[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ55328.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3ckmA.bssp"
#ERROR : Can't open dsspfile "3eafA.bssp"
#ERROR : Can't open dsspfile "2e4yB.bssp"
#ERROR : Can't open dsspfile "2e4uB.bssp"
#ERROR : Can't open dsspfile "2e4zA.bssp"
#ERROR : Can't open dsspfile "2e4vA.bssp"
#ERROR : Can't open dsspfile "2e4uA.bssp"
#ERROR : Can't open dsspfile "2e4vB.bssp"
#ERROR : Can't open dsspfile "1dp4A.bssp"
#ERROR : Can't open dsspfile "1dp4C.bssp"
#ERROR : Can't open dsspfile "3cznA.bssp"
#ERROR : Can't open dsspfile "3bilA.bssp"
#ERROR : Can't open dsspfile "1dbpA.bssp"
#ERROR : Can't open dsspfile "1drkA.bssp"
#ERROR : Can't open dsspfile "1efaC.bssp"
#ERROR : Can't open dsspfile "1efaA.bssp"
#ERROR : Can't open dsspfile "1efaB.bssp"
#ERROR : Can't open dsspfile "1bdhA.bssp"

## Summary of PDB Search
:392
    3e-29  16%  3ckmA  [x.x.x] YRAM (HI1655)
    8e-29  18%  3eafA  [x.x.x] ABC TRANSPORTER, SUBSTRATE BINDING PROTEIN
    1e-21  14%  2e4yB  [x.x.x] METABOTROPIC GLUTAMATE RECEPTOR 3
    9e-17  18%  2e4uB  [x.x.x] METABOTROPIC GLUTAMATE RECEPTOR 3
    1e-16  15%  2e4zA  [x.x.x] METABOTROPIC GLUTAMATE RECEPTOR 7
    2e-16  20%  2e4vA  [x.x.x] METABOTROPIC GLUTAMATE RECEPTOR 3
    1e-15  18%  2e4uA  [x.x.x] METABOTROPIC GLUTAMATE RECEPTOR 3
    1e-15  20%  2e4vB  [x.x.x] METABOTROPIC GLUTAMATE RECEPTOR 3
    5e-15  11%  1dp4A  [c.93.1] ATRIAL NATRIURETIC PEPTIDE RECEPTOR A
    6e-15  11%  1dp4C  [c.93.1] ATRIAL NATRIURETIC PEPTIDE RECEPTOR A
    1e-09  13%  3cznA  [x.x.x] ALPHA-MANNOSIDASE 2
    2e-06   8%  3bilA  [x.x.x] PROBABLE LACI-FAMILY TRANSCRIPTIONAL REGULATOR
    6e-05  16%  1dbpA  [x.x.x] D-RIBOSE-BINDING PROTEIN
    2e-04  16%  1drkA  [x.x.x] D-RIBOSE-BINDING PROTEIN
    3e-04   9%  1efaC  [a.35.1 - c.93.1] LAC REPRESSOR
    4e-04  10%  1efaA  [a.35.1 - c.93.1] LAC REPRESSOR
    5e-04  11%  1efaB  [a.35.1 - c.93.1] LAC REPRESSOR
    9e-04  13%  1bdhA  [a.35.1 - c.93.1] PROTEIN (PURINE REPRESSOR)
:392

