[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ55524.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3ej8A.bssp"
#ERROR : Can't open dsspfile "1djqA.bssp"
#ERROR : Can't open dsspfile "3e7gC.bssp"
#ERROR : Can't open dsspfile "1djnA.bssp"
#ERROR : Can't open dsspfile "3dwjB.bssp"
#ERROR : Can't open dsspfile "1bwkA.bssp"
#ERROR : Can't open dsspfile "3dqtB.bssp"
#ERROR : Can't open dsspfile "3e7sB.bssp"
#ERROR : Can't open dsspfile "3dqsA.bssp"
#ERROR : Can't open dsspfile "1dd7A.bssp"
#ERROR : Can't open dsspfile "3e7gA.bssp"
#ERROR : Can't open dsspfile "1dwxA.bssp"
#ERROR : Can't open dsspfile "3e68A.bssp"
#ERROR : Can't open dsspfile "3eahB.bssp"
#ERROR : Can't open dsspfile "3c56A.bssp"
#ERROR : Can't open dsspfile "3e65B.bssp"
#ERROR : Can't open dsspfile "1df1A.bssp"
#ERROR : Can't open dsspfile "2dv2A.bssp"
#ERROR : Can't open dsspfile "1bwlA.bssp"
#ERROR : Can't open dsspfile "2aeaD.bssp"
#ERROR : Can't open dsspfile "3e65A.bssp"
#ERROR : Can't open dsspfile "3dwjA.bssp"
#ERROR : Can't open dsspfile "3e68B.bssp"
#ERROR : Can't open dsspfile "3e7mA.bssp"
#ERROR : Can't open dsspfile "2abbA.bssp"
#ERROR : Can't open dsspfile "3e7sA.bssp"
#ERROR : Can't open dsspfile "1dwxB.bssp"
#ERROR : Can't open dsspfile "2an0A.bssp"
#ERROR : Can't open dsspfile "3eahA.bssp"
#ERROR : Can't open dsspfile "3c52B.bssp"
#ERROR : Can't open dsspfile "3drwA.bssp"
#ERROR : Can't open dsspfile "1b3oB.bssp"
#ERROR : Can't open dsspfile "2dv1A.bssp"
#ERROR : Can't open dsspfile "2an2A.bssp"
#ERROR : Can't open dsspfile "3cb3A.bssp"
#ERROR : Can't open dsspfile "3bjsA.bssp"
#ERROR : Can't open dsspfile "3cb3B.bssp"
#ERROR : Can't open dsspfile "3dfhA.bssp"
#ERROR : Can't open dsspfile "2e68B.bssp"
#ERROR : Can't open dsspfile "3bjsB.bssp"
#ERROR : Can't open dsspfile "3bsmA.bssp"
#ERROR : Can't open dsspfile "1a53A.bssp"
#ERROR : Can't open dsspfile "1bkhB.bssp"
#ERROR : Can't open dsspfile "3ddmA.bssp"
#ERROR : Can't open dsspfile "2e66A.bssp"
#ERROR : Can't open dsspfile "1d3hA.bssp"
#ERROR : Can't open dsspfile "2ejrA.bssp"
#ERROR : Can't open dsspfile "3c52A.bssp"
#ERROR : Can't open dsspfile "2djxA.bssp"
#ERROR : Can't open dsspfile "3dipB.bssp"
#ERROR : Can't open dsspfile "2dw4A.bssp"
#ERROR : Can't open dsspfile "2b4gA.bssp"
#ERROR : Can't open dsspfile "1d3gA.bssp"
#ERROR : Can't open dsspfile "1chrA.bssp"
#ERROR : Can't open dsspfile "3c4uA.bssp"
#ERROR : Can't open dsspfile "2dzwB.bssp"
#ERROR : Can't open dsspfile "3c61A.bssp"
#ERROR : Can't open dsspfile "1b3oA.bssp"
#ERROR : Can't open dsspfile "1a48A.bssp"
#ERROR : Can't open dsspfile "3b5vA.bssp"
#ERROR : Can't open dsspfile "2djlA.bssp"
#ERROR : Can't open dsspfile "3dfyA.bssp"
#ERROR : Can't open dsspfile "1al8A.bssp"
#ERROR : Can't open dsspfile "2e68A.bssp"
#ERROR : Can't open dsspfile "2dzsB.bssp"
#ERROR : Can't open dsspfile "3dg6A.bssp"
#ERROR : Can't open dsspfile "2c3zA.bssp"
#ERROR : Can't open dsspfile "3c56B.bssp"
#ERROR : Can't open dsspfile "3bpwB.bssp"
#ERROR : Can't open dsspfile "2dzwA.bssp"
#ERROR : Can't open dsspfile "3eezA.bssp"
#ERROR : Can't open dsspfile "3dg3A.bssp"
#ERROR : Can't open dsspfile "2bahA.bssp"
#ERROR : Can't open dsspfile "1bkhC.bssp"
#ERROR : Can't open dsspfile "2b4gB.bssp"
#ERROR : Can't open dsspfile "2a1yA.bssp"
#ERROR : Can't open dsspfile "3dgbA.bssp"
#ERROR : Can't open dsspfile "3c3nA.bssp"
#ERROR : Can't open dsspfile "1dtnA.bssp"
#ERROR : Can't open dsspfile "2dzpA.bssp"
#ERROR : Can't open dsspfile "1b57A.bssp"
#ERROR : Can't open dsspfile "3dtvD.bssp"
#ERROR : Can't open dsspfile "2drvA.bssp"
#ERROR : Can't open dsspfile "1bkhA.bssp"
#ERROR : Can't open dsspfile "2dzuA.bssp"
#ERROR : Can't open dsspfile "2dzuB.bssp"
#ERROR : Can't open dsspfile "2e09B.bssp"
#ERROR : Can't open dsspfile "1al7A.bssp"
#ERROR : Can't open dsspfile "3dfyL.bssp"
#ERROR : Can't open dsspfile "2dztB.bssp"
#ERROR : Can't open dsspfile "3ct2A.bssp"
#ERROR : Can't open dsspfile "3cb3C.bssp"
#ERROR : Can't open dsspfile "3dfyF.bssp"
#ERROR : Can't open dsspfile "1dqwA.bssp"
#ERROR : Can't open dsspfile "2dztA.bssp"
#ERROR : Can't open dsspfile "3cb3D.bssp"
#ERROR : Can't open dsspfile "2ehhA.bssp"
#ERROR : Can't open dsspfile "2e09A.bssp"
#ERROR : Can't open dsspfile "2a4aB.bssp"
#ERROR : Can't open dsspfile "2dzpB.bssp"
#ERROR : Can't open dsspfile "3dfyB.bssp"
#ERROR : Can't open dsspfile "3eb2D.bssp"
#ERROR : Can't open dsspfile "3dfyE.bssp"
#ERROR : Can't open dsspfile "3derA.bssp"
#ERROR : Can't open dsspfile "3dk9A.bssp"
#ERROR : Can't open dsspfile "1dj8A.bssp"
#ERROR : Can't open dsspfile "3dbyR.bssp"
#ERROR : Can't open dsspfile "1dncA.bssp"
#ERROR : Can't open dsspfile "2btmA.bssp"
#ERROR : Can't open dsspfile "1bg8A.bssp"
#ERROR : Can't open dsspfile "3eb2A.bssp"
#ERROR : Can't open dsspfile "2dzxA.bssp"
#ERROR : Can't open dsspfile "3bofA.bssp"
#ERROR : Can't open dsspfile "2dzvB.bssp"
#ERROR : Can't open dsspfile "3d4oC.bssp"
#ERROR : Can't open dsspfile "2bc0A.bssp"
#ERROR : Can't open dsspfile "1a0dA.bssp"
#ERROR : Can't open dsspfile "1ad1B.bssp"
#ERROR : Can't open dsspfile "3dbyH.bssp"
#ERROR : Can't open dsspfile "2bznC.bssp"
#ERROR : Can't open dsspfile "2e77C.bssp"
#ERROR : Can't open dsspfile "2a0nA.bssp"
#ERROR : Can't open dsspfile "2cyjA.bssp"
#ERROR : Can't open dsspfile "2czgB.bssp"
#ERROR : Can't open dsspfile "2e1mA.bssp"
#ERROR : Can't open dsspfile "3c6eA.bssp"
#ERROR : Can't open dsspfile "1amkA.bssp"
#ERROR : Can't open dsspfile "2dwcB.bssp"
#ERROR : Can't open dsspfile "1ak5A.bssp"
#ERROR : Can't open dsspfile "1bhyA.bssp"
#ERROR : Can't open dsspfile "2dpoA.bssp"
#ERROR : Can't open dsspfile "2dwcA.bssp"
#ERROR : Can't open dsspfile "2cfyA.bssp"
#ERROR : Can't open dsspfile "2czgA.bssp"
#ERROR : Can't open dsspfile "2dzvA.bssp"
#ERROR : Can't open dsspfile "2c6qA.bssp"
#ERROR : Can't open dsspfile "2bznD.bssp"
#ERROR : Can't open dsspfile "1cc4A.bssp"
#ERROR : Can't open dsspfile "3cntB.bssp"
#ERROR : Can't open dsspfile "2a4aA.bssp"
#ERROR : Can't open dsspfile "2culA.bssp"
#ERROR : Can't open dsspfile "1dbtA.bssp"
#ERROR : Can't open dsspfile "2bznA.bssp"
#ERROR : Can't open dsspfile "2bxrA.bssp"
#ERROR : Can't open dsspfile "3cukA.bssp"
#ERROR : Can't open dsspfile "1cc6A.bssp"
#ERROR : Can't open dsspfile "1btmA.bssp"
#ERROR : Can't open dsspfile "3b8iE.bssp"
#ERROR : Can't open dsspfile "1ad4A.bssp"
#ERROR : Can't open dsspfile "1d7lA.bssp"
#ERROR : Can't open dsspfile "3cpiG.bssp"
#ERROR : Can't open dsspfile "1dbtB.bssp"
#ERROR : Can't open dsspfile "1b37A.bssp"
#ERROR : Can't open dsspfile "2bxsA.bssp"
#ERROR : Can't open dsspfile "3b8iA.bssp"
#ERROR : Can't open dsspfile "2a87B.bssp"
#ERROR : Can't open dsspfile "1ec7C.bssp"
#ERROR : Can't open dsspfile "2cffA.bssp"
#ERROR : Can't open dsspfile "2e77A.bssp"
#ERROR : Can't open dsspfile "2bwgD.bssp"
#ERROR : Can't open dsspfile "2dzsA.bssp"
#ERROR : Can't open dsspfile "3dl2B.bssp"
#ERROR : Can't open dsspfile "3cpjG.bssp"
#ERROR : Can't open dsspfile "3cnpA.bssp"
#ERROR : Can't open dsspfile "3bi4B.bssp"
#ERROR : Can't open dsspfile "1aogB.bssp"
#ERROR : Can't open dsspfile "3d4oA.bssp"
#ERROR : Can't open dsspfile "3bi2B.bssp"
#ERROR : Can't open dsspfile "3bi4A.bssp"
#ERROR : Can't open dsspfile "3cnsB.bssp"
#ERROR : Can't open dsspfile "2bc1A.bssp"
#ERROR : Can't open dsspfile "2dkiA.bssp"
#ERROR : Can't open dsspfile "2bs2A.bssp"
#ERROR : Can't open dsspfile "3bi2A.bssp"
#ERROR : Can't open dsspfile "2brxA.bssp"
#ERROR : Can't open dsspfile "3ctyB.bssp"
#ERROR : Can't open dsspfile "3cnsA.bssp"
#ERROR : Can't open dsspfile "3bi8A.bssp"
#ERROR : Can't open dsspfile "2c72A.bssp"
#ERROR : Can't open dsspfile "2a7rC.bssp"
#ERROR : Can't open dsspfile "2du8A.bssp"
#ERROR : Can't open dsspfile "1b9bA.bssp"
#ERROR : Can't open dsspfile "2a87A.bssp"
#ERROR : Can't open dsspfile "3eb2B.bssp"
#ERROR : Can't open dsspfile "1d7yA.bssp"
#ERROR : Can't open dsspfile "3d1cA.bssp"
#ERROR : Can't open dsspfile "1cjcA.bssp"
#ERROR : Can't open dsspfile "2ehhC.bssp"
#ERROR : Can't open dsspfile "3bh1C.bssp"
#ERROR : Can't open dsspfile "2bmuB.bssp"
#ERROR : Can't open dsspfile "3c4aA.bssp"
#ERROR : Can't open dsspfile "2dp3A.bssp"
#ERROR : Can't open dsspfile "2bznB.bssp"
#ERROR : Can't open dsspfile "2dzxB.bssp"
#ERROR : Can't open dsspfile "3cnjA.bssp"
#ERROR : Can't open dsspfile "3cpiH.bssp"
#ERROR : Can't open dsspfile "2amfE.bssp"
#ERROR : Can't open dsspfile "2dkhA.bssp"
#ERROR : Can't open dsspfile "3cgvA.bssp"
#ERROR : Can't open dsspfile "1b37B.bssp"
#ERROR : Can't open dsspfile "1cj2A.bssp"
#ERROR : Can't open dsspfile "2b9wA.bssp"
#ERROR : Can't open dsspfile "2bwgB.bssp"
#ERROR : Can't open dsspfile "2c6qB.bssp"
#ERROR : Can't open dsspfile "2e4gA.bssp"
#ERROR : Can't open dsspfile "3b3rA.bssp"
#ERROR : Can't open dsspfile "1cl0A.bssp"
#ERROR : Can't open dsspfile "3c4nA.bssp"
#ERROR : Can't open dsspfile "3cqjA.bssp"
#ERROR : Can't open dsspfile "3d4oB.bssp"
#ERROR : Can't open dsspfile "3coxA.bssp"
#ERROR : Can't open dsspfile "2dw6A.bssp"
#ERROR : Can't open dsspfile "2agkA.bssp"
#ERROR : Can't open dsspfile "3cqhA.bssp"
#ERROR : Can't open dsspfile "1d5tA.bssp"
#ERROR : Can't open dsspfile "3d8xA.bssp"
#ERROR : Can't open dsspfile "2aefB.bssp"
#ERROR : Can't open dsspfile "3djeB.bssp"
#ERROR : Can't open dsspfile "2ciqA.bssp"
#ERROR : Can't open dsspfile "3c24A.bssp"
#ERROR : Can't open dsspfile "3cgbA.bssp"
#ERROR : Can't open dsspfile "3dghB.bssp"
#ERROR : Can't open dsspfile "1ec7A.bssp"
#ERROR : Can't open dsspfile "2cduB.bssp"
#ERROR : Can't open dsspfile "2dqwB.bssp"
#ERROR : Can't open dsspfile "1eehA.bssp"
#ERROR : Can't open dsspfile "1b8sA.bssp"
#ERROR : Can't open dsspfile "2e4gB.bssp"
#ERROR : Can't open dsspfile "2amfA.bssp"
#ERROR : Can't open dsspfile "3cphH.bssp"
#ERROR : Can't open dsspfile "1b73A.bssp"
#ERROR : Can't open dsspfile "1c0iA.bssp"
#ERROR : Can't open dsspfile "2aejB.bssp"
#ERROR : Can't open dsspfile "2c76A.bssp"
#ERROR : Can't open dsspfile "2aqwA.bssp"
#ERROR : Can't open dsspfile "2bmuA.bssp"
#ERROR : Can't open dsspfile "1e0dA.bssp"
#ERROR : Can't open dsspfile "3eanC.bssp"
#ERROR : Can't open dsspfile "2eggB.bssp"
#ERROR : Can't open dsspfile "2du2A.bssp"
#ERROR : Can't open dsspfile "2d4aA.bssp"
#ERROR : Can't open dsspfile "2c75B.bssp"
#ERROR : Can't open dsspfile "3eanD.bssp"
#ERROR : Can't open dsspfile "3eanA.bssp"
#ERROR : Can't open dsspfile "3ctyA.bssp"
#ERROR : Can't open dsspfile "1eepB.bssp"
#ERROR : Can't open dsspfile "2dw7A.bssp"

## Summary of PDB Search
:656
    2e-48  10%  3ej8A  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    1e-47  23%  1djqA  [c.1.4 - c.4.1 - c.3.1] TRIMETHYLAMINE DEHYDROGENASE
    6e-42  10%  3e7gC  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    3e-38  24%  1djnA  [c.1.4 - c.4.1 - c.3.1] TRIMETHYLAMINE DEHYDROGENASE
    1e-37   9%  3dwjB  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    3e-37  22%  1bwkA  [c.1.4] PROTEIN (NADPH DEHYDROGENASE 1)
    2e-35   6%  3dqtB  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    3e-35   8%  3e7sB  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    3e-35   5%  3dqsA  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    1e-34  10%  1dd7A  [d.174.1] INDUCIBLE NITRIC OXIDE SYNTHASE
    2e-33   7%  3e7gA  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    5e-33   7%  1dwxA  [d.174.1] NITRIC OXIDE SYNTHASE
    7e-33   6%  3e68A  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    1e-32   8%  3eahB  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    4e-31  14%  3c56A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE
    9e-31  10%  3e65B  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    4e-30   8%  1df1A  [d.174.1] NITRIC OXIDE SYNTHASE
    5e-30   7%  2dv2A  [x.x.x] PEROXIDASE/CATALASE
    7e-30  22%  1bwlA  [c.1.4] PROTEIN (NADPH DEHYDROGENASE 1)
    3e-29  11%  2aeaD  [x.x.x] PUTATIVE ACETYLXYLAN ESTERASE
