[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ55377.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "1ecrA.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"

## Summary of PDB Search
:1060
    2e-06  14%  1e2lB  [c.37.1] THYMIDINE KINASE
    1e-04  15%  1ecrA  [e.2.1] PROTEIN (REPLICATION-TERMINATOR PROTEIN)
    1e-04  15%  1e2iB  [c.37.1] THYMIDINE KINASE
    3e-04  17%  1e2jB  [c.37.1] THYMIDINE KINASE
    4e-04  12%  3cmtD  [x.x.x] PROTEIN RECA
    4e-04  12%  1e2mB  [c.37.1] THYMIDINE KINASE
:1060

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1e2lB           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1e2lB           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1e2lB           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1e2lB           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxRYDNLQPLLASLLTQRECLLRPIVLLGHPGAGKSQLTRMLAARLP
1e2lB           ---------------------------------------------LRVYIDGPHGMGKTTTTQLLVALGS
1ecrA           -------------------------LVDRLNTTFRQMEQELAIFLLVARVFSLPEVKKEDEHNPL-----
1e2iB           ---------------------------------------------LRVYIDGPHGMGKTTTTQLLVALGS
1e2jB           ---------------------------------------------LRVYIDGPHGMGKTTTTQLLVALGS
3cmtD           -----------------------------------------------VEIYGPESSGKTTLTLQVIAAA-
1e2mB           ---------------------------------------------LRVYIDGPHGMGKTTTTQLLVALGS


                         .         .         .         .         *         .         .:420
query           LGNFLPLRVELRSVPADAPIHTQIDEGISATLHARTSWRDLADEAQDALPVVILDGFDELLQATGVNRSD
1e2lB           RDDIVYVPEPMTY-----------WRVLGASETIANIFTTQHRLDQGEISAGDAAVVMTSAQITMGMPYA
1ecrA           ----------------------------------------------------------------------
1e2iB           RDDYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQ----ITMGMPYAVTDAVLAPH
1e2jB           ----------------RDDIVYVPEPMTYWRVLGASETIANIYTTQHQGEISAGDAAVVMTSAMGMPYAV
3cmtD           QREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALARSGAVDVIVLTPKAEIEGEIGDSHMG
1e2mB           RDDI--VYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPH


                         .         .         +         .         .         .         .:490
query           YLEQVQRFQEHQADLGRPVAVIVTSRTVVAERTRFPFGIPVIRLEPFTDAQIAHLTDVWNRANTAALAER
1e2lB           VTDAVLAPHIGGEAGSPPALTLIFDRHPIAALLCYPAARYVLAFVALIPPTLPGTNIVLGALPEDRHIDR
1ecrA           ----------------------------------------------------------------------
1e2iB           IGGEAHAPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLVALIPPTLPGTNIALPEDRHIDRLAKR
1e2jB           TDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYPAAQAVLAFVALIPPTLPGTNIVLGALPEDRHIDR
3cmtD           LAARMMSQAMRK--LAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVR-----------
1e2mB           IGGEAGSPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDR


                         *         .         .         .         .         +         .:560
query           GLHPITADSLLRYRDLAEQPLLLFMLLIFDADANALQRETADLGRAGLYEKLLTSFAEREVRKHHPHLYG
1e2lB           LAKRLDLAMLAAIRRVYGLRYLQCGGSWREDWGQLSGPQSNAGPRPHIGDTLFTLFRAPELLAPNGDLYN
1ecrA           ----------------------------------------------------------------------
1e2iB           ERLDLAMLAAIRYGLLANTVRYLQCGGSWREDWGQLSGPQSNAGRPHIGDTLFTLFRAPELLAPNGDLYN
1e2jB           LAKRLDLAMLAAIRRLANTVRYLQCGGSWREDWGQLSGTAVPQSNAGPGDTLFTLFRAPELLAPNGDLYN
3cmtD           ----------------------------------------------------------------------
1e2mB           LAKRLDLAMLAAIRRVYGLRYLQCGGSWREDWGQLSGPQSNAGPRPHIGDTLFTLFRAPELLAPNGDLY-


                         .         .         .         *         .         .         .:630
query           EELAQAVEDELRSLEVVAIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1e2lB           VFALDVLAKRLRSMHV------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
1e2iB           VFALDVLAKRLRSMHVFIL---------------------------------------------------
1e2jB           VFAWDVLAKRLRSMHVF-----------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1e2mB           NVFAWALDVLAKRLRSMHV---------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1e2lB           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1e2lB           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1e2lB           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1e2lB           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1e2lB           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1e2lB           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxx
1e2lB           ----------
1ecrA           ----------
1e2iB           ----------
1e2jB           ----------
3cmtD           ----------
1e2mB           ----------