLRRAKRICRNKVAVGFG
2dzvB           ----------------------------------------------------------------------
3c2zA           QAENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVGEGQDEM-FRVLDFSVPMLPDDKPHYLM
2dp3A           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
3b5vA           ---------YGMEPLIKINDENDLDIALRIGARFIGIVSADWETLAINKANQAKLISMIPSNVVKVAAFG
2e68B           ----------------------------------------------------------------------
3c5xA           ----------------------------------------------------------------------
3bjsA           ---------------TMADARRVLPVLAEIQAGWL------EEPFACNDFASYREVAKITPLVPIAAGEN
2c3zA           ---------------IEINDENDLDIALRIGARFIGINSRDLETLEINKENQRKLISMIPSNVVKVAESG
2e77C           ----------------------------------------------------------------------
2djlA           ----------------------------------------------------------------------
3bw2A           -------------EAAGADAV--IAQGVEAGGHQGTHRDSSEDDGAGIGLLSLLAQVREAVDIPVVAAGG
2cu0B           ----------------------------------------------------------------------
3bi8A           VNKRIPVIAGTGSNNTA-ASIAMSKWAESIGVDGLLVITPYYNKTTQKGLVKHFKAVSDAVSTPIIIYNV
2e68A           IAHFDTANEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYLANVNAFYRRCDKLVFGCGG
2e77A           SQNVEDLKGLDLFDNPYGY--EY-----------------------------------------------
1bkhB           -GDSASVRVDVNQYWDESQAIRACQVLGDNGIDLI-------EQPISRINRGGQVRLNQRTPAPIMADES
1eepA           ILTQLKGGLMSGMGYLGAATISDLKI--------------------------------------------
3di1B           VDKRVPVIAGTGTNDTE-KSIQASIQAKALGADAIMLITPYYNKTNQRGLVKHFEAIADAVKLPVVL---
3bw3A           -------------EAAGADAV--IAQGVEAGGDQGTHRDSSEDDGAGIGLLSLLAQVREAVDIPVVAAGG
3di1A           ---RVPVIAGTGTNDTEK-SIQASIQAKALGADAIMLITPYYNKTNQRGLVKHFEAIADAVKLPVVLYNV
1al7A           SLK-------------------------------------------------------------------
1eepB           -SYGMVPYSGKLKDILTQLKGGLMSGMGYLGAATI-----------------------------------
2a6nA           ADGRIPVIAGTGANATA-EAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQI----
2a4aA           ----------------------------------------------------------------------
3c3nA           ----------------------------------------------------------------------
3bggA           ----------------------------------------------------------------------
2a6lA           ADGRIPVIAGTGANATA-EAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNV
3d0cB           -----RATVVAGIGYSVDTAIELGKSAIDSGADCVIHQPVHPYITDAGA-VEYYRNIIEALDAPSI----
2btmA           ----------------------------------------------------------------------
1b9bA           ----------------------------------------------------------------------
2dw7A           -GKDAQLAVDANGRFNLETGIAYAKMLRDYPLFWY-------EEVGDPLDYALQAALAEFYPGPMATGEN
1btmA           ----------------------------------------------------------------------
2cliA           RQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSR------SGVTGHLIEKLKEYHAAPALQGFG
3dwjB           EHPKYEWFQELGLKWYALPAVAN-----------------------------------------------
3bllA           ----------------------------------------------------------------------
3c52A           ----------------------------------------------------------------------
3bpwB           ----------------------------------------------------------------------
3cwoX           FTYSGKKNTGILLR-------DWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGG
3di0A           ---RVPVIAGTGTNDTE-KSIQASIQAKALGADAIMLITPYYNKTNQRGLVKHFEAIADAVKLPVVLYNV
2ekcA           ----------------------------------------------------------------------
2cu0A           SLGAMMKYMKTRKFVPEGVEGVVPYRGTVSEVLYQLVGGLKAGMGYVGARNIRELKEKGEFVIITHAGIK
2djxA           ----------------------------------------------------------------------
1amkA           ----------------------------------------------------------------------
3eisA           ------------ARVDTATLVDLCVRAFEAAP--------DSDGSGGLLTLDAIPEVERRLGVPVVSSSP
3denA           ADGRIPVIAGTGANATA-EAISLTQRFNDSGIVGCLTVTPYWNRPSQEGLYQHFKAIAEH----------
3e7sB           ----------------------------------------------------------------------
2bbfA           ----------------------------------------------------------------------
1aj0A           KTMQEAPKYDDVFAEVNRYFIEQIARCEQAGIAKELLDPGFGFGKNLSHNYSLLARLAEFHHFNLPLLVG
1d3hA           ----------------------------------------------------------------------
1ec7A           ----------------------------------------------------------------------
1a5sA           QAALR-HNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGV----TGAENLIEKLKEYHAAPALQGFG
3e7sA           ----------------------------------------------------------------------
3e7mA           ----------------------------------------------------------------------
2dzbA           ATMMAHARYRDVVAEVKAFLEAQARRALSAGVPQVVLDPGFGFGKLLEHNLALLRRLDEIVALGHPVLVG
3dqsA           ----------------------------------------------------------------------
3dqtB           ----------------------------------------------------------------------
3dwjA           ----------------------------------------------------------------------
3di0B           -ETVEILSQHPYIVAATNDFEYLEEVKKRIDTNSFALYSGNDDNVVEYYQRGGQGVISVIANVPKEFQAL
1efzA           ----------------------------------------------------------------------
3d0cA           Y--------------SVDTAIELGKSAIDSGADCVIHQPVHPYITDAGA-VEYYRNIIEALDAPSIIYFK