    7e-29   9%  3e65A  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    2e-27   7%  3dwjA  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    4e-27   6%  3e68B  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    8e-27   8%  3e7mA  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    2e-26  21%  2abbA  [x.x.x] PENTAERYTHRITOL TETRANITRATE REDUCTASE
    3e-26   9%  3e7sA  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    7e-26   7%  1dwxB  [d.174.1] NITRIC OXIDE SYNTHASE
    1e-25  12%  2an0A  [x.x.x] NITRIC OXIDE SYNTHASE
    3e-25   8%  3eahA  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    4e-25  13%  3c52B  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE
    5e-24  12%  3drwA  [x.x.x] ADP-SPECIFIC PHOSPHOFRUCTOKINASE
    2e-22  14%  1b3oB  [c.1.5 - d.37.1 - d.37.1] PROTEIN (INOSINE MONOPHOSPHATE
    3e-22   9%  2dv1A  [x.x.x] PEROXIDASE/CATALASE
    1e-21   8%  2an2A  [x.x.x] P332G A333S DOUBLE MUTANT OF NITRIC OXIDE
    3e-21  13%  3cb3A  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    3e-21  11%  3bjsA  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    5e-21  11%  3cb3B  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    2e-20  13%  3dfhA  [x.x.x] MANDELATE RACEMASE
    2e-19  10%  2e68B  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    2e-19  10%  3bjsB  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    6e-19  14%  3bsmA  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    2e-18   5%  1a53A  [c.1.2 (1lbfA)] INDOLE-3-GLYCEROLPHOSPHATE SYNTHASE
    2e-18  17%  1bkhB  [d.54.1 - c.1.11] MUCONATE LACTONIZING ENZYME
    2e-18  14%  3ddmA  [x.x.x] PUTATIVE MANDELATE RACEMASE/MUCONATE LACTONIZING
    3e-18  13%  2e66A  [x.x.x] DIVALENT-CATION TOLERANCE PROTEIN CUTA
    1e-17  13%  1d3hA  [c.1.4] DIHYDROOROTATE DEHYDROGENASE
    2e-17  12%  2ejrA  [x.x.x] LYSINE-SPECIFIC HISTONE DEMETHYLASE 1
    4e-17  11%  3c52A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE
    8e-17   9%  2djxA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    1e-16  15%  3dipB  [x.x.x] ENOLASE
    1e-16  17%  2dw4A  [x.x.x] LYSINE-SPECIFIC HISTONE DEMETHYLASE 1
    1e-16  13%  2b4gA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    6e-16  13%  1d3gA  [c.1.4] DIHYDROOROTATE DEHYDROGENASE
    8e-16  15%  1chrA  [d.54.1 - c.1.11] CHLOROMUCONATE CYCLOISOMERASE
    1e-15  12%  3c4uA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE
    2e-15  12%  2dzwB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    4e-15   8%  3c61A  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    4e-15  11%  1b3oA  [c.1.5] PROTEIN (INOSINE MONOPHOSPHATE DEHYDROGENASE 2)
    4e-15  13%  1a48A  [x.x.x] PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE
    5e-15   6%  3b5vA  [x.x.x] RETROALDOLASE-22
    6e-15  11%  2djlA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    2e-14  14%  3dfyA  [x.x.x] MUCONATE CYCLOISOMERASE
    2e-14  16%  1al8A  [x.x.x] GLYCOLATE OXIDASE
    2e-14  10%  2e68A  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    4e-14  13%  2dzsB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    7e-14  11%  3dg6A  [x.x.x] MUCONATE CYCLOISOMERASE
    1e-13   8%  2c3zA  [x.x.x] INDOLE-3-GLYCEROL PHOSPHATE SYNTHASE
    2e-13  11%  3c56B  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE
    2e-13   9%  3bpwB  [x.x.x] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    4e-13  12%  2dzwA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    7e-13  16%  3eezA  [x.x.x] PUTATIVE MANDELATE RACEMASE/MUCONATE LACTONIZING
    8e-13  15%  3dg3A  [x.x.x] MUCONATE CYCLOISOMERASE
    8e-13  15%  2bahA  [x.x.x] N-ACYLAMINO ACID RACEMASE
    1e-12  17%  1bkhC  [d.54.1 - c.1.11] MUCONATE LACTONIZING ENZYME
    1e-12  13%  2b4gB  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    1e-12  13%  2a1yA  [x.x.x] GMP REDUCTASE
    1e-12  15%  3dgbA  [x.x.x] MUCONATE CYCLOISOMERASE
    2e-12   9%  3c3nA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    2e-12  14%  1dtnA  [x.x.x] MANDELATE RACEMASE
    4e-12  11%  2dzpA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    4e-12  12%  1b57A  [c.1.10] PROTEIN (FRUCTOSE-BISPHOSPHATE ALDOLASE II)
    4e-12  13%  3dtvD  [x.x.x] ARYLMALONATE DECARBOXYLASE
    4e-12  11%  2drvA  [x.x.x] UPF0130 PROTEIN PH1069
    5e-12  18%  1bkhA  [d.54.1 - c.1.11] MUCONATE LACTONIZING ENZYME
    2e-11  12%  2dzuA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    2e-11  12%  2dzuB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    4e-11  13%  2e09B  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    5e-11  12%  1al7A  [x.x.x] GLYCOLATE OXIDASE
    7e-11  18%  3dfyL  [x.x.x] MUCONATE CYCLOISOMERASE
    7e-11  13%  2dztB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    8e-11  17%  3ct2A  [x.x.x] MUCONATE CYCLOISOMERASE
    9e-11  15%  3cb3C  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    9e-11  18%  3dfyF  [x.x.x] MUCONATE CYCLOISOMERASE
    9e-11  12%  1dqwA  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    3e-10  13%  2dztA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    3e-10  15%  3cb3D  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    4e-10  10%  2ehhA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    4e-10  13%  2e09A  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    7e-10  11%  2a4aB  [x.x.x] DEOXYRIBOSE-PHOSPHATE ALDOLASE
    8e-10  11%  2dzpB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    1e-09  19%  3dfyB  [x.x.x] MUCONATE CYCLOISOMERASE
    1e-09  13%  3eb2D  [x.x.x] PUTATIVE DIHYDRODIPICOLINATE SYNTHETASE
    2e-09  19%  3dfyE  [x.x.x] MUCONATE CYCLOISOMERASE
    2e-09  18%  3derA  [x.x.x] MUCONATE CYCLOISOMERASE
    1e-08  12%  3dk9A  [x.x.x] GLUTATHIONE REDUCTASE
    1e-08  12%  1dj8A  [a.57.1] PROTEIN HNS-DEPENDENT EXPRESSION A
    1e-08   6%  3dbyR  [x.x.x] UNCHARACTERIZED PROTEIN
    1e-08  16%  1dncA  [x.x.x] GLUTATHIONE REDUCTASE
    2e-08  10%  2btmA  [c.1.1] PROTEIN (TRIOSEPHOSPHATE ISOMERASE)
    2e-08  12%  1bg8A  [a.57.1] HDEA
    2e-08  13%  3eb2A  [x.x.x] PUTATIVE DIHYDRODIPICOLINATE SYNTHETASE
    2e-08  13%  2dzxA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    6e-08   8%  3bofA  [x.x.x] 5-METHYLTETRAHYDROFOLATE S-HOMOCYSTEINE
    7e-08  14%  2dzvB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    9e-08  18%  3d4oC  [x.x.x] DIPICOLINATE SYNTHASE SUBUNIT A
    1e-07  14%  2bc0A  [x.x.x] NADH OXIDASE
    1e-07   7%  1a0dA  [c.1.15] XYLOSE ISOMERASE
    1e-07  15%  1ad1B  [c.1.21] DIHYDROPTEROATE SYNTHETASE
    1e-07   9%  3dbyH  [x.x.x] UNCHARACTERIZED PROTEIN
    2e-07  13%  2bznC  [x.x.x] GMP REDUCTASE 2
    2e-07  14%  2e77C  [x.x.x] LACTATE OXIDASE
    2e-07  23%  2a0nA  [x.x.x] IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE SUBUNIT
    2e-07  13%  2cyjA  [x.x.x] HYPOTHETICAL PROTEIN PH1505
    2e-07  20%  2czgB  [x.x.x] PHOSPHORIBOSYLGLYCINAMIDE FORMYL TRANSFERASE
    2e-07  40%  2e1mA  [x.x.x] L-GLUTAMATE OXIDASE
    3e-07   6%  3c6eA  [x.x.x] ENVELOPE PROTEIN E
    6e-07  12%  1amkA  [x.x.x] TRIOSE PHOSPHATE ISOMERASE
    8e-07  20%  2dwcB  [x.x.x] 433AA LONG HYPOTHETICAL
    8e-07  17%  1ak5A  [x.x.x] INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
    8e-07  37%  1bhyA  [x.x.x] P64K
    9e-07  33%  2dpoA  [x.x.x] L-GULONATE 3-DEHYDROGENASE
    9e-07  22%  2dwcA  [x.x.x] 433AA LONG HYPOTHETICAL
    1e-06   7%  2cfyA  [x.x.x] THIOREDOXIN REDUCTASE 1[MASQUE : MEMB(X) 44 / COIL(x)
    1e-06  22%  2czgA  [x.x.x] PHOSPHORIBOSYLGLYCINAMIDE FORMYL TRANSFERASE
    1e-06  14%  2dzvA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    1e-06  12%  2c6qA  [x.x.x] GMP REDUCTASE 2
    2e-06  15%  2bznD  [x.x.x] GMP REDUCTASE 2
    2e-06  32%  1cc4A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    2e-06  22%  3cntB  [x.x.x] FMS1
    3e-06  10%  2a4aA  [x.x.x] DEOXYRIBOSE-PHOSPHATE ALDOLASE
    3e-06  36%  2culA  [x.x.x] GLUCOSE-INHIBITED DIVISION PROTEIN A-RELATED
    3e-06  10%  1dbtA  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    3e-06  14%  2bznA  [x.x.x] GMP REDUCTASE 2
    4e-06  39%  2bxrA  [x.x.x] AMINE OXIDASE [FLAVIN-CONTAINING] A
    4e-06  28%  3cukA  [x.x.x] D-AMINO-ACID OXIDASE
    5e-06  32%  1cc6A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    5e-06  15%  1btmA  [c.1.1] TRIOSEPHOSPHATE ISOMERASE
    6e-06  13%  3b8iE  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    6e-06  18%  1ad4A  [c.1.21] DIHYDROPTEROATE SYNTHETASE
    6e-06  31%  1d7lA  [c.3.1 - d.16.1] P-HYDROXYBENZOATE HYDROXYLASE
    7e-06  32%  3cpiG  [x.x.x] RAB GDP-DISSOCIATION INHIBITOR
    7e-06  11%  1dbtB  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    7e-06  38%  1b37A  [c.3.1 - d.16.1] PROTEIN (POLYAMINE OXIDASE)
    7e-06  39%  2bxsA  [x.x.x] AMINE OXIDASE [FLAVIN-CONTAINING] A
    7e-06  15%  3b8iA  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    7e-06  18%  2a87B  [x.x.x] THIOREDOXIN REDUCTASE
    8e-06  15%  1ec7C  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    8e-06   8%  2cffA  [x.x.x] 1-(5-PHOSPHORIBOSYL)-5-[(5-PHOSPHORIBOSYLAMINO)
    9e-06  13%  2e77A  [x.x.x] LACTATE OXIDASE
    9e-06  14%  2bwgD  [x.x.x] GMP REDUCTASE I
    9e-06  14%  2dzsA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    1e-05  20%  3dl2B  [x.x.x] UBIQUITIN-CONJUGATING ENZYME E2 VARIANT 3
    1e-05  32%  3cpjG  [x.x.x] RAB GDP-DISSOCIATION INHIBITOR
    1e-05  22%  3cnpA  [x.x.x] FMS1
    1e-05  22%  3bi4B  [x.x.x] POLYAMINE OXIDASE FMS1
    1e-05  21%  1aogB  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
    2e-05  17%  3d4oA  [x.x.x] DIPICOLINATE SYNTHASE SUBUNIT A
    2e-05  22%  3bi2B  [x.x.x] POLYAMINE OXIDASE FMS1
    2e-05  22%  3bi4A  [x.x.x] POLYAMINE OXIDASE FMS1
    2e-05  22%  3cnsB  [x.x.x] FMS1
    2e-05  17%  2bc1A  [x.x.x] NADH OXIDASE
    2e-05  38%  2dkiA  [x.x.x] 3-HYDROXYBENZOATE HYDROXYLASE
    2e-05  12%  2bs2A  [c.3.1 - d.168.1 - a.7.3 (1e7pA)] QUINOL-FUMARATE REDUCTASE
    2e-05  22%  3bi2A  [x.x.x] POLYAMINE OXIDASE FMS1
    2e-05  14%  2brxA  [x.x.x] URIDYLATE KINASE
    3e-05  13%  3ctyB  [x.x.x] THIOREDOXIN REDUCTASE
    3e-05  22%  3cnsA  [x.x.x] FMS1
    3e-05  21%  3bi8A  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    3e-05  42%  2c72A  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    3e-05  11%  2a7rC  [x.x.x] GMP REDUCTASE 2
    3e-05  28%  2du8A  [x.x.x] D-AMINO-ACID OXIDASE
    4e-05  13%  1b9bA  [c.1.1] PROTEIN (TRIOSEPHOSPHATE ISOMERASE)
    4e-05  17%  2a87A  [x.x.x] THIOREDOXIN REDUCTASE
    4e-05  14%  3eb2B  [x.x.x] PUTATIVE DIHYDRODIPICOLINATE SYNTHETASE
    4e-05  18%  1d7yA  [c.3.1 - c.3.1 - d.87.1] FERREDOXIN REDUCTASE
    4e-05   6%  3d1cA  [x.x.x] FLAVIN-CONTAINING PUTATIVE MONOOXYGENASE
    4e-05  32%  1cjcA  [c.4.1 - c.3.1] PROTEIN (ADRENODOXIN REDUCTASE)
    5e-05  10%  2ehhC  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    5e-05  12%  3bh1C  [x.x.x] UPF0371 PROTEIN DIP2346
    5e-05  17%  2bmuB  [x.x.x] URIDYLATE KINASE
    5e-05  26%  3c4aA  [x.x.x] PROBABLE TRYPTOPHAN HYDROXYLASE VIOD
    5e-05  13%  2dp3A  [x.x.x] TRIOSEPHOSPHATE ISOMERASE
    6e-05  13%  2bznB  [x.x.x] GMP REDUCTASE 2
    6e-05   8%  2dzxB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    6e-05  22%  3cnjA  [x.x.x] CHOLESTEROL OXIDASE
    6e-05  32%  3cpiH  [x.x.x] RAB GDP-DISSOCIATION INHIBITOR
    6e-05  12%  2amfE  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
    7e-05  31%  2dkhA  [x.x.x] 3-HYDROXYBENZOATE HYDROXYLASE
    7e-05  37%  3cgvA  [x.x.x] GERANYLGERANYL REDUCTASE RELATED PROTEIN
    7e-05  36%  1b37B  [c.3.1 - d.16.1] PROTEIN (POLYAMINE OXIDASE)
    8e-05  31%  1cj2A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    8e-05  35%  2b9wA  [x.x.x] PUTATIVE AMINOOXIDASE
    9e-05  17%  2bwgB  [x.x.x] GMP REDUCTASE I
    1e-04  13%  2c6qB  [x.x.x] GMP REDUCTASE 2
    1e-04  24%  2e4gA  [x.x.x] TRYPTOPHAN HALOGENASE
    1e-04  21%  3b3rA  [x.x.x] CHOLESTEROL OXIDASE
    1e-04  26%  1cl0A  [c.3.1 - c.3.1] THIOREDOXIN REDUCTASE
    1e-04  19%  3c4nA  [x.x.x] UNCHARACTERIZED PROTEIN DR_0571
