[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ55274.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3b6mA.bssp"
#ERROR : Can't open dsspfile "3b6mB.bssp"
#ERROR : Can't open dsspfile "2b3dB.bssp"
#ERROR : Can't open dsspfile "3b6iA.bssp"
#ERROR : Can't open dsspfile "2b3dA.bssp"
#ERROR : Can't open dsspfile "2amjD.bssp"
#ERROR : Can't open dsspfile "2arkF.bssp"
#ERROR : Can't open dsspfile "2arkA.bssp"
#ERROR : Can't open dsspfile "2arkE.bssp"
#ERROR : Can't open dsspfile "2amjC.bssp"
#ERROR : Can't open dsspfile "2arkB.bssp"
#ERROR : Can't open dsspfile "1aktA.bssp"
#ERROR : Can't open dsspfile "3edoB.bssp"
#ERROR : Can't open dsspfile "2a5lB.bssp"
#ERROR : Can't open dsspfile "2arkC.bssp"
#ERROR : Can't open dsspfile "2d5iA.bssp"
#ERROR : Can't open dsspfile "3brcA.bssp"
#ERROR : Can't open dsspfile "3edoA.bssp"
#ERROR : Can't open dsspfile "1dxqA.bssp"
#ERROR : Can't open dsspfile "3d7nA.bssp"
#ERROR : Can't open dsspfile "3brcB.bssp"
#ERROR : Can't open dsspfile "1akwA.bssp"
#ERROR : Can't open dsspfile "2a5lA.bssp"
#ERROR : Can't open dsspfile "1bu5A.bssp"
#ERROR : Can't open dsspfile "1d4aA.bssp"
#ERROR : Can't open dsspfile "2bmvA.bssp"
#ERROR : Can't open dsspfile "1azlA.bssp"
#ERROR : Can't open dsspfile "1c7eA.bssp"
#ERROR : Can't open dsspfile "1akrA.bssp"
#ERROR : Can't open dsspfile "1akqA.bssp"
#ERROR : Can't open dsspfile "1czhA.bssp"
#ERROR : Can't open dsspfile "2amjB.bssp"
#ERROR : Can't open dsspfile "1ag9A.bssp"
#ERROR : Can't open dsspfile "2amjA.bssp"

## Summary of PDB Search
:227
    1e-13  13%  3b6mA  [x.x.x] FLAVOPROTEIN WRBA
    2e-13  12%  3b6mB  [x.x.x] FLAVOPROTEIN WRBA
    6e-12  13%  2b3dB  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    3e-11  15%  3b6iA  [x.x.x] FLAVOPROTEIN WRBA
    4e-11  13%  2b3dA  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    1e-09  10%  2amjD  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    1e-09  21%  2arkF  [x.x.x] FLAVODOXIN
    2e-09  21%  2arkA  [x.x.x] FLAVODOXIN
    3e-09  21%  2arkE  [x.x.x] FLAVODOXIN
    1e-08  10%  2amjC  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    1e-08  21%  2arkB  [x.x.x] FLAVODOXIN
    2e-08  15%  1aktA  [x.x.x] FLAVODOXIN
    3e-08  12%  3edoB  [x.x.x] PUTATIVE TRP REPRESSOR BINDING PROTEIN
    4e-08  21%  2a5lB  [x.x.x] TRP REPRESSOR BINDING PROTEIN WRBA
    5e-08  21%  2arkC  [x.x.x] FLAVODOXIN
    9e-08  14%  2d5iA  [x.x.x] AZO REDUCTASE
    9e-08  16%  3brcA  [x.x.x] CONSERVED PROTEIN OF UNKNOWN FUNCTION
    1e-07  13%  3edoA  [x.x.x] PUTATIVE TRP REPRESSOR BINDING PROTEIN
    5e-07  20%  1dxqA  [c.23.5] QUINONE REDUCTASE
    5e-07  17%  3d7nA  [x.x.x] FLAVODOXIN, WRBA-LIKE PROTEIN
    1e-06  17%  3brcB  [x.x.x] CONSERVED PROTEIN OF UNKNOWN FUNCTION
    4e-06  15%  1akwA  [x.x.x] FLAVODOXIN
    4e-06  23%  2a5lA  [x.x.x] TRP REPRESSOR BINDING PROTEIN WRBA
    1e-05  15%  1bu5A  [c.23.5] PROTEIN (FLAVODOXIN)
    1e-05  20%  1d4aA  [c.23.5] QUINONE REDUCTASE
    2e-05  13%  2bmvA  [x.x.x] FLAVODOXIN
    2e-05  15%  1azlA  [x.x.x] FLAVODOXIN
    5e-05  15%  1c7eA  [c.23.5] FLAVODOXIN
    2e-04  15%  1akrA  [x.x.x] FLAVODOXIN
    2e-04  15%  1akqA  [x.x.x] FLAVODOXIN
    3e-04  15%  1czhA  [c.23.5] FLAVODOXIN
    5e-04  18%  2amjB  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    6e-04  10%  1ag9A  [c.23.5] FLAVODOXIN
    7e-04  23%  2amjA  [x.x.x] MODULATOR OF DRUG ACTIVITY B
:227

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxRLXXXXASARKGRNGGCVAQWFLEQTTGRSELEVDTVDTAVFXXXXXX