3e65B           ----------------------------------------------------------------------
3eahA           ----------------------------------------------------------------------
1dtnA           ----------------------------------------------------------------------
1dvjA           ----------------------------------------------------------------------
3eahB           ----------------------------------------------------------------------
1b4eA           NPMNRR------------EAIRESLLDEAQGADCLMV-------KPAGAYLDIVRELRERTELPIGA---
1df1A           ----------------------------------------------------------------------
3ddmA           ----TPLMADANQGWDLPRARQMAQRLGPAQL------DWLEEPLRADRPAAEWAELAQAAPMPLAGGEN
3eisC           LGITGVEAMARVDTATLVDLCVRAFEAAPDSDGILLSGGL--------LTLDAIPEVERRLGVPVVSSSP
1dwxA           ----------------------------------------------------------------------
1dwxB           ----------------------------------------------------------------------
2b7nA           ----------------------------------------------------------------------
1ec7C           ----------------------------------------------------------------------
1dvjC           ----------------------------------------------------------------------
2aqwA           ----------------------------------------------------------------------
3eegA           DAG-----------RADQAFLARVEAVIEAGADVVNIP--DTTGYLPWQYGERIKYLDNVSNIDKAILSA
3bsmA           FGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWL-------EDCVPAENQESLRLIREHTTTPLAIGEV
3dclB           VPVVAKIPAHGSGIGASSSASTDYDIASNPDLGVADLKLGDIVAIQDHDNSGVGKYRKGAVSIGV-----
3bjsB           ----------------------------------------------------------------------
3dipA           AIFQEVVRASLATWYADL-----VDHLPVIQEGIALA------PTRPGLGTALLPHVRKIAGAVVRESGK
3eegB           AILSAHCHNDLGLA------TANSLAALQNGARQVECTINGIGERAGNTALEEVVAECHKETLGLETGIN
1dvjB           ----------------------------------------------------------------------
3barA           ----------------------------------------------------------------------
3c56A           -------IAVLVNPKEAEQFVKE-SQVDYLAPAIGTSHGAFKFKGEPKLDFERLQEVKRLTNIPLVLHGA
3e7gC           ----------------------------------------------------------------------
3c52B           ----------------------------------------------------------------------
1ec7B           ----------------------------------------------------------------------
1ad4A           ----------------------------------------------------------------------
1e0tA           ----------------------------------------------------------------------
2ashA           ----------------------------------------------------------------------
2a5sA           EEAPFVIVEDIDPLET------CVRNTVPCKINNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTY-----
1e0uA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
3bicB           ----------------------------------------------------------------------
2e09B           -----------------NTPDERLKVIDDMTTGFVYLVSLYGTTEEIPTAYDLLRRAKRICRNKVAVGFG
3bw2A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AGAVEHFXXXXXXXXXXXXXXXXFHFGEITISDVKAELRAKGYPVR
2a0nA           AGKMEHFLEAFLAGADAALAASVFHFREIDVRELKEYLKKHGVNVR
3c4uA           SAIPDNV---------------------------------------
2e7fA           LSNVSQ----------------------------------------
3cepA           ISSPEQ----------------------------------------
1dquA           AAIEKYL---------------------------------------
2ekcB           VS--------------------------------------------
2bznB           ----------------------------------------------
3bofB           LSNLSFGPDRSYYNTAFLVLGISKGLSSAIMNPLDETLMK------
3dg9A           AGFWDA----------------------------------------
2a7rA           ----------------------------------------------
3bolB           LSNLSFLTAFLVLGISKGLSSAIMNPLDETLMKTLNATLV------
2a7rB           ----------------------------------------------
2bznC           ----------------------------------------------
2c6qG           ----------------------------------------------
2bznA           ----------------------------------------------
1ad1B           TSRKRFT---------------------------------------
2a7nA           FRRGSDI---------------------------------------
3bolA           LSNLSFLTAFLVLGISKGLSSAIMNPLDETLMKTLNATLV------
1a50A           ISSPEQ----------------------------------------
1ad4B           TSRKRFTEMMGYDTTPVERDEVTAATTAYGIMKGVRAVRVHN----
1b3oB           ----------------------------------------------
3dg6A           VPTPADVTREVLGGSATAISIKTARTGFTGSTRVHHLAEGLGLDM-
2bleA           ----------------------------------------------
2cffA           ISSENS----------------------------------------
1bksA           ISSPEQ----------------------------------------
1beuA           ISSPEQ----------------------------------------
2e09A           VSKREHVVSLLKEGANGVVVGSALKIIGEKGREATEFLKKKVEELL
2a1yA           IRTNGD----------------------------------------
3b8iA           GNP-------------------------------------------
2bwgB           ----------------------------------------------
1chrA           LSTLASAFDLARDRSVDVFSLKLCNMGGVSTQKIAAVAEASGIASY
2a7rC           ----------------------------------------------
3b8iC           GNP-------------------------------------------
3b8iE           GNP-------------------------------------------
2c6qA           ----------------------------------------------
2bznD           ----------------------------------------------