    1e-04  10%  3cqjA  [x.x.x] L-RIBULOSE-5-PHOSPHATE 3-EPIMERASE ULAE
    1e-04  18%  3d4oB  [x.x.x] DIPICOLINATE SYNTHASE SUBUNIT A
    1e-04  26%  3coxA  [x.x.x] CHOLESTEROL OXIDASE
    2e-04  18%  2dw6A  [x.x.x] BLL6730 PROTEIN
    2e-04  10%  2agkA  [x.x.x] 1-(5-PHOSPHORIBOSYL)-5-[(5-PHOSPHORIBOSYLAMINO)
    2e-04  14%  3cqhA  [x.x.x] L-RIBULOSE-5-PHOSPHATE 3-EPIMERASE ULAE
    2e-04  29%  1d5tA  [c.3.1 - d.16.1] GUANINE NUCLEOTIDE DISSOCIATION INHIBITOR
    2e-04  34%  3d8xA  [x.x.x] THIOREDOXIN REDUCTASE 1
    2e-04  15%  2aefB  [x.x.x] CALCIUM-GATED POTASSIUM CHANNEL MTHK
    2e-04  26%  3djeB  [x.x.x] FRUCTOSYL AMINE: OXYGEN OXIDOREDUCTASE
    2e-04   8%  2ciqA  [x.x.x] HEXOSE-6-PHOSPHATE MUTAROTASE
    3e-04  15%  3c24A  [x.x.x] PUTATIVE OXIDOREDUCTASE
    3e-04  19%  3cgbA  [x.x.x] PYRIDINE NUCLEOTIDE-DISULFIDE OXIDOREDUCTASE,
    3e-04  24%  3dghB  [x.x.x] THIOREDOXIN REDUCTASE 1, MITOCHONDRIAL
    3e-04  13%  1ec7A  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    3e-04  18%  2cduB  [x.x.x] NADPH OXIDASE
    3e-04  18%  2dqwB  [x.x.x] DIHYDROPTEROATE SYNTHASE
    4e-04  17%  1eehA  [c.5.1 - c.72.2 - c.59.1]
    4e-04  21%  1b8sA  [c.3.1 - d.16.1] PROTEIN (CHOLESTEROL OXIDASE)
    4e-04  26%  2e4gB  [x.x.x] TRYPTOPHAN HALOGENASE
    4e-04  17%  2amfA  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
    4e-04  32%  3cphH  [x.x.x] RAB GDP-DISSOCIATION INHIBITOR
    5e-04  12%  1b73A  [c.78.2 - c.78.2] GLUTAMATE RACEMASE
    5e-04  31%  1c0iA  [c.4.1 - d.16.1] D-AMINO ACID OXIDASE
    5e-04  15%  2aejB  [x.x.x] CALCIUM-GATED POTASSIUM CHANNEL MTHK
    5e-04  41%  2c76A  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    5e-04   8%  2aqwA  [x.x.x] PUTATIVE OROTIDINE-MONOPHOSPHATE-DECARBOXYLASE
    6e-04  17%  2bmuA  [x.x.x] URIDYLATE KINASE
    6e-04  18%  1e0dA  [c.5.1 - c.72.2 - c.59.1]
    6e-04  37%  3eanC  [x.x.x] THIOREDOXIN REDUCTASE 1
    6e-04  10%  2eggB  [x.x.x] SHIKIMATE 5-DEHYDROGENASE
    6e-04  13%  2du2A  [x.x.x] LACTATE OXIDASE
    7e-04  31%  2d4aA  [x.x.x] MALATE DEHYDROGENASE
    7e-04  41%  2c75B  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    7e-04   7%  3eanD  [x.x.x] THIOREDOXIN REDUCTASE 1
    7e-04   5%  3eanA  [x.x.x] THIOREDOXIN REDUCTASE 1
    8e-04  12%  3ctyA  [x.x.x] THIOREDOXIN REDUCTASE
    9e-04  15%  1eepB  [c.1.5] INOSINE 5'-MONOPHOSPHATE DEHYDROGENASE
    0.001  16%  2dw7A  [x.x.x] BLL6730 PROTEIN
:656

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKPRETTQFTHLFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXISA
3ej8A           ----------------------------------------------------------------------
1djqA           ----RDPKHDILFEPIQIGPKTLRNRFYQVPHAIGAGSDKPGFQSAHRSVKAEGGW-------------A
3e7gC           ----------------------------------------------------------------------
1djnA           -----DPKHDILFEPIQIGPKTLRNRFYQVPHCIGAGSDKPGFQSAHRSVKAEGGW-------------A
3dwjB           ----------------------------------------------------------------------
1bwkA           --KPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRAL--HPGNIPNRDWAVEYYTQRAQRPGTMIITEG
3dqtB           ----------------------------------------------------------------------
3e7sB           ----------------------------------------------------------------------
3dqsA           ----------------------------------------------------------------------
1dd7A           ----------------------------------------------------------------------
3e7gA           ----------------------------------------------------------------------
1dwxA           ----------------------------------------------------------------------
3e68A           ----------------------------------------------------------------------
3eahB           ----------------------------------------------------------------------
3c56A           ----------------------------------------------------------------------
3e65B           ----------------------------------------------------------------------
1df1A           ----------------------------------------------------------------------
2dv2A           ----------------------------------------------------------------------
1bwlA           --KPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRAL-HPGNIPNRDWAVEYYTQRAQRP--------G
2aeaD           ----------------------------------------------------------------------
3e65A           ----------------------------------------------------------------------
3dwjA           ----------------------------------------------------------------------
3e68B           ----------------------------------------------------------------------
3e7mA           ----------------------------------------------------------------------
2abbA           -----------LFTPLKVGAVTAPNRVFMAPLTR---LRSIEPGDIPTPLMGEYYRQRAS---------A
3e7sA           ----------------------------------------------------------------------
1dwxB           ----------------------------------------------------------------------
2an0A           ----------------------------------------------------------------------
3eahA           ----------------------------------------------------------------------
3c52B           ----------------------------------------------------------------------
3drwA           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
2dv1A           ----------------------------------------------------------------------
2an2A           ----------------------------------------------------------------------
3cb3A           ----------------------------------------------------------------------
3bjsA           ----------------------------------------------------------------------
3cb3B           ----------------------------------------------------------------------
3dfhA           ----------------------------------------------------------------------
2e68B           -----------MCLKLNLLDHVFANPFMNAAGVLC-------STEEDLRCMTASSSGALV----------
3bjsB           ----------------------------------------------------------------------
3bsmA           ----------------------------------------------------------------------
1a53A           ----------------------------------------------------------------------
1bkhB           ----------------------------------------------------------------------
3ddmA           ----------------------------------------------------------------------
2e66A           ----------------------------------------------------------------------
1d3hA           TSLGLLPFQDSDMLEVRVLGHKFRNPVGIAAGFD--KHGEAVDGL-----------------------YK
2ejrA           ----------------------------------------------------------------------
3c52A           ----------------------------------------------------------------------
2djxA           -----------MCLKLNLLDHVFANPFMNAAGVL--CCTEEDLRCMT-------------------ASSS
3dipB           ----------------------------------------------------------------------
2dw4A           ----------------------------------------------------------------------
2b4gA           ----------------------------------------------------------------------
1d3gA           TSLGLLPFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMG----------------------F
1chrA           ----------------------------------------------------------------------
3c4uA           ----------------------------------------------------------------------
2dzwB           ----------------------------------------------------------------------
3c61A           -------------LQVDLLNNTFANPFMNAAGVM--CSTTEDLVA------------------------M
1b3oA           ----------------------------------------------------------------------
1a48A           ----------------------------------------------------------------------
3b5vA           ----------------------------------------------------------------------
2djlA           -----------MCLKLNLLDHVFANPFMNAAGVL--CCTEEDLRCMT-------------------ASSS
3dfyA           ----------------------------------------------------------------------
1al8A           ----------------------------------------------------------------------
2e68A           -----------MCLKLNLLDHVFANPFMNAAGVL-CSTEEDLRCMTASSSGALVS---------------
2dzsB           ----------------------------------------------------------------------
3dg6A           ----------------------------------------------------------------------
2c3zA           ----------------------------------------------------------------------
3c56B           ----------------------------------------------------------------------
3bpwB           ----------------------------------------------------------------------
2dzwA           ----------------------------------------------------------------------
3eezA           ----------------------------------------------------------------------
3dg3A           ----------------------------------------------------------------------
2bahA           ----------------------------------------------------------------------
1bkhC           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
3dgbA           ----------------------------------------------------------------------
3c3nA           ----------------------------------------------------------------------
1dtnA           ----------------------------------------------------------------------
2dzpA           ----------------------------------------------------------------------
1b57A           ----------------------------------------------------------------------
3dtvD           ----------------------------------------------------------------------
2drvA           ----------------------------------------------------------------------
1bkhA           ----------------------------------------------------------------------
2dzuA           ----------------------------------------------------------------------
2dzuB           ----------------------------------------------------------------------
2e09B           ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
3dfyL           ----------------------------------------------------------------------
2dztB           ----------------------------------------------------------------------
3ct2A           ----------------------------------------------------------------------
3cb3C           ----------------------------------------------------------------------
3dfyF           ----------------------------------------------------------------------
1dqwA           ----------------------------------------------------------------------
2dztA           ----------------------------------------------------------------------
3cb3D           ----------------------------------------------------------------------
2ehhA           ----------------------------------------------------------------------
2e09A           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2dzpB           ----------------------------------------------------------------------
3dfyB           ----------------------------------------------------------------------
3eb2D           ----------------------------------------------------------------------
3dfyE           ----------------------------------------------------------------------
3derA           ----------------------------------------------------------------------
3dk9A           ----------------------------------------------------------------------
1dj8A           ----------------------------------------------------------------------
3dbyR           ----------------------------------------------------------------------
1dncA           ----------------------------------------------------------------------
2btmA           ----------------------------------------------------------------------
1bg8A           ----------------------------------------------------------------------
3eb2A           ----------------------------------------------------------------------
2dzxA           ----------------------------------------------------------------------
3bofA           ----------------------------------------------------------------------