3b6mA           ----------------------------------------------------------------------
3b6mB           ---------------------------------------MARAVAEGASKVDGAEVVVKRVPETMPPQLF
2b3dB           ----------------------------GAKKFAHSNGQLNDTLTEVA--DGTLRDLGHDVR--------
3b6iA           ----------------------------------------------------------------------
2b3dA           ----------------------------GAKKFAHSNGQLNDTLTEVA--DGTLRDLGHDVRIVRADS--
2amjD           ----------------------------------------------------------------------
2arkF           ----------------------------------------------------------------------
2arkA           ----------------------------------------------------------------------
2arkE           ----------------------------------------------------------------------
2amjC           ----------------------------------------------------------------------
2arkB           ----------------------------------------------------------------------
1aktA           ----------------------------------------------------------------------
3edoB           ----------------------------------------------------------------------
2a5lB           ----------------------------------------------------------------------
2arkC           ----------------------------------------------------------------------
2d5iA           ----------------------KVLVLKSSILAGYQSNQLSDYFWREKHSADEITVDGELVGALRPSDAP
3brcA           ----------------------------------------------------------------------
3edoA           ----------------------------------------------------------------------
1dxqA           ----------------------------------------------------------------------
3d7nA           ----------------------------------------------------------------------
3brcB           ----------------------------------------------------------------------
1akwA           ----------------------------------------------------------------------
2a5lA           ----------------------------------------------------------------------
1bu5A           ----------------------------------------------------------------------
1d4aA           ----------------------------------------------------------------------
2bmvA           ----------------------------------------------------------------------
1azlA           ----------------------------------------------------------------------
1c7eA           ----------------------------------------------------------------------
1akrA           ----------------------------------------------------------------------
1akqA           ----------------------------------------------------------------------
1czhA           ----------------------------------------------------------------------
2amjB           ----------------------------------------------------------------------
1ag9A           ----------------------------------------------------------------------
2amjA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXTTVQVLSRLTPRLRRADMFVFVVPEYNRSFPASVKSLIDWHTAEWEAKPVGFVSYGGRSGGLRA
3b6mA           -----------PVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASKLASVFSSTGTGGGQQT
3b6mB           EKAGGKTQTAP-VATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASKLASVFSSTGTGGGQQT
2b3dB           --IVRADSDYDVKAEVQNFLWADVVIWQMPGWWMGAPWTVKKYIDGHGTLYASDGRTDPSKKYGSGGLVQ
3b6iA           -----------PVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASKLASVFSSTGTGGGQEV
2b3dA           --------DYDVKAEVQNFLWADVVIWQMPGWWMGAPWTVKKYIDDVFTEGHGRTRKDPSKKYGSGGLVQ
2amjD           -------------AEVQNFLWADVVIWQP--GWWGAPWTVKKYIDDVFTEGHGGKKYSLTWNAPEAFTEK
2arkF           ------------------VLWADGLAVGSPTNG-LVSWKKRFFDDVLGDLWGEKIACFSSSGGWGGGNEV
2arkA           ------------------VLWADGLAVGSPTNG-LVSWKKRFFDDVLGDLWGEKIACFSSSGGWGGGNEV
2arkE           ---------------------ADGLAVGSPTNG-LVSWKKRFFDDVLGDLWGEKIACFSSSGGWGGGNEV
2amjC           -------------AEVQNFLWADVVIW--QPGWWGAPWTVKKYIDDVFTEGHGGKKYSLTWNAPEAFTEK
2arkB           ------------------VLWADGLAVGSPTNG-LVSWKKRFFDDVLGDLWGEKIACFSSSGGWGGGNEV
1aktA           ------------------FEGFDLVLLGCSTWNDDSIELQDDFIPLFDSLEETRKVACFGCGDSSYECGA
3edoB           -----------IQLDNIDYNNYDLILIGSPVWSGYPATPIKTLLDQK--NYRGEVASFFTSAGTNHKADG
2a5lB           -----------LYATLEDLKNCAGLALGSPTRFGN-ASPLKYFLDWLTGSLVGKPAAFTSTASLHGGLLP
2arkC           ------------------VLWADGLAVGSPTNG-LVSWKKRFFDDVLGDLWGEKIACFSSSGGWGGGNEV
2d5iA           LTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTKKAIVITSRGGIHKDLV
3brcA           ------------------LREAEHLQFNTNWADLTRPAVTKALALGRLGVPGSGSLLVIRGRLLSAASPP
3edoA           -----------IQLDNIDYNNYDLILIGSPVWSGYPATPIKTLLDQK--NYRGEVASFFTSAGTNHK---
1dxqA           ------------VAEHKKLEAADLVIFQFPLQWFGVPAILKGWFERVLVAGFAYTYAA------------
3d7nA           ------------------LDAADAIIFGTPTYG-GPSWQFKKFADASSKPWFSKVFGGFTNSASLNGLNT
3brcB           ------------------LREAEHLQFNTNWADLTRPAVTKALALDISGADLVGSLLIDSRGRLLSAASP
1akwA           ------------------FEGFDLVLLGCSTWLDDSIELQDDFIPLFDSLEETRKVACFGCGDSSYECGA
2a5lA           --------------TLEDLKNCAGLALGSPTRFGN-ASPLKYFLDWLTGSLVGKPAAFTSTASLHGG---
1bu5A           ------------------FEGFDLVLLGCSTWGDDSIELQDDFIPLFDSLEETRKVACFGCGDSSYFCGA
1d4aA           -----------------KLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAKKAVLSITTGGSGSMYS
2bmvA           ------------------FNSFTKVILVAPTAGGDLQTDWEDFLGTLEASDANKTIGLVGLGDQDTYTFA
1azlA           ------------------FEGFDLVLLGCSTWVDDSIELQDDFIPLFDSLEETRKVACFGCGDSSYECGA
1c7eA           ------------------FEGFDLVLLGCSTWGDDSIELQDDFIPLFDSLEETRKVACFGCGESSYECGA
1akrA           ------------------FEGFDLVLLGCSTWADDSIELQDDFIPLFDSLEETRKVACFGCGDSSYECGA
1akqA           ------------------FEGFDLVLLGCSTWGDDSIELQDDFIPLFDSLEETRKVACFGCGASSYFCGA
1czhA           ------------------LNAYDYLIIGCPTWGGELQSDWEGIYDDLDSVNQGKKVAYFGAGDQVGYSDA
2amjB           ------------------FLWADVVIWQPG--WWGAPWTVKKYIDDVFTEGHGDGRTKYGSGGLVQGKYL
1ag9A           ------------------LEAYDILLLGIPTWYYEAQCDWDDFFPTLEEIDNGKLVALFGCGDQEDYCDA
2amjA           --------------EVQNFLWADVVIW--QPGWWGAPWTVKKYIDDVFTEGHGTLYASDGRKYGSGGLV-


                         +         .         .         .         .         *         .:210
query           VEHLGQVFTELHAVTVRNTVSFHSVEEQFDSEGRPKSPEACAVAAQNLLDQLVWWGRALRRAREESPxxx
3b6mA           ITSTWTTLAHHGMVIVPIGYAAQGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKLN----------
3b6mB           ITSTWTTLAHHGMVIVPIGYAAQEGGTPYGATTIAGGDGSRQPIARYQGEYVAGLAVKLN----------
2b3dB           GKKYMLSLTWNAPMEAFTEKDQFFHGVGVDGVYLPFHKANQFLGME-PLPTFIANDVIKMPDVPR-----
3b6iA           IVPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKLN----------
2b3dA           GKKYMLSLTWNAPMEAFTEKDQFFHGVGVDGVYLPFHKANQFLGMEPLPTFIANDVIKMPDVPRY-----
2amjD           DQFFHGVGVDGVYLPFHKANQFEPLPTFIANDVIKPDVPRYTEEYRKHLVEIF-----------------
2arkF           ACSILTLNFGFLVFGVTDYVGKFTLHYGAVVAGEPRSEEEKE-ACRRLGRRLAEWVAIFVDGRKE-----