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGEGLPDTIKIMSIKEMTGPVSFAGENSTKGIDL
3ckmA           ---------------------------------------------QIGLLLPLSGDGQILGTTIQSGFND
3eafA           -------------------------------------------TINVGLLVDETGPTSDVGKGYSLGAEL
2e4yB           -----------------------------------------PINEKGTGTEECGRINEDRGIQRLEAMLF
2e4uB           -----------------------------------------PINEKGTGTEECGRINEDRGIQRLEAMLF
2e4zA           -------------------------------------GGLFPVHAKGPSGVPCGDIKRENGIHRLEAMLY
2e4vA           -----------------------------------------PINEKGTGTEECGRINEDRGIQRLEAMLF
2e4uA           -----------------------------------------PINEKGTGTEECGRINEDRGIQRLEAMLF
2e4vB           -----------------------------------------PINEKGTGTEECGRINEDRGIQRLEAMLF
1dp4A           -------------------------------------------DLTVAVVLPLTNTSYPWSWARVGAVEL
1dp4C           -------------------------------------------DLTVAVVLPLTNTSYPWSWARVGPVEL
3cznA           --------------------------------------------VPPMGLATYVLTISDSKPEHTSYASN
3bilA           ----------------------------------------------------------------------
1dbpA           ----------------------------------------------------------------------
1drkA           ----------------------------------------------------------------------
1efaC           ----------------------------------------------------------------------
1efaA           ----------------------------------------------------------------------
1efaB           ----------------------------------------------------------------------
1bdhA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AVEQINEQGFLGDTKLEIDLKDASDSTQEAASLATQAVSDKSYSAILGPGLSSQASAISPIAEKGEIPVI
3ckmA           AKG---------NSTIPVQVFDTSNSVQDIIAQAKQAGIK----TLVGPLLKQNLDVILADPAQIQGDVL
3eafA           AFKYFNEKGIYTRVNINYIKRDYAYNPTTAEEYYREFRDRYGVIAIIGWG-TADTEKLSDQVDTDKITYI
2e4yB           AIDEINKDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLIAGVIGGSYSSVSIQVANLLRLFQIPQI
2e4uB           AIDEINKDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLIPLVIGGSYSSVSIQVANLL--------
2e4zA           ALDQINSDNLLPNVTLGARILDTCSRDTYALEQSLTFVQALIQKGVIGASGSSVSIMVANILRLFQIPQI
2e4vA           AIDEINKDNLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLIPLVIGGSYSSVSIQVANLLRLFQIPQI
2e4uA           AIDEINKDNLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLIPLVIGGSYSSVSIQVANLL--------
2e4vB           AIDEINKDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLIPLVIGGSYSSVSIQVANLLRLFQIPQI
1dp4A           ALARVKARDLLPGWTVRMVLGSSENAAGVCSDTAAPLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLL
1dp4C           ALARVKARDLLPGWTVRMVLGSSENAAGVCPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLL
3cznA           LLLRKNPTSLPLGQYPEDVKFGDPREISLRVGNGPTLAFSEQ-----GLLKSIQLTQDSPHVPVHFKFLK
3bilA           ----------------ATIITNSNEDATTMSGSLEFLTSHGVDGIICVPNEECANQLE---DLQKQMPVV
1dbpA           ----------ADKLGYNLVVLDSQNNPAKELANVQDLTVRGTKILLINPTDSDAVDNAVKMANQANIPVI
1drkA           ----------ADKLGYNLVVLDSQNNPAKELANVQDLTVRGTKILLINPTDSDAVGNAVKMANQANIPVI
1efaC           -----------------VVSMVERSGVEACKT-AVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPAL
1efaA           ---------------------VERSGVEACKTAVHNLLA-QRVSGLIINYPLDDQDAIAVEAACTNVPAL
1efaB           --------------------------------------------GLIINYPLDDQDAIAVEAACTNVPAL
1bdhA           ----------CFQKGYTLILGNAWNNLEKQRA-YLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMV


                         +         .         .         .         .         *         .:210
query           YYQAGSDGVLVGDYTYRVTAPAASYYHIIGDYLAEKKVKTAAVLYTSGNPTLTELGEKAVPGVIEENGVT
3ckmA           ALNATPN-SRAIPQLCYYGLSPEDEAESAANKWN--DGVRNPLVAP--QNDLGQRVGNAFNVRWQQLAGT
3eafA           SA-SYSAKLLVKPFNFYPAPDYSTQACSGLAFLASEFGQGKLALAYDSKVAYSRSPIGAIKKAAPSLGLQ
2e4yB           SYASTSAKLSDKSYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGI--EAFEQEARLRNIC
2e4uB           ----------------------------------------------------------------------
2e4zA           SYASTAPELSDDRFFSRVVPPDSFQAQAMVDIVKALGWNYVSTLASEGSYGEKGV--ESFTQISKEAGGL
2e4vA           SY--------------------------------------------------------------------
2e4uA           ----------------------------------------------------------------------
2e4vB           SY--------------------------------------------------------------------
1dp4A           TAGAPALGIGVKDLTTRTGPSHVKLGDFVTALHRRLGWEHQALVLYLGDDRPCFFIVEGLYMRVRERLNI
1dp4C           TAGAPALGIDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQALVLYLGDDRPCFFIVEGLYMRVRERLNI
3cznA           YGVRSH-GDRSGAYLFLPNGPASPVELGQPVVLVTKLESSVSVGLPSVVHQTIMRGGA----PEIRNLVD
3bilA           LVDRELPG----DTIPTATSNPQPGIAAAVELLAHNNALPIGYLSGPMDTSTGRERLEDFKAACANSKIG
1dbpA           TLDRQATK---GEVVSHIASDNVLGGKIAGDYIAKKAGEGAKVIELQGIAGTARERGEGFQQAVAAHKFN
1drkA           TLDRQATK---GEVVSHIASDNVLGGKIAGDYIAKKAGEGAKVIELQGTAATARERGEGFQQAVAAHKFN
1efaC           F-----LDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQ
1efaA           F-----LDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQ
1efaB           F-----LDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQ
1bdhA           VMDWGEAK---ADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIK


                         .         .         .         +         .         .         .:280
query           IKRSDTVSNDTQDFTAVTSEIIKADPDAVFLLLLGPQNPRAVSQLKQKGYDGEIIGMTTMGAGNLETAGE
3ckmA           DANIRYYNLPADVTYFVQ--ENNSNTTALYAVA-SPTELAEKGYLTNIVPNLAIYASSSASATNTNTDFI
3eafA           VVGDYDLPRATEADAERIARELAADPDYVWCGNTIS-SCSLLGRAAKVGLDAFLLTNWGFDERSPQLIGE
2e4yB           IATAEKVGRSNIRKSYIRELLQKPNARVVVLFMRSDDSRELIAAANRVNASFTWVASDGWGAQESIVKGS
2e4uB           ----------------------------------------------------------------------
2e4zA           CIAQSVRIPTIDFDRIIKQLLDTPNSRAVVIFANDEDIKQILAAAKRADQVGHFLWVGSD----------
2e4vA           ----------------------------------------------------------------------
2e4uA           ----------------------------------------------------------------------
2e4vB           ----------------------------------------------------------------------
1dp4A           TVNHQEFVEGDPDHYPKLLRAVRRKGRVIYICSSPDAFRNLMLLALNAGLTGEDYVFFHLDVFGQSLKSA
1dp4C           TVNHQEFVEGDPDHYPKLLRAVRRKGRVIYICSSPDAFRNLMLLALNAGLTGEDYVFF------------
3cznA           I--------GSLDNTEIVMRLETHDSGDIFYTDLNGLQFIKRRRLDKLPLQANYYPIPSGMFIEDANTRL
3bilA           EQLVFLGGYEQSVGFEGATKLLDQGAKTLF----------------------------------------
1dbpA           VLASQPADFDRIKGLNVMQNLLTPDVQAVF----------------------------------------
1drkA           VLASQPADFDRIKGLNVMQNLLTPDVQAVF----------------------------------------
1efaC           PIAEREGDWSAMSGFQQTMQMLNEGIV-------------------------------------------
1efaA           PIAEREGDWSAMSGFQQTMQMLNEVPTAML----------------------------------------
1efaB           PIAEREGDWSAMSGFQQTMQMLNEVPTAML----------------------------------------
1bdhA           VPESWIVQFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCADEMGLRVPQD---------------


                         .         *         .         .         .         .         +:350
query           DAAGVVWPSNFSARSEVPSTQEFVKAYEEKYGELPNNYAAEGYDAVWLLARGIKEANSADRVAIREGIAK
3ckmA           AQNGVQFSDPFFKDTNSPQYQKLAKSTGGEYQL----RLYAGADAWLLINQFNE-------------LRQ
3eafA           GGYGKVFPFIYPFGQDVEGIQTIFEAARNGVSEQINLRVVQGFVNVWLLIKAIESVTSQDGEALKEALEA
2e4yB           EHVAYGAITLELASHPVRQFDRYFQSL-------------------------------------------
2e4uB           ----------------------------------------------------------------------
2e4zA           ----------------------------------------------------------------------
2e4vA           ----------------------------------------------------------------------
2e4uA           ----------------------------------------------------------------------
2e4vB           ----------------------------------------------------------------------
1dp4A           QVPQKPWERGDGQDRSARQAFQAAKII-------------------------------------------
1dp4C           ----------------------------------------------------------------------
3cznA           TGQPLGGSSLASGELEIMQDRRLASDDERGLGQGVLDNKLHIYRLVLEKVNNCVRPSKLHPAGYLTSAAH
3bilA           ----------------------------------------------------------------------
1dbpA           ----------------------------------------------------------------------
1drkA           ----------------------------------------------------------------------
1efaC           ----------------------------------------------------------------------
1efaA           ----------------------------------------------------------------------
1efaB           ----------------------------------------------------------------------
1bdhA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VAAEGFDGAQGPLSFENNDVRVEGVIASWNGSEEVVVxxxxx
3ckmA           VPGYRLSGLTGILSADTNCNVERDTWYQYQDGAIVPV-----
3eafA           NTFDLGGITADTIDYEPGF-----------------------
2e4yB           ------------------------------------------
2e4uB           ------------------------------------------
2e4zA           ------------------------------------------
2e4vA           ------------------------------------------
2e4uA           ------------------------------------------
2e4vB           ------------------------------------------
1dp4A           ------------------------------------------
1dp4C           ------------------------------------------
3cznA           KASQSLL-----------------------------------
3bilA           ------------------------------------------
1dbpA           ------------------------------------------
1drkA           ------------------------------------------
1efaC           ------------------------------------------
1efaA           ------------------------------------------
1efaB           ------------------------------------------
1bdhA           ------------------------------------------