2dzvB           ----------------------------------------------------------------------
3d4oC           ----------------------------------------------------------------------
2bc0A           ----------------------------------------------------------------------
1a0dA           ----------------------------------------------------------------------
1ad1B           ----------------------------------------------------------------------
3dbyH           ----------------------------------------------------------------------
2bznC           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2a0nA           ----------------------------------------------------------------------
2cyjA           ----------------------------------------------------------------------
2czgB           ----------------------------------------------------------------------
2e1mA           ----------------------------------------------------------------------
3c6eA           ----------------------------------------------------------------------
1amkA           ----------------------------------------------------------------------
2dwcB           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1bhyA           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
2dwcA           ----------------------------------------------------------------------
2cfyA           ----------------------------------------------------------------------
2czgA           ----------------------------------------------------------------------
2dzvA           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
1cc4A           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2culA           ----------------------------------------------------------------------
1dbtA           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2bxrA           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
1cc6A           ----------------------------------------------------------------------
1btmA           ----------------------------------------------------------------------
3b8iE           ----------------------------------------------------------------------
1ad4A           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
3cpiG           ----------------------------------------------------------------------
1dbtB           ----------------------------------------------------------------------
1b37A           ----------------------------------------------------------------------
2bxsA           ----------------------------------------------------------------------
3b8iA           ----------------------------------------------------------------------
2a87B           ----------------------------------------------------------------------
1ec7C           ----------------------------------------------------------------------
2cffA           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2bwgD           ----------------------------------------------------------------------
2dzsA           ----------------------------------------------------------------------
3dl2B           ----------------------------------------------------------------------
3cpjG           ----------------------------------------------------------------------
3cnpA           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
1aogB           ----------------------------------------------------------------------
3d4oA           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3cnsB           ----------------------------------------------------------------------
2bc1A           ----------------------------------------------------------------------
2dkiA           ----------------------------------------------------------------------
2bs2A           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------
2brxA           ----------------------------------------------------------------------
3ctyB           ----------------------------------------------------------------------
3cnsA           ----------------------------------------------------------------------
3bi8A           ----------------------------------------------------------------------
2c72A           ----------------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2du8A           ----------------------------------------------------------------------
1b9bA           ----------------------------------------------------------------------
2a87A           ----------------------------------------------------------------------
3eb2B           ----------------------------------------------------------------------
1d7yA           ----------------------------------------------------------------------
3d1cA           ----------------------------------------------------------------------
1cjcA           ----------------------------------------------------------------------
2ehhC           ----------------------------------------------------------------------
3bh1C           ----------------------------------------------------------------------
2bmuB           ----------------------------------------------------------------------
3c4aA           ----------------------------------------------------------------------
2dp3A           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
2dzxB           ----------------------------------------------------------------------
3cnjA           ----------------------------------------------------------------------
3cpiH           ----------------------------------------------------------------------
2amfE           ----------------------------------------------------------------------
2dkhA           ----------------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
1b37B           ----------------------------------------------------------------------
1cj2A           ----------------------------------------------------------------------
2b9wA           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
3b3rA           ----------------------------------------------------------------------
1cl0A           ----------------------------------------------------------------------
3c4nA           ----------------------------------------------------------------------
3cqjA           ----------------------------------------------------------------------
3d4oB           ----------------------------------------------------------------------
3coxA           ----------------------------------------------------------------------
2dw6A           ----------------------------------------------------------------------
2agkA           ----------------------------------------------------------------------
3cqhA           ----------------------------------------------------------------------
1d5tA           ----------------------------------------------------------------------
3d8xA           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
3djeB           ----------------------------------------------------------------------
2ciqA           ----------------------------------------------------------------------
3c24A           ----------------------------------------------------------------------
3cgbA           ----------------------------------------------------------------------
3dghB           ----------------------------------------------------------------------
1ec7A           ----------------------------------------------------------------------
2cduB           ----------------------------------------------------------------------
2dqwB           ----------------------------------------------------------------------
1eehA           ----------------------------------------------------------------------
1b8sA           ----------------------------------------------------------------------
2e4gB           ----------------------------------------------------------------------
2amfA           ----------------------------------------------------------------------
3cphH           ----------------------------------------------------------------------
1b73A           ----------------------------------------------------------------------
1c0iA           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
2c76A           ----------------------------------------------------------------------
2aqwA           ----------------------------------------------------------------------
2bmuA           ----------------------------------------------------------------------
1e0dA           ----------------------------------------------------------------------
3eanC           ----------------------------------------------------------------------
2eggB           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2d4aA           ----------------------------------------------------------------------
2c75B           ----------------------------------------------------------------------
3eanD           ----------------------------------------------------------------------
3eanA           ----------------------------------------------------------------------
3ctyA           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
2dw7A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ALENHLVPGFEPTGVGAAARGVFRLPYFHDRIRKLTDTLHEAGAYVTAQLIMQGGMPHGPSPTVTAYVAN
3ej8A           --------------------------------------NWGSGMTFQDTLHHKAKGILTCRS--------
1djqA           ALNTEYCS-INPESDDTHRL-SARIWDEGDVRKAMTDEVHKYGALAGVELMESRATPRGPSQYASEFETL
3e7gC           --------------------------------------NWGSGMTFQDTLHHKAKGILTCRS--------
1djnA           ALNTEYC-SINPESDD-THRLSARIWDEGDVRKAMTDEVHKYGALAGVELMESRATPRGPSQYASEFETL
3dwjB           -------------------------------------------------------TLHHKATSCLGSIMN
1bwkA           AFISPQAGGYDNAPG-------VWSEEQMVEWTKIFNAIHEKKSFVWVQLWVLGNVFMDAEQEAKAKKAN
3dqtB           ----------------------------------------------------------------------
3e7sB           ------------------------------------------------------------YDTLCAQSQQ
3dqsA           ----------------------------------------------------------------------
1dd7A           ---------------------------------------------------------------------N
3e7gA           --------------------------------------NWGSGMTFQDTLHHKAKGILTCRS--------
1dwxA           --------------------------------------------------------YVRIKNWGSEILHD
3e68A           ----------------------------------------------------------------------
3eahB           ----------------------------------------------------------------------
3c56A           ----------GNEILLKAHKEGYGVGAFNFVLNAIFEAGNEENSPLFIQASEGAIKYMGIDMAVGMVKIM
3e65B           --------------------------------------NWGSGEILHDTLHHKATSDFTCKSKSLGSIMN
1df1A           --------------------------------------NWGSGEILHDTLHHKATSDFTCKSKSLGSIMN
2dv2A           ----------------------------LRFDPAYEKISRRFHENPEQFADAFATHRDMGPRARYLGPEV
1bwlA           TMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLWVLGNVFMDAEQEAKAKKAN
2aeaD           ----------------------------------------------------------------------
3e65A           -------------------------------------------------------------------IKN
3dwjA           ------------------------------------------SGEILHDTLHHKATSSIMNPK--SLTRG
3e68B           ----------------------------------------------------------------------
3e7mA           --------------------------------------------------------KATSDFTCLGSIMN
2abbA           GLIISEATQISAQAKGYAGAPGLHSPEQIAAWKKITAGVHAEDGRIAVQLWHTTRTSLRDENGNAIRVDT
3e7sA           --------------------------------------NWELGSITYDTLCAQSQQDGPCTP--------
1dwxB           --------------------------------------NWGSGEILHDTL---HHKATCLGS-----IMN
2an0A           ----------------------------------------------------------------------
3eahA           --------------------------------------NWEVGSITYDTL-----SAQAQQD-GPCTPRR
3c52B           -----------------AHKEGYGVGAFNFVLNAIFEAGNEENSPLFIQASEGAIKYMGIDMAVGMVKIM
3drwA           ----------------------------------------------------------------------
1b3oB           ---------------------------RVRCGIPITDTGRMGSRLVGIIIMTKREDLVVAPAGITLKEAN