2arkA           ACSILTLNFGFLVFGVTDYVGKFTLHYGAVVAGEPRSEEEKE-ACRRLGRRLAEWVAIFVDGRKE-----
2arkE           ACSILTLNFGFLVFGVTDYVGKFTLHYGAVVAGEPRSEEEKE-ACRRLGRRLAEWVAIFVDGRKE-----
2amjC           DQFFHGVGVDGVYLPFHKANQFLPLPTFIANDVIKPDVPRYTEEYRKHLVEIF-----------------
2arkB           ACSILTLNFGFLVFGVTDYVGKKFTLHYGAVVGEPRSEEEKE-ACRRLGRRLAEWVAIFVDGRKE-----
1aktA           VDAIEEKLKNLGAEIV-----QDGLRIDGDPRA---ARDDIVGWAHDVRGAI------------------
3edoB           LNVIGVARDD------------------------------------------------------------
2a5lB           LLHHGLVLGIPYSEP---TPYGASHFAGADGKRSL-DEHELT-LCRALGKRLAETAGKL-----------
2arkC           ACSILTLNFGFLVFGVTDYVGKFTLHYGAVVAGEPRSEEEKE-ACRRLGRRLAEWVAIFVDGRKE-----
2d5iA           TPYLSTFLGFIGITDVKFVFAEG---IAYGPE--------------------------------------
3brcA           HVIHSEVREAVRSETH------------------------------------------------------
3edoA           ----------------------------------------------------------------------
1dxqA           ----------------------------------------------------------------------
3d7nA           LQYLVLLAGQHGGLWVSLGYIA--PAQSESVGDL--------ETARLYGARVANVARQHK----------
3brcB           PHVIHSEVREAV----------------------------------------------------------
1akwA           VDAIEEKLKNLGAEIVRIDGDPRAARDDI-----------------------------------------
2a5lA           ----------------------------------------------------------------------
1bu5A           VDAIEEKLKNLGAEIVRIDGDPRAARDDI-----------------------------------------
1d4aA           LQGIHGDMNVILWPIQSGILHFFQVLEPQLTYSIGHTPAD---ARIQILEG---WKKRLENIWDETP---
2bmvA           EGIFHIYEKAKAGKVVGQTSTDGYHFEASK----------------------------------------
1azlA           VDAIEEKLKNLGAEIVRIDGDPRAARDDI-----------------------------------------
1c7eA           VDAIEEKLKNLGAEIVRIDGDPRAARDDIV----------------------------------------
1akrA           VDAIEEKLKNLGAEIVRIDGDPRAARDDI-----------------------------------------
1akqA           VDAIEEKLKNLGAEIVRIDGDPRAARDDI-----------------------------------------
1czhA           MGILEEKISSLGSQTVGYWPIE---GYDFNESKAVRNNQFVGLAIDEDNQ--------------------
2amjB           SLTWNAPEAFTEKDQFFHGVGVDGVYLPFH----------------------------------------
1ag9A           LGTIRDIIEPRGATIVGHWPTAFEASKGLADDDHFVGLAID-----------------------------
2amjA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxx
3b6mA           -----------------
3b6mB           -----------------
2b3dB           -----------------
3b6iA           -----------------
2b3dA           -----------------
2amjD           -----------------
2arkF           -----------------
2arkA           -----------------
2arkE           -----------------
2amjC           -----------------
2arkB           -----------------
1aktA           -----------------
3edoB           -----------------
2a5lB           -----------------
2arkC           -----------------
2d5iA           -----------------
3brcA           -----------------
3edoA           -----------------
1dxqA           -----------------
3d7nA           -----------------
3brcB           -----------------
1akwA           -----------------
2a5lA           -----------------
1bu5A           -----------------
1d4aA           -----------------
2bmvA           -----------------
1azlA           -----------------
1c7eA           -----------------
1akrA           -----------------
1akqA           -----------------
1czhA           -----------------
2amjB           -----------------
1ag9A           -----------------
2amjA           -----------------