[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ55520.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2c7yA.bssp"
#ERROR : Can't open dsspfile "2c7yB.bssp"
#ERROR : Can't open dsspfile "2almA.bssp"
#ERROR : Can't open dsspfile "1b3nA.bssp"
#ERROR : Can't open dsspfile "2d0oC.bssp"
#ERROR : Can't open dsspfile "1afwB.bssp"
#ERROR : Can't open dsspfile "1dluA.bssp"

## Summary of PDB Search
:389
    8e-08  17%  2c7yA  [x.x.x] 3-KETOACYL-COA THIOLASE 2
    1e-07  18%  2c7yB  [x.x.x] 3-KETOACYL-COA THIOLASE 2
    9e-06  12%  2almA  [x.x.x] 3-OXOACYL-(ACYL-CARRIER-PROTEIN) SYNTHASE II
    4e-05  18%  1b3nA  [c.95.1 - c.95.1] PROTEIN (KETOACYL ACYL CARRIER PROTEIN
    6e-05  17%  2d0oC  [x.x.x] DIOL DEHYDRATASE-REACTIVATING FACTOR LARGE
    2e-04  24%  1afwB  [c.95.1 - c.95.1] 3-KETOACETYL-COA THIOLASE
    4e-04  14%  1dluA  [c.95.1 - c.95.1] BIOSYNTHETIC THIOLASE
:389

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2c7yA           ----------------------------------------------------------------------
2c7yB           ----------------------------------------------------------------------
2almA           ----------------------------------------------------------------------
1b3nA           ----------------------------------------------------------------------
2d0oC           ----------------------------------------------------------------------
1afwB           ----------------------------------------------------------------------
1dluA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxGFGSSAIQMVQYASMAISAGMANVVACVYADAPLKEGRGSGAAYAGGNRPLTGVEALPAAA
2c7yA           ---------RQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPKFAQAQNCLLPMGVT--SENVAQR
2c7yB           -----------CSSGLQAVADVAAAIKAGFYDIGIGAGLENPMAWEKKFAQAQNCLLPMGVTSENV-AQR
2almA           ----------------------------------------------------------------------
1b3nA           ----------------------------------------------------------------------
2d0oC           ----------------------------------------------------------------------
1afwB           ----------------------------------------------------------------------
1dluA           -----------CGSGLRAVALGMQQIATGDASIIVAGGMESMSMAHLRGGVKMGDFKMIDTMIKDGLTDA


                         +         .         .         .         .         *         .:210
query           GLKSAPARYAIAARRHMETYGTTSEQLGXXXXXXXXXXXMNPLAQMREPITIDDHQNSRMIADPLRLLDC
2c7yA           FGVSRQEQDQAAVDSHRTAAGKFKDEIIPVKTKLVDPKTGDEKPITRPTTTLASLGKLKPVFKTTTAGNS
2c7yB           FGVSRQEQDQAAVDSHRKAAGKFKDEIIPVKTKLVDPKTGDEKPIIRPTTTLASLGKLKPVFKKTTAGNS
2almA           ----SSSNDAIGDAFRSIKFGFQ--DVMLVGGTEASITPFAIAGFQALTALSTTEDPTRASIPFDKDRNG
1b3nA           ---------------------------------------------------------------WDKERDG
2d0oC           ----------------------------------------------------------------------
1afwB           -----------------------------------------------------------KDRGTTTAGNA
1dluA           F---YGYHMGTTAENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRDKEGTVTAGNA


                         .         .         .         +         .         .         .:280
query           CLVSNGAIAIIVTSAERAADLAQPPVHIWGWGQAHPGYTSYRDSNFGLVSGAAQSGPAALRMAGVTVDEI
2c7yA           SQVSDGAGAVLLMKRSVAQKGLPVLGVFRTFAAVG-------VDPAIMGIGPAVAIPAAVKAAGLELDDI
2c7yB           SQVSDGAGAVLLMKRSVAQKGLPVLGVFRTFAAVGVDPAI-------MGIGPAVAIPAAVKAAGLELDDI
2almA           FVMGEGSGMLVLESLEHAKRGATILAEVVGYGNTCDAYHMTSPHPEG--QGAIKAIKLALEEAEISPEQV
1b3nA           FVLGDGAGMLVLEEYEHAKRGAKIYAELVGFGMSSDAYHMTSPPENG--AGAALAMANALRDAGIEASQI
2d0oC           ----NSSTEVALATLDEAGALTITHSALATTGIKGTLRN---------VFGIQEALALVARGAGIAVSDI
1afwB           SQVSDGVAGVLLARRSVANQLNLPVLGRYIDFQTVGVPPEIM------GVGPAYAIPKVLEATGLQVQDI
1dluA           SGLNDGAAAALLMSEAEASRRGIQPLGRIVSWA----TVGVDPKVMGTGP--IPASRKALERAGWKIGDL


                         .         *         .         .         .         .         +:350
query           DIREIYDCFTYTTLLTLEDYGFCAKGEGGEFVASGALAPGGSHPTNTGGGELSSYYMWGMTPLSEAVxxx
2c7yA           DLFEINEAFASQFVYCRNKLGLDPE------------------KINVNGGAMAIGHPLGATGARCVA---
2c7yB           DLFEINEAFASQFVYCRNKLGLDPE------------------KINVNGGAMAIGHPLGATGARCVA---
2almA           AYVNAAGTSTPANEKGESGAIVAV----------------------------------------------
1b3nA           GYVNAHGTSTPAGDKA-EAQAVKTIFGEAA------------SRVLVSSTKSMTGHLLGAAGAVESI---
2d0oC           SLIRINEATPVIGDVAME----------------------------------------------------
1afwB           DIFEINEAFAAQALYCIHKLGIDLN---KVNPRGGAIALG--HPLGCTG---------------------
1dluA           DLVEANEAFAAQACAVNKDLGWDPSIVN---VNGGAIAIG--HPIGASGARILNTLLFEM----------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2c7yA           ---------------------------------------
2c7yB           ---------------------------------------
2almA           ---------------------------------------
1b3nA           ---------------------------------------
2d0oC           ---------------------------------------
1afwB           ---------------------------------------
1dluA           ---------------------------------------