2dv1A           ----------------------------------------------------------------------
2an2A           ----------------------------------------------------------------------
3cb3A           ----------------------------------------------------------------------
3bjsA           ----------------------------------------------------------------------
3cb3B           ----------------------------------------------------------------------
3dfhA           --------------------------------QRPLAVKTMVDEYLKPILILWQMMMVNAYWRNGPVINN
2e68B           ---------SKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLS-----
3bjsB           ----------------------------------------------------------------------
3bsmA           --------------------------------QYLYRGAYWRRGPVTMTAIAAVDMAL---WDIKAKAAG
1a53A           -------------------------------LKGWLKDVVQLSLRRPSFRASRQSLNERILEFNKRNITA
1bkhB           ----------------------------------------------------------------------
3ddmA           ----------------------------------------------------------------------
2e66A           ----------------------------------------------------------------------
1d3hA           MGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGV
2ejrA           ----------------------------------------------------------------------
3c52A           --------------------------------NEILLKAHKEGYGVGAFNFVNFEMLNAIFEAGNEENSP
2djxA           GALVS-----KSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISG--
3dipB           ----------------------------------------------------------GQRAGVPLHVAL
2dw4A           ----------------------------------------------------------------------
2b4gA           ----------------------------------------------------------------------
1d3gA           GFVEIGSVTPKPQEGNPRPRVF---RLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGV
1chrA           ----------------------------------------------------------------------
3c4uA           --------------------------------NEILLKAHKEGYGVGAFNFVNFEMLNAIFEAGNEELFI
2dzwB           ----------------------------------------------------------------------
3c61A           TESASGSLVSKSCTPALREGNPTPRYRALPLGSINSMGLPNNGFDFYLAYAAEQHDYGRKPLFLSMSGLS
1b3oA           ----------------------------------------------------------------------
1a48A           ----------------------------------------------------------------------
3b5vA           ----------------------------------------------------------------------
2djlA           GALVSKSCTSAPRDGNPEPRYMAFPLGSINSM-----GLPNLGFDFYLKYASDLHDYSKKPLFLSI----
3dfyA           ----------------------------------------------------------------------
1al8A           ---------------------------------------HPEGEYATARAASAAGTIMTLSSWATSSVEE
2e68A           ----------KSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLS-ISGL
2dzsB           ----------------------------------------------------------------------
3dg6A           -------PFTYGETQTGIVAVIEQYFAPALIGLTLTEREV-----AHTRMARTVGNPTAKAAIDMA-MWD
2c3zA           ----------------------------------------------------------------------
3c56B           -------------------------------LNAIFEAGNEENSPLFIQASEGAIKYMGIDMAVGMVKIM
3bpwB           ----------------------------------------YALTFKMFAFYIPYGSVDVLKNVFDYLYEL
2dzwA           ----------------------------------------------------------------------
3eezA           ----------------------------------------------------------------------
3dg3A           ----------------------------------------------------------------------
2bahA           ----------------------------------------------------------------------
1bkhC           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
3dgbA           ----------------------------------------------------------------------
3c3nA           ----------KSCTSAPRDGNPEPRYMAVPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSI---S
1dtnA           ----------------------------------------------------------------------
2dzpA           ----------------------------------------------------------------------
1b57A           ----------------VAKENNFALPAVNCVINAVLETAAKVKAPVIVQFSNGGASFIAGSGAHHVHQMA
3dtvD           -------------------------------------------------------------PDLPFIASG
2drvA           ----------------------------------------------------------------------
1bkhA           ----------------------------------------------------------------------
2dzuA           ----------------------------------------------------------------------
2dzuB           ----------------------------------------------------------------------
2e09B           ----------------------------------------------------------------------
1al7A           -------------------------------------------------------------IMTLSSWAT
3dfyL           ----------------------------------------------------------------------
2dztB           ----------------------------------------------------------------------
3ct2A           ----------------------------------------------------------------------
3cb3C           ----------------------------------------------------------------------
3dfyF           ----------------------------------------------------------------------
1dqwA           -------------------------------------------------------------KALSAKYNF
2dztA           ----------------------------------------------------------------------
3cb3D           ----------------------------------------------------------------------
2ehhA           ----------------------------------------------------------------------
2e09A           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2dzpB           ----------------------------------------------------------------------
3dfyB           ----------------------------------------------------------------------
3eb2D           ----------------------------------------------------------------------
3dfyE           ----------------------------------------------------------------------
3derA           ----------------------------------------------------------------------
3dk9A           ----------------------------------------------------------------------
1dj8A           --------------------------------------SWTCEDFLAVDES--FQPTAVGFAEALNNKDK
3dbyR           ----------------------------------------------------------------------
1dncA           ----------------------------------------------------------------------
2btmA           ----------------------------------------------------------------------
1bg8A           --------------------------------------SWTCEDFLAVDE--SFQPTAVGFAEALNNKDK
3eb2A           ----------------------------------------------------------------------
2dzxA           ----------------------------------------------------------------------
3bofA           ---------------------------------------------------------YTDKFLVVEPNAG
2dzvB           ----------------------------------------------------------------------
3d4oC           ----------------------------------------------------------------------
2bc0A           ----------------------------------------------------------------------
1a0dA           ----------------------------------------------------------------------
1ad1B           ----------------------------------------------------------------------
3dbyH           ----------------------------------------------------------------------
2bznC           -------------------------------LTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKF
2e77C           ----------------------------------------------------------------------
2a0nA           ----------------------------------------------------------------------
2cyjA           ----------------------------------------------------------------------
2czgB           ----------------------------------------------------------------------
2e1mA           ----------------------------------------------------------------------
3c6eA           ----------------------------------------------------------------------
1amkA           ----------------------------------------------------------------------
2dwcB           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1bhyA           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
2dwcA           ----------------------------------------------------------------------
2cfyA           ----------------------------------------------------------------------
2czgA           ----------------------------------------------------------------------
2dzvA           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
1cc4A           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2culA           ----------------------------------------------------------------------
1dbtA           --------------------------------------LAPFQQEPLF-VKVGMELFYQEGPSIVKQLKE
2bznA           ----------------------------------------------------------------------
2bxrA           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
1cc6A           ----------------------------------------------------------------------
1btmA           ----------------------------------------------------------------------
3b8iE           -----------------------------------------------------ALITLSEFVEQATRIGR
1ad4A           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
3cpiG           ----------------------------------------------------------------------
1dbtB           ----------------------------------------------------------------------
1b37A           ----------------------------------------------------------------------
2bxsA           ----------------------------------------------------------------------
3b8iA           ----------------------------------------------------------------------
2a87B           ----------------------------------------------------------------------
1ec7C           ----------------------------------------------------------------------
2cffA           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2bwgD           --------------------------------------------------IIVANMDTVGTFEMAAVMSQ
2dzsA           ----------------------------------------------------------------------
3dl2B           ----------------------------------------------------------------------
3cpjG           ----------------------------------------------------------------------
3cnpA           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
1aogB           ----------------------------------------------------------------------
3d4oA           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3cnsB           ----------------------------------------------------------------------
2bc1A           ----------------------------------------------------------------------
2dkiA           ----------------------------------------------------------------------
2bs2A           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------
2brxA           ----------------------------------------------------------------------
3ctyB           ----------------------------------------------------------------------
3cnsA           ----------------------------------------------------------------------
3bi8A           ----------------------------------------------------------------------
2c72A           ----------------------------------------------------------------------
2a7rC           --------------------------------------------------IIAANM-DTVGTFEMAKVLC
2du8A           ----------------------------------------------------------------------
1b9bA           --------------------EIVVCPPFTA-LSEVGEILSGRNIKLGAQNVFYEDQEISPLMLQEIGVEY
2a87A           ----------------------------------------------------------------------
3eb2B           ----------------------------------------------------------------------
1d7yA           ----------------------------------------------------------------------
3d1cA           ----------------------------------------------------------------------
1cjcA           ----------------------------------------------------------------------
2ehhC           ----------------------------------------------------------------------