2c6qB           ----------------------------------------------
1ak5A           ----------------------------------------------
2bwgA           CTCPGD----------------------------------------
3dz1A           FPDLVDV---------------------------------------
1b3oA           ----------------------------------------------
1bwkA           FALHPEVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDR-
3dipB           LAGTRRFHEMLCADAIDFVMLDLTWCGGLSEGKIAALAETHARPLA
3ct2A           IECVEDA---------------------------------------
3cb3B           LTSAAEHGDLIRHRAADYLMPDAPRVGGITPFKIASLAEHAGLMLA
2clfA           ISSPEQ----------------------------------------
2agkA           AKSVDDLLSHGKVDLTFGSSLDIFGGNLVKFEDCCRWNEKQG----
2bwgD           ----------------------------------------------
3cu2A           TLELAKY---------------------------------------
2a7rD           ----------------------------------------------
2dzwB           ----------------------------------------------
2dzpA           VSKREH----------------------------------------
3eb2B           ----------------------------------------------
2dzuB           VSKREH----------------------------------------
2csbA           ----------------------------------------------
2dzwA           ----------------------------------------------
1dbtB           QVRVAT----------------------------------------
2e28A           ----------------------------------------------
3eisB           AGFWDA----------------------------------------
1bwlA           FALHPE----------------------------------------
3b8iB           GNP-------------------------------------------
2e09B           ----------------------------------------------
2dzsB           ----------------------------------------------
2dztB           ----------------------------------------------
3cb3A           LTSAAEHGDLIRHRAADYLMPDAPRVGGITPFKIASLAEHAGLMLA
2bdqA           ----------------------------------------------
1djqA           YTDPEKM---------------------------------------
1c29A           ISSPEQ----------------------------------------
1djnA           YTDPEKM---------------------------------------
2dzuA           ----------------------------------------------
2dzxB           ----------------------------------------------
3b8iD           GNP-------------------------------------------
2du2A           ----------------------------------------------
2abbA           ----------------------------------------------
2dzsA           ----------------------------------------------
2dzpB           ----------------------------------------------
3c6eA           QEGAMH--TALTGATEIQMSSGNLLFTGHLKCRLRMDLQLKG----
1dbtA           QVRVAT----------------------------------------
1a53A           ----------------------------------------------
2b4gB           ----------------------------------------------
3dgbA           IECVEDA---------------------------------------
2clhA           ISSPEQ----------------------------------------
2an2A           ----------------------------------------------
2dqwA           LSRKRTI---------------------------------------
3bofA           LSNLSFGPDRSYYNTAFLVLGISKGLSSAIMNPLDETLMK------
3dg3A           VPTPADVTREVLGGSATAISIKTARTGFTGSTRVHHLAEGLGLDMV
3dtvD           AGFWDA----------------------------------------
3dfhA           FNNPEEWKSLIANRRIDFIRCHVSQIGGITPAKLGHLCQNFGVRIA
2ehhC           PSRTCVE---------------------------------------
3eb2D           PQFQRS----------------------------------------
2dw6A           LFSHQDAYGGMRPDRDWLQFDCALSYGLCEYQRTLEVLKTHGWSPS
2e77B           ----------------------------------------------
3daqA           ----------------------------------------------
3e7gA           ----------------------------------------------
1al8A           ----------------------------------------------
2dqwB           ----------------------------------------------
1bkhA           IESVEDAFSLAADGAASIFALKIAKNGGPRAVRTAQIAEAAGIGLY
3eb2A           PQFQRS----------------------------------------
1bkhC           IESVEDAFSLAADGAASIFALKIAKNGGPRAVRTAQIAEAAGIGLY
2b4gA           ----------------------------------------------
2dztA           ----------------------------------------------
2dzvA           VSKREH----------------------------------------
3bw4A           IM--------------------------------------------
1dqwA           GQQYRTVDDVVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAY
2dzbB           LSRKRTI---------------------------------------
3ct7A           SCNQAT----------------------------------------
2ehhA           PSRTCVE---------------------------------------
2dzxA           VSKREH----------------------------------------
2dzvB           ----------------------------------------------
3c2zA           GV--------------------------------------------
2dp3A           ----------------------------------------------
3c61A           ----------------------------------------------
3b5vA           ISARNE----------------------------------------
2e68B           ----------------------------------------------
3c5xA           ----------------------------------------------
3bjsA           HYTRFEFGQMLDAGAVQVWQPDLSKCGGITEGRIAAMASAYRIP--
2c3zA           ISERNE----------------------------------------
2e77C           ----------------------------------------------
2djlA           ----------------------------------------------
3bw2A           IM--------------------------------------------