3bh1C           ----------------------------------------------------------------------
2bmuB           ----------------------------------------------------------------------
3c4aA           ----------------------------------------------------------------------
2dp3A           ----------------------------------------------------------------------
2bznB           -------------------------------VDLTRSFSFRNSKQTYSGVIIAANMDTVGTFEMAKVLCK
2dzxB           --------------------------------------------------SLIPYLTAGPDKQSTLNFLL
3cnjA           ----------------------------------------------------------------------
3cpiH           ----------------------------------------------------------------------
2amfE           ----------------------------------------------------------------------
2dkhA           ----------------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
1b37B           ----------------------------------------------------------------------
1cj2A           ----------------------------------------------------------------------
2b9wA           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
3b3rA           ----------------------------------------------------------------------
1cl0A           ----------------------------------------------------------------------
3c4nA           ----------------------------------------------------------------------
3cqjA           ----------------------------------------------------------------------
3d4oB           ----------------------------------------------------------------------
3coxA           ----------------------------------------------------------------------
2dw6A           ----------------------------------------------------------------------
2agkA           ----------------------------------------------------------------------
3cqhA           ----------------------------------------------------------------------
1d5tA           ----------------------------------------------------------------------
3d8xA           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
3djeB           ----------------------------------------------------------------------
2ciqA           ----------------------------------------------------------------------
3c24A           ----------------------------------------------------------------------
3cgbA           ----------------------------------------------------------------------
3dghB           ----------------------------------------------------------------------
1ec7A           ----------------------------------------------------------------------
2cduB           ----------------------------------------------------------------------
2dqwB           ----------------------------------------------------------------------
1eehA           ----------------------------------------------------------------------
1b8sA           ----------------------------------------------------------------------
2e4gB           ----------------------------------------------------------------------
2amfA           ----------------------------------------------------------------------
3cphH           ----------------------------------------------------------------------
1b73A           ----------------------------------------------------------------------
1c0iA           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
2c76A           ----------------------------------------------------------------------
2aqwA           -------------------------------------------------------------INALKNVFD
2bmuA           ----------------------------------------------------------------------
1e0dA           ----------------------------------------------------------------------
3eanC           ----------------------------------------------------------------------
2eggB           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2d4aA           ----------------------------------------------------------------------
2c75B           ----------------------------------------------------------------------
3eanD           ----------------------------------------------------------------------
3eanA           ----------------------------------------------------------------------
3ctyA           ----------------------------------------------------------------------
1eepB           -------------------------------PSEVSLKTQLTKNISLNIPFLSSAMDTVTESQMAIAIAK
2dw7A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QVSHALDRDEIAWFINEYAESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLL
3ej8A           --------KSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEE-------HLARVE
1djqA           SYCKEMDLSDIAQVQQFYVDAAKRSRDAGFDIVYVYGAHSYLPLQFLNPYYNKRTDKYGGSLENRARFWL
3e7gC           --------KSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEE-------HLARVE
1djnA           SYCKEMDLSDIAQVQQFYVDAAKRSRDAGFDIVYVYGAHSYLPLQFLNPYYNKRTDKYGGSLENRARFWL
3dwjB           PKSLTRGPRDKPTPLEELLPHAIEFINQYYGSFKEAK----------IEEHLARLEAVTKEIETTGTYQL
1bwkA           NPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEINSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTL
3dqtB           ---PRVKNWELGSITYDTLCAQSQQDGPCTPRRCLGSLPRPPPAEQLLSQARDFINQYYSSIEERLQEVE
3e7sB           DGPCTPRRCLGSLVLPRKLPPAEQLLSQARDFINQYYSSIKR---SGSQAHEERLQEVEAEVASTGTYHL
3dqsA           ---KFPRVKNWE--LGSITYDTLCAQSQQDGPCTPRRCLGSLVLPQLLSQARDFINQYYSSIEERLQEVE
1dd7A           PKSLTRGPRDKPTPLEELLPHAIEFINQYYGSFKE----------AKIEEHLARLEAVTKEIETTGTYQL
3e7gA           --------KSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEE-------HLARVE
1dwxA           TLHHKATSDSCLGSIMNPKSLTRGPRDKPTPLEELLPHAIEFINQY------YGSFKEAKIEEHLARL-E
3e68A           ---------HKATSDFTSCLGSINPKSLTRGPRDKPTPLEELLPHAIEFINQYEHLARLEAVTKEIETTG
3eahB           ------------RCLGSLVFPPEQLLSQARDFINQYYSSIKR---SGSQAHEQRLQEVEAEVAATGTYQL
3c56A           CERYPHIPVALHLDHGTTFESCEKAVKAGFTSVMIDASHHAFEELELTSKVVKMAHNAGVSVEAELGRLM
3e65B           PKSLTRGPRDKPTPLEELLPHAIEFINQYYGSFKEAK----------IEEHLARLEAVTKEIETTGTYQL
1df1A           PKSLTRGPRDKPTPLEELLPHAIEFINQYYGSFKEAK----------IEEHLARLEAVTKEIETTGTYQL
2dv2A           PAEVLLWQDPIPAVDHPLIDAADAAELKAKVLASGLTVSQLVSTAWAAASTFRGSDKRGGANGARIRLAP
1bwlA           NPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEINSAHGYLLNQFLDPHSNTRTDEYGGSIENRARFTL
2aeaD           ----------MAGRGGVVWDKILPPECAPNSSILRLSADLRWE--EAHEPLHVDIDTGKVCGVGPGMAFV
3e65A           WGSGEILHDHKATSDFTSCLGSINPKSLTRGPRDKPTPLEELLPHAIEFINQYGSFKEAKIEEHLARLE-
3dwjA           PRDKPTPLEEL--------------LPHAIEFINQYYGSFKE---AKIEEHLARLEAVTKEIETTGTYQL
3e68B           ----------------------------------LPHAIE-FINQYYGSFKEAKIEEHLEAVTKEIETTG
3e7mA           PKSLTRGPRDKPTPLEELLPHAIEFINQYYGSFKEAK----------IEEHLARLEAVTKEIETTGTYQL
2abbA           TTPRALELDEIPGIVNDFRQAVANAREAGFDLVELHSAHGFLLHQFLSPSSNQRTDQYGGSVENRARLVL
3e7sA           ----------RRCLGSLVLPRKE----------QLLSQARDFINQYYSKRSGSQAHEERLEVASTGTYHL
1dwxB           PKSLTRGPRDKPTPLEEL----------------LPHAIE-FINQYYGSFKEAKIEEHLEAVTKEIETTG
2an0A           ---------------------------------------------ILWNEAKAFIAECYAELG-KAEEVA
3eahA           CLGSLVFPEQLLSQARDF--------------INQYYSS---IKRSGSQAHEQRLQEVEAEVAATGTYQL
3c52B           CERYPHIPVALHLDHGTTFESCEKAVKAGFTSVMIDASHHAFEELELTSKVVKMAHNAGVSVEAELGRLM
3drwA           -------NSGRFIVSARFESISRIETREDIKPFLGEIGKEVDGAIFSGYQGLRTKYSDGKDANYYLRRAK
1b3oB           EILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLAQAGV
2dv1A           ---DHPLIDAADAAELKAKVLASGLTVSQLVSTAWAAASDKRGGANGARIRLAPQKDWEANQPEQLAAVL
2an2A           ------------------------------HAAILWNEAKAFIAECYAEEVADRLDSIKSEIDLTGSYVH
3cb3A           ---DLKAKRAGLSLAKLLGSYRDSVRCYNTSGGFLHTPIDQLMVNASASIERGIGGIKLKVGQPDGALDI
3bjsA           -----IRGKAANMPLYELLGGSKRRIPAYAGGIALGYQPKESLAEEAQEYIARGYKALKLRIGDAARVDI
3cb3B           ---------DLKAKRAGLSLAKLLGSYRDSVRCYNTSGGFLHTPIDQLMVNASASIERGIGGQPDGALDI
3dfhA           AISGKAKLAGMPLHQLFGGKSRDAIPVYTHATSDTMEGIYDLVEGFLEKGYKHIRCQLGFDQDQYMDNTL
2e68B           -----ISGLSVEENV-AMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPF
3bjsB           -----IRGKAANMPLYELLGGSKRRIPAYAGGIALGYQPKESLAEEAQEYIARGYKALKLRIGDAARVDI
3bsmA           MPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYR--------AVRVQSGVPGSTEKYLNHAP
1a53A           IIAEYKRKSPSGLDVERDPIEYSKFMERYAVGLSILTEEKYFNGSYETLRKIASSVSIPILMKDFIVKES
1bkhB           -----------------------------------AWTLASGDTARDIAEARHMLEIRRHRVANPVEQDL
3ddmA           ---------------------AWLGGSGDRIGVYASGINPENPEDVVARKAAEGYRAFKLKVGFDDARDV
2e66A           --------------WESAEKVVKTLLKERLACANLREHRA----FYWWEGKIEEDKEVGAILKTREALWE
1d3hA           NLGK----NKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNT--------AGLRSLQGKAELRRLLTKVL
2ejrA           ----------------------------------------------------------------------
3c52A           -LFIQASEGAIKYMGIDMAVGMIMCERYPHIPVALHLDHGTTFESCEKGFTSVMIDASHHAFEENLELTS
2djxA           ---------LSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPF
3dipB           GGAARDRVPVYATFMRDAGVLAESLVAEGYAAMKIWPFDD------------FASITPHHISLTDLKDGL
2dw4A           ----------------------------------------------------------------------
2b4gA           --------------SVEMVKKLVPITKEKGTILELNLSCPNVPGKPQVGYDFDTTRTYLQKVSEAYGLPF
1d3gA           NLG----KNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSP------------NTAGLGKAELRRLLTKVL
1chrA           -----------------------------------GDTKRDLDSAVEMIERRRHNRFKVKLGFRSPQDDL
3c4uA           QASEGAIKYMGIDMAVGMVKIMCE--RYPHIPVALHLDHGTTFESCEKAVKAGFTSVMIDASHHFEENLE
2dzwB           ----------------QSTLNFLLALDEYAGAIELGIPFSDPIDGKTIQESHYRALKNGFKLREAFWIVK
3c61A           V-----------RENVEMCKRLAAVATEKGVILELNLSCPNVPGKPQVAYDFDAMRQCLTAVSEVYPHSF
1b3oA           -----------------VTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKDYPLASKDAKKQLLCGA
1a48A           ----------------------------------------------------------------------
3b5vA           ------------LDVERDPIEYSKFMERYAVGLSITTEAKYFNGSYIASSVSIPILMADFIVKESQIDDA
2djlA           -------SGLSVEENVAMVRRLAPVAQEKGVLLELNLSCP--NVPGKPQVAYDFEAMRTYLQQVSLAYGL
3dfyA           ----------------------------------------KEAKKIFEEGFRVIKIKVGENL----KEDI
1al8A           VASIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDT-------PRLIKNRFVLPPFLTLKNFEGIDL
2e68A           SVEENVAMVRRLAPVAQE----------KGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPF
2dzsB           ----------------QSTLNFLLALDEYAGAIELGIPFSDPIDGKTIQESHYRALKNGFKLREAFWIVK
3dg6A           ALGQSLRLSVSEMLGGYTDRMRVSHMLGFDDPVKMVAE------AERIRETYGINTFKVKVGRRPVQLDT
2c3zA           --------SPSGLDVERDPIEYSKFMERYAVGLSILTEEKYFNGSYETLRKIASSV-SIPILMKDFIVKE
3c56B           CERYPHIPVALHLDHGTTFESCEKAVKAGFTSVMIDASHHAFEELELTSKVVKMAHNAGVSVEAELGRLM
3bpwB           NIPTILDMKINDIGNTVKNYRKFIFEYLKSDSCTVNIYMG----------TNMLKDICYDEEKNKYYSAF
2dzwA           ----------------QSTLNFLLALDEYAGAIELGIPFSDPIADGKT---IQESHYRALKNGFKLREAF
3eezA           ----------------------------------------------------------------------
3dg3A           --------------------------------------VKMVAEAERIRETYGINTFKVKVGRRPVQLDT
2bahA           -------------------EMAAWDLWARTLGVPLCTLLGGHKEQVEVGVSLGIQADEQATVDLVRRHVE
1bkhC           ------------------------------DSLEVAWTLASGDTARDIAEARHMLEIRRHRGANPVEQDL
2b4gB           --------------SVEMVKKLVPITKEKGTILELNLSCPNVPGKPQVGYDFDTTRTYLQKVSEAYGLPF
2a1yA           --NNYFYIMHRFQPEKRISFIRDMQSRGLIASISVGVKEDEYEFVQLAAEHLTPEYITIDIAHGHSNAVI
3dgbA           ----------------LGLPVSELLGGRVRDALPVAWTLASGDTAKDIAEAQKMLDLRRHRIAGEVDRDL
3c3nA           GLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYF
1dtnA           -----------------------------------------------------------------LDQDL
2dzpA           ----------------QSTLNFLLALDEYAGAIELGIPFSDPIADGKT---IQESHYRALKNGFKLREAF
1b57A           EHYGVPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKP---------LFSSHMIDLSEESLQENIEICS
3dtvD           LGLGSVTPEGYDAVIESVVDHARRLQKQGAAVVSLMGTSFYRGAAFNAALTVAMREATGLPCTTMSTAVL
2drvA           ----------------------------------------------------------------------
1bkhA           ---------------------------------------------------------------NPVEQDL
2dzuA           ----------------QSTLNFLLALDEYAGAIELGIPFSDPIADGKTI---QESHYRALKNGFKLREAF
2dzuB           ---------------------FLLALDEYAGAIELGIPFSDPIADGK---TIQESHYRALKNGFKLREAF
2e09B           ----------------QSTLNFLLALDEYAGAIELGIPFSDP---IADGKTIQESHYRALKNGFKLREAF
1al7A           SSVEEVASTGPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPFLTL
3dfyL           ---------------------------------------------------------------------I
2dztB           ----------------QSTLNFLLALDEYAGAIELGIPFSDPIADG---KTIQESHYRALKNGFKLREAF
3ct2A           -----------------------------------------------------------------VDRDL
3cb3C           --------------------------------------------------------------QPDGALDI
3dfyF           ---------------------------------------------------------------------I
1dqwA           LLFEDRKFADIGNTVKLQYSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCK
2dztA           ----------------QSTLNFLLALDEYAGAIELGIPFSDP---IADGKTIQESHYRALKNGFKLREAF
3cb3D           ----------------------------------------------------------------DGALDI
2ehhA           --------------YEALGNLIEFHVDNGTDAILVCGTT-------------------GESPTLTFEEHE
2e09A           ---------------------FLLALDEYAGAIELGIPFSDP---IADGKTIQESHYRALKNGFKLREAF
2a4aB           -----------------------------------KVLNDTEKALDDGADEIDLVINYKKIIENTDEGLK
2dzpB           ----------------QSTLNFLLALDEYAGAIELGIPFSDP---IADGKTIQESHYRALKNGFKLREAF
3dfyB           ---------------------------------------------------------------------I
3eb2D           --------------ADVMGRLCDDLIQAGVHGLTPLGST-------------------GEFAYLGTAQRE
3dfyE           ---------------------------------------------------------------------I
3derA           ---------------------------------------------------------------------I
3dk9A           ----------------------------------------------------------------------
1dj8A           PEDAVLDVQGIATVTPAIVQACTQDKQANKDKVKGE----------------------------------
3dbyR           ----------------------ESALFEHQFWLKVLTDHAQ-----------FLLDALAPKEKEDIKKAT
1dncA           ----------------------------------------------------------------------
2btmA           ------------------------------------------------SERRQMFAETDETVNKKVLAAF
1bg8A           PEDAVLDVQGIATVTPAIVQACTQDKQANKDKVKGE----------------------------------
3eb2A           --------------ADVMGRLCDDLIQAGVHGLTPLGSTGEFAYLG-------------------TAQRE
2dzxA           ----------------QSTLNFLLALDEYAGAIELGIPFSDPIADG---KTIQESHYRALKNGFKLREAF
3bofA           KPIVENGKTVYPLKPHDFAVHIDSYYELGVNIFGGCCGTTPEHVKLFRKVLGNRKPLQRKKKRIFAVSSP
2dzvB           ------------------TLNFLLALDEYAGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAF---
3d4oC           ----------------------------------------------------------------------
2bc0A           ----------------------------------------------------------------------
1a0dA           -------YSGMDLAKARVEAAFEFFEKLNIPFFCFHDVDIAPEGETLKETYKNLDIIVDMIEEYMKTSKT
1ad1B           ----------------------------------------------------------------------
3dbyH           ----------------------ERNYEESALFEHQFWLK------VLTDHAQFLLDALAPKEKEDIKKAT
2bznC           SLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQ-ILEAIPQVKYICLDVANGYSEHFV
2e77C           --------------DQQNRDILDEAKSDGATAIILTADSTVSGNRDRDVKNKFVYPFGMIYGASKQKISP
2a0nA           ---------------------------------------------------------------------K
2cyjA           ----------------------------------------------------------------------
2czgB           ----------------------------------------------------------------------
2e1mA           ----------------------------------------------------------------------
3c6eA           ----------------------------------------------------------NRDFVEGVSGGS
1amkA           ---HSERRTYYGETDEIVAQKVSEACKQGFMVI-------------ACIGETLQQREANQTAKVVLSQTS
2dwcB           ----------------------------------------------------------------------
1ak5A           -------------------------------LVGAGINTRDFRERVPALVEAGADVLCIDSSDGFSEWQK
1bhyA           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
2dwcA           ----------------------------------------------------------------------
2cfyA           ----------------------------------------------------------------------
2czgA           ----------------------------------------------------------------------
2dzvA           ----------------QSTLNFLLALDEYAGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIV
2c6qA           --------------------------------------------------------------------FV
2bznD           ---------------------------------------------------------------GYSEHFV
1cc4A           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
2a4aA           -------------------------------------------EIDLVINYKKIIENTDEGLKEATKLTQ
2culA           ----------------------------------------------------------------------
1dbtA           RNCELFLDLKLHDIPTTVNKAMKRLASLGVDLVNVHAAG---------GKKMMQAALEGLEEGTPAGKKR
2bznA           ------------------------------------------------------------------EHFV
2bxrA           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
1cc6A           ----------------------------------------------------------------------
1btmA           ----------------------------------------------------------------------
3b8iE           VARLPVIADADHGYGNALNRTVVELERAGIAALTIEDTLLP-----------AQFGRKSTDLICVEEGVG
1ad4A           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
3cpiG           ----------------------------------------------------------------------
1dbtB           ----------------------------HDIPTTVNKAMKRLASLGVDLVNVHAAGGKKMMQAALEGLEE
1b37A           ----------------------------------------------------------------------
2bxsA           ----------------------------------------------------------------------
3b8iA           -----ADADHGYGNALNVMRTVVELERAGIAALTIEDTLLP-----------AQFGRKSTDLICVEEGVG
2a87B           ----------------------------------------------------------------------
1ec7C           ---------------------------------------------------------------------A
2cffA           ------------------VELVEKLIEEGFTLIHVVDLSNAIENSGENLPVLEKLSEFAEQIGGGIRSLD
2e77A           -------------QNRDILDEAKSDGATAIILTADSGNRDRDVKNKFVYPFGMPIVQNNIYGASKQKISP
2bwgD           HSMF-TAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTILEAVPQVKFICLDVANGYSEHFV
2dzsA           ------------------TLNFLLALDEYAGAIELGIPFSDIQESHYRALKNGFKLREAFWIVKEFRRHS
3dl2B           ----------------------------------------------------------------------
3cpjG           ----------------------------------------------------------------------
3cnpA           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
1aogB           ----------------------------------------------------------------------
3d4oA           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3cnsB           ----------------------------------------------------------------------
2bc1A           ----------------------------------------------------------------------
2dkiA           ----------------------------------------------------------------------
2bs2A           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------
2brxA           ----------------------------------------------------------------------
3ctyB           ----------------------------------------------------------------------
3cnsA           ----------------------------------------------------------------------
3bi8A           ----------------------------------------------------------------------
2c72A           ----------------------------------------------------------------------
2a7rC           KFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLQILEAIPQVKYICLDVANGYSEHFV
2du8A           ----------------------------------------------------------------------
1b9bA           VIVGHSERRRIFKEDDEINRKVKAVLEKGMTPI-------------LCVGETLEEREKGLTFCVVEKQVR
2a87A           ----------------------------------------------------------------------
3eb2B           --------------ADVMGRLCDDLIQAGVHGLTPLGS-------------------TGEFAYLGTAQRE
1d7yA           ----------------------------------------------------------------------
3d1cA           ----------------------------------------------------------------------
1cjcA           ----------------------------------------------------------------------
2ehhC           -----------------LGNLIEFHVDNGTDAILVCGTT-------------------GESPTLTFEEHE
3bh1C           ----------------------------------------------------------------------
2bmuB           ----------------------------------------------------------------------
3c4aA           ----------------------------------------------------------------------
2dp3A           ---VIVGHSERRRIMGESAKKAKRALEKGMTVI-------------FCVGETLDERKANRTMEVNIAQLE
2bznB           FVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANG-----YSEHFV
2dzxB           ALDEYAGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRRHSSTPIVLMTYEAKASGVD
3cnjA           ----------------------------------------------------------------------
3cpiH           ----------------------------------------------------------------------
2amfE           ----------------------------------------------------------------------
2dkhA           ----------------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
1b37B           ----------------------------------------------------------------------
1cj2A           ----------------------------------------------------------------------
2b9wA           ----------------------------------------------------------------------
2bwgB           -------------------------------------------------------------------HFV
2c6qB           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
3b3rA           ----------------------------------------------------------------------
1cl0A           ----------------------------------------------------------------------
3c4nA           ----------------------------------------------------------------------
3cqjA           -----------------WLERLQLAKTLGFDFVEMSVDE--------TDERLSRLDWSREQRLALVNAIV
3d4oB           ----------------------------------------------------------------------
3coxA           ----------------------------------------------------------------------
2dw6A           ----------------MLRGEMRGYLDRGYNVVKMAIGGAPI------------------------EEDR
2agkA           ------NNDDAAREALQESPQFLQVGGGINDTNCLEWLKWASKVIVTSWLFTKEGHFQLKRLE--RLTEL
3cqhA           ---------EKALPAECWLERLQLAKTLGFDFVESVDETD------------ERLSRLDWSREQRLALVN
1d5tA           ----------------------------------------------------------------------
3d8xA           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
3djeB           ----------------------------------------------------------------------
2ciqA           ----------------------------------------------------------------------
3c24A           ----------------------------------------------------------------------
3cgbA           ----------------------------------------------------------------------
3dghB           ----------------------------------------------------------------------
1ec7A           ----------------------------------------------------------------------
2cduB           ----------------------------------------------------------------------
2dqwB           ----------------------------------------------------------------------
1eehA           ----------------------------------------------------------------------
1b8sA           ----------------------------------------------------------------------
2e4gB           ----------------------------------------------------------------------
2amfA           ----------------------------------------------------------------------
3cphH           ----------------------------------------------------------------------
1b73A           ----------------------------------------------------------------------
1c0iA           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
2c76A           ----------------------------------------------------------------------