2cu0B           ----------------------------------------------
3bi8A           PGRTGL----------------------------------------
2e68A           VYSGED----------------------------------------
2e77A           ----------------------------------------------
1bkhB           IESVEDAFSLAADGAASIFALKIAKNGGPRAVRTAQIAEAAGIGLY
1eepA           ----------------------------------------------
3di1B           ----------------------------------------------
3bw3A           IM--------------------------------------------
3di1A           PSRTNM----------------------------------------
1al7A           ----------------------------------------------
1eepB           ----------------------------------------------
2a6nA           ----------------------------------------------
2a4aA           ----------------------------------------------
3c3nA           ----------------------------------------------
3bggA           ----------------------------------------------
2a6lA           PSHTGC----------------------------------------
3d0cB           ----------------------------------------------
2btmA           ----------------------------------------------
1b9bA           ----------------------------------------------
2dw7A           LFSHQDAYGGMRPDRDWLQFDCALSYGLCEYQRTLEVLKTHGWSPS
1btmA           ----------------------------------------------
2cliA           ISSPEQ----------------------------------------
3dwjB           ----------------------------------------------
3bllA           ----------------------------------------------
3c52A           ----------------------------------------------
3bpwB           ----------------------------------------------
3cwoX           AGKMEHFLEAFLAGADAALAASVFHFREIDVRELKEYLKKHGVNVR
3di0A           PSRTNM----------------------------------------
2ekcA           ----------------------------------------------
2cu0A           ESHPHD----------------------------------------
2djxA           ----------------------------------------------
1amkA           ----------------------------------------------
3eisA           AGF-------------------------------------------
3denA           ----------------------------------------------
3e7sB           ----------------------------------------------
2bbfA           ----------------------------------------------
1aj0A           MSRKSMI---------------------------------------
1d3hA           ----------------------------------------------
1ec7A           ----------------------------------------------
1a5sA           ISSPEQ----------------------------------------
3e7sA           ----------------------------------------------
3e7mA           ----------------------------------------------
2dzbA           ----------------------------------------------
3dqsA           ----------------------------------------------
3dqtB           ----------------------------------------------
3dwjA           ----------------------------------------------
3di0B           YDAQQS-GLDIQDQFKPIGTLLSALSVDINPIPIKALTSYLGFGN-
1efzA           ----------------------------------------------
3d0cA           DA--------------------------------------------
3e65B           ----------------------------------------------
3eahA           ----------------------------------------------
1dtnA           ----------------------------------------------
1dvjA           ----------------------------------------------
3eahB           ----------------------------------------------
1b4eA           ----------------------------------------------
1df1A           ----------------------------------------------
3ddmA           IAGVAAFETALAARSLRVMQPDLAKWGGFSGCPVARAVVAAGLR--
3eisC           AGF-------------------------------------------
1dwxA           ----------------------------------------------
1dwxB           ----------------------------------------------
2b7nA           ----------------------------------------------
1ec7C           ----------------------------------------------
1dvjC           ----------------------------------------------
2aqwA           ----------------------------------------------
3eegA           HC--------------------------------------------
3bsmA           FNSIHDCRELIQNQWIDYIRMPLTHGGGITARRVADLASLYHVRTG
3dclB           ----------------------------------------------
3bjsB           ----------------------------------------------
3dipA           P---------------------------------------------
3eegB           HKKLV-----------------------------------------
1dvjB           ----------------------------------------------
3barA           ----------------------------------------------
3c56A           SAIPDNV---------------------------------------
3e7gC           ----------------------------------------------
3c52B           ----------------------------------------------
1ec7B           ----------------------------------------------
1ad4A           ----------------------------------------------
1e0tA           ----------------------------------------------
2ashA           ----------------------------------------------
2a5sA           ----------------------------------------------
1e0uA           ----------------------------------------------
1d3gA           ----------------------------------------------
3bicB           ----------------------------------------------
2e09B           VSKREH----------------------------------------
3bw2A           ----------------------------------------------