2aqwA           YLNSNIPTLDKINDIGNTVYRKFIFEYLKSDSCTINVYG-------------TNLKDICFDYEKNKYYSA
2bmuA           ----------------------------------------------------------------------
1e0dA           ----------------------------------------------------------------------
3eanC           ----------------------------------------------------------------------
2eggB           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------TAEGMSLNNIYGASKQKI
2d4aA           ----------------------------------------------------------------------
2c75B           ----------------------------------------------------------------------
3eanD           ----------------------------------------------------------------------
3eanA           ----------------------------------------------------------------------
3ctyA           ----------------------------------------------------------------------
1eepB           ESIEAQRKEIEKVKTYDFPNACKDLNNKLRVGAAVSIDIDTI-ERVEELVKAHVDILVIDSAHGHSTRII
2dw7A           ----------------MLRGEMRGYLDRGYNVVKMKIGGAPI------------------------EEDR


                         .         .         .         +         .         .         .:280
query           EIIDAIRAEVGPDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHYY
3ej8A           AVTKEIETTGTYQLTGAWRNAPRCIGRIQWSNLQVFDARSCSTAREMFEHICRHVRYST--NNGNIRSAI
1djqA           ETLEKVKHAVGSDCAIATRFGVDTVYGPGQIAEVDGQKFVEMADSLVDMWDITIGDIAEWGEDAGPSRFY
3e7gC           AVTKEIETTGTYQLTGAWRNAPRCIGRIQWSNLQVFDARSCSTAREMFEHICRHV--RYSTNNGNIRSAI
1djnA           ETLEKVKHAVGSDCAIATRFGVDTVYGPGQIEEVDGQKFVEMADSLVDMWDITIGDIAEWGEDAGPSRFY
3dwjB           TLDELIFATK-----MAHRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHI---LYATNNGNIRSA
1bwkA           EVVDALVEAIGHEKVGLGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEG
3dqtB           AEVASTGTYHLRESELAWRNAPRCVGRIQWGKLQVFDARDCSSAQEMFTYI--CNHIKYATNRGNLRSAI
3e7sB           RESELVFGAK-----QAWRNAPRCVGRIQWGKLQVFDARDCSSAQEMFTYICNHI--KYATNRGNLRSAI
3dqsA           AEVASTGTYHLRESEQAWRNAPRCVGRIQWGKLQVFDARDCSSAQEMFTYICNHIKYATNR--GNLRSAI
1dd7A           TLDELIFATKWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYATN---------NGNIRSAI
3e7gA           AVTKEIETTGTYQLTGDELIFPRCIGRIQWSNLQVFDARSCSTAREMFEHICRHVRYSTNN--GNIRSAI
1dwxA           AVTKEIETTGTFATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHI--LYATNNGNIRSAI
3e68A           TYQLTLDELIFATK-MAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILY--ATNNGNIRSAI
3eahB           RESELVFGAK-----QAWRNAPRCVGRIQWGKLQVFDARDCRSAQEMFTYICNHI--KYATNRGNLRSAI
3c56A           GIAVLVNPKEAEQFVKESQ----------------------------VDYLAPAIGTSHG----AFKFKG
3e65B           TLDELIFATNAPRCIGRIQWSVFDARNCSTAQEMFQHICRHILYAT-NNGNI--------------RSAI
1df1A           TLDELIFATKMPRCIGRIQWSVFDARNCSTAQEMFQHICRHILYAT-NNGNIR--------------SAI
2dv2A           QKDWEANQPEQLAAVLETLEAIRTAFNGALAGCAGVEQAAKNAG-HAVTVPFAPGRADASQEQTDVESMA
1bwlA           EVVDALVEAIGHEKVGLRLSPYMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEG
2aeaD           KVIGLVPCASGGTAI-------KEWERGSHLYERMVKRTEESRKCG-GEIKAVLWYQGESDVLDIHDAES
3e65A           AVTKEIETTGTYQLTLAWRNAPRCIGRIQWSNLQVFDARNC--STAQEMFQHICRHILYATNNGNIRSAI
3dwjA           TLDELIFATKMAHRNAPRCIGRIQWSNQVFDARNCSTAQEMFQHICRILYATN---------NGNIRSAI
3e68B           TYQLTLDELIFATKMA-WRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILY--ATNNGNIRSAI
3e7mA           TLDELIFATKM-----AWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYATNN--GNIRSAI
2abbA           EVVDAVCNEWSADRIG---IRVSPIGTFQNVDNGPNEEADALYLIEELAKRGIAYLHM-----SETDLAG
3e7sA           RESELVFGAK-----QAWRNAPRCVGRIQWGKLQVFDARDCSSAQEMFTYICNHIKYATNRGNLRSAITV
1dwxB           TYQLTLDELIFATKM-AWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHIL--YATNNGNIRSAI
2an0A           DRLDSIKSEIDRTGSYVHTKEELEHGAKFWNSLNVIDRRDVRTKEDVRDALFHHIETATNNGKIRP--SI
3eahA           RESELVFGARCVGRIQWGKLQVFDARDCRSAQEMFTYICNHIKYAT---------------NRGNLRSAI
3c52B           GILVNPKEAEQFVKESQVDY------------------------------LAPAIGTSHGAFKFKGEPKL
3drwA           EDIIEFKEKDVK-----IHVEFASVQDRKLRKKIITNILPFVDSVG-IDEAE--IAQILSVLGYRELADR
1b3oB           DVVVLDSSQGNSIFQINMIKYIKDKYPNLQVIGGNAAQAKNLIDAG-VDALRVGMGSGSICITQEVLACG
2dv1A           ETLEAIRTAFNGAQRGGKQVSLADLI--VLAGCAGVEQAAKNAG--HAVTVPFAPGRADASQEQTDVESM
2an2A           TKEELEHGAMAWRNSNRCIGRLFWNSLNVI-DRRDVRTKEDVRDAL-FHHI--ETATNNGKIRPSITIFP
3cb3A           ARVTAVRKHLGDAVPLMVDAN------QQWDRPTAQRMCRIFEPFN-LVWIEEPLD--------------
3bjsA           ERVRHVRKVLGDEVDILTDAN------TAYTMADARRVLPVLAEIQ-AGWLEEPFACND-----------
3cb3B           ARVTAVRKHLGDAVPLMVDAN------QQWDRPTAQRMCRIFEPFNL-VWI----------------EEP
3dfhA           TMFKSLREKYGNQFHILHDVH------ERLFPNQAIQFAKEVEQYKPYFI-----------------EDI
2e68B           GVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAE-SESVVIKPKQGFGGLGGKYILPTAL
3bjsB           ERVRHVRKVLGDEVDILTDANTA------YTMADARRVLPVLAEIQ-AGWLEEPFACND-----------
3bsmA           KLFAAVRERFGDD------LHVLHDVHHRLTPIEAARLGKAVEPYH-LFWLEDCVPAEN-----------
1a53A           QIDDAYNLGADTVLLIVKILTERELESLLEYARSYGMEPLIEINDENDLDIALRIGARFIGINSRDLETL
1bkhB           KHVVTIKRELGDSASVRVDVN------QYWDESQAIRACQVLGDNG-IDLIEQPIS--------------
3ddmA           RNALHVRELLGAATPLMADANQGW------DLPRARQMAQRLGPAQ---------------LDWLEEPLR
2e66A           ELKERIKELHPYDVPAIIRIDVDDVNEDYLK---------------------------------------
1d3hA           QERDGLRRVHRPAVLVKIA--------PDLTSQDKEDIASVVKELG-IDGLIVTNTTVSRPAGLQGALRS
2ejrA           ----------------------------------------------------------------------
3c52A           KVVKMAHNAGVSVEAELGRL-------MGIVLVNPKEAEQFVKESQ-VDYLAPAIGTSHGAFKFKGEPKL
2djxA           GVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYIL-----
3dipB           EPFRKIRAAVGQRIEIMCELH------SLWGTHAAARICNALADYG-VLWVEDPIAKMD-----------
2dw4A           ----------------------------------------------------------------------
2b4gA           GVKMPPYFDIAHFDMAAAVLNDFPLVKFITCVNSIGNGLVIDPANEVVIKPKQGFGGLGGKY-------V
1d3gA           QERDGLRRVHRPAVLVKIAP--------DLTSQDKEDIASVVKELG-IDGLIVTTVSRPAGLQGALRSET
1chrA           IHMEALSNSLGSKAYLRVDVN------QAWDEQVASVYIPELEALG-VELI----------------EQP
3c4uA           LTSKVVKMAHNAGVSVEAELG--------RVLVNPKEAEQFVKESQ-VDYLAPAIGTSHG---AFKFKGE
2dzwB           EFRRHSSTPIVLMTYYNPIYRAGVRNFLAEAKASGVDGIKTVFLAAPNTPDERLKVIDDMTTGFVYLVSL
3c61A           GVKMPPY-FDFAHFDAAAEILNEFPQVQFITCINSIGNGLVIDAETESVVIKPKQGFGGLGGRYVLP---
1b3oA           AIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVIGGNVVTAVDALRVGMGSR
1a48A           ----------------------------------------------------------------------
3b5vA           YNLGADTVALIVAILTEAELESLLAYARSYGMEPLIKINDENDLDILRIGARFIGIVSADWETLAINKA-
2djlA           PFGVKMPPYFDIAHFDTAAAVLNEF---PLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYI-
3dfyA           EAVEEIAKVTRGAKYIVDA-------NMGYTQKEAVEFARAV--------------YQKGIDIAVYEQPV
1al8A           GLSSYVAGQIDRSLSWKDVAWLQTITSLPILVKGTAEDARLAVQHG-AAGIIVSNHGARQLDYVPATI--
2e68A           GVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYIL-----
2dzsB           EFRRHSSTPIVLMTYYNPIYRKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNTPGFVYLVSL
3dg6A           AVVRALRERFGDAIELYVDGN------RGWSAAESLRAMREMADLD---------------LLFAEELC-
2c3zA           SQIDDAYNLGADTVLLIVKILTERELESLLEYARSYGMEPLIEINDENDLDIALIGARFIGINSRDLETL
3c56B           VLVNPKEAEQFVKESQVDYLAPAIGTSHG--AFKFKGEPKLDFERLQEVKRLTNIPLVLHGASAIPDNVR
3bpwB           VLVKTTNPD-------SAIFQKNLSLDNKQAYVIMAQEALNMSS----YLNLEQNNEFIGF-VVGANSYD
2dzwA           WIVKEFRRHSSTPIVLMTYYNPIYRAGVRNFLAEADERLKVIDDMT-TGFVYLVSLYGTEEIPKTAY---
3eezA           ----DVEDIREPGEIVLYDVN------RGWTRQQALRVMRATEDLH--------------------VMFE
3dg3A           AVVRALRERFGDAIELYVDGN------RGWSAAESLRAMREMADLD-LLFAEELCP--------------
2bahA           QGYRRIKLKIKPGWDVQPVRATRE---AFPDIRLTVDANSAYTLADAGRLRQLDEYD----LTYIEQ--P
1bkhC           KHVVTIKRELGDSASVRVDVN------QYWDESQAIRACQVLGDNG-IDLIEQPIS--------------
2b4gB           GVKMPPYFDIA-HFDMAAAVLNDFPLVKFITCVNSIGNGLVIDPANETVVIKPKQGFGG-----LGGKYV
2a1yA           NMIQHIKKHLPESFVIAGNVGTPE-------------AVRELENAG-ADATKVGIGPGKVCITKIKTGFG
3dgbA           AHVIAIKKALGDSASVRVDVN------QAWDEAVALRACRILGGNG-IDLIEQPIS--------------
3c3nA           DIAHFDT--------AAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALA
1dtnA           AVVRSIRQAVGDDFGIMVDYN------QSLDVPAAIKRSQALQQEG-VTWIEEPT---------------
2dzpA           WIVKEFRRHSSTPIVLMTYYNPIYRAGVRNFLAEAKEFTEIAREEG-IKTVFLAAPNTPMTTGFVYLVEI
1b57A           KYLERMSK---IGMTLEIELGCTGGEELYTQEDVDYAYTELSKISP-RFTIAASFGNVHGVY-KPGNVVL
3dtvD           NGLRALGVR---RVALATAYIDDVNERLAAFLAEESLVPTGCRSLGITGVEAMARVDTATLVDLCVRAFE
2drvA           ----------------------------------------------------------------------
1bkhA           KHVVTIKRELGDSASVRVDVN------QYWDESQAIRACQVLGDNG-IDLIEQPIS--------------
2dzuA           WIVKEFRRHSSTPIVLMTYYNPIYRAGVRNFLAEAKASGVNFTEIAREEGIKTVFLAAPNTPSLYGTEEI
2dzuB           WIVKEFRRHSSTPIVLMTYYNPIYRAGVRNFLAEVFHAKEFTEIAREEGIKTVFLAAPNTPDERLKVIDD
2e09B           WIVKAFRRHSSTPIVLMTYYNPIYRAGVRNFLAEADERLKVIDDMT-TGFVYLVSLYGTT-------EEI
1al7A           KNFEGIDLGLSSYVAGQIDRSLLQTITSLPILVKGVITAEDARLAVQHGAAGIIVSNHGARQLDYVPATI
3dfyL           EAVEEIA-KVTRGAKYIVDAN------MGYTQKEAVEFARAVYQKGI-DIAVY-------------EQPV
2dztB           WIVKEFRRHSSTPIVLMTYRNFLAEAKASGVAGILVVTEIAREEGIKTVFLAAPNTPDERLKVIDDMTEE
3ct2A           AHVIAIKKALGDSASVRVDVN------QAWDEAVALRACRILGGNG---------------IDLIEQP--
3cb3C           ARVTAVRKHLGDAVPLMVDAN------QQWDRPTAQRMCRIFEPFN---------------LVWIEE-PL
3dfyF           EAVEEIA-KVTRGAKYIVDAN------MGYTQKEAVEFARAVYQKGI-DIAVY-------------EQPV
1dqwA           GSLSTGEYTKGTVD--------------------------------------IAKSDKDFVIGFIAQRDM
2dztA           WIVKEFRRHSSTPIVLMTYYNPIYRAGVRNFLAEKEFTEIAREEGIKTVFLAAPNTPDERLKVIDDMTTE
3cb3D           ARVTAVRKHLGDAVPLMVDAN------QQWDRPTAQRMCRIFEPFN---------------LVWIE-EPL
2ehhA           KVIEFAVKRAAGRIKVIAGT-------GGNATHEAVHLTAHAKEVG-ADGALVVVPYYNKTQRGLYEHFK
2e09A           WIVKAFRRHSSTPIVLMTYYNPIYRAGVRNFLDLPVFHAKEFTEIAREEGIKTVFLAAPNTPDERLKVID
2a4aB           EATKLTQSVKKLLTNKILKVIIEVGELKTEDLI--IKTTLAVLNGN-ADFIKTSTGKVQINATPSSVEYI
2dzpB           WIVKEFRRHSSTPIVLMTYYNPIYRAGVRNFLAEAKASGKTVFLAAPNTPDERLKVIDDMTTGFVYLVSL
3dfyB           EAVEEIA-KVTRGAKYIVDAN------MGYTQKEAVEFARAVYQKGI-DIAVYE-----------QPV--
3eb2D           AVVRATIEAAQRRVPVVAGV-------ASTSVADAVAQAKLYEKLG-ADGILAILEAYFPLKDAQIESYF
3dfyE           EAVEEIA-KVTRGAKYIVDAN------MGYTQKEAVEFARAVYQKGIDIA------------VYEQP--V
3derA           EAVEEIA-KVTRGAKYIVDAN------MGYTQKEAVEFARAVY-------------QKGIDIAVYQP--V
3dk9A           ----------------------------------------------------------------------
1dj8A           ----------------------------------------------------------------------
3dbyR           YFVETFTNLLNKVRNVLMAFSKEAEQAAKEIRAFKLNIIQKQLEGK-ITIHFTPTFINHMVN--------
1dncA           ---------------------------------------------------------NVGVPKKVMWNTA
2btmA           TRGLIPIICCGESLEEREAGQTNAVVSQVEKALAGLTPEQVKQAVIAYEPIWAIGTGKSSTPEDANSVCG
1bg8A           ----------------------------------------------------------------------
3eb2A           AVVRATIEAAQRRVPVVAGV-------ASTSVADAVAQAKLYEKLG-ADGILAILEAYFPLK--------
2dzxA           WIVKEFRRHSSTPIVLMLAEAKASGVDGILVVDLPVFHAKEFTEIARAAGIKTVFTTGFVYLVSLYGTEE
3bofA           SKLVTFDHFVVIGERINPAGRKKLWAEMQKGNEEIVIKEAKTQVEKGAEVLDVNFGIESQIDVRYVEKIV
2dzvB           WIVKEFRRHSSTPIVLMTYYNPIYRAGVAEAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPN
3d4oC           ----------------------------------------------------------------------
2bc0A           ----------------------------------------------------------------------
1a0dA           KLLWNTANLFTHPRFVHGAATSCNADVFAYAAAKVKKGLEIAKRLGAENYVFWGGREGYETLLNTDMKLE
1ad1B           ------------------KTKIMGILNVTPNVESAVTRVKAMMDEG-ADIIDVGGVS---------TMIT
3dbyH           YFVETFT-NLLNKVRNLMAFSKEAEQAAKEIRAFKLNIIQKQLEGK-ITIHFTPTFINHMVN----EVEE
2bznC           EFVKDVRKRFPQHTIMAGNVVT-------------GEMVEELILSGA-DIIKVGIGPGSVCTTRKKTGVG
2e77C           RDIEEIAGHSGLPVFVKGIQH--------------PEDADMAIKRG-ASGIWVSNHGARQLYEAPGSFDT
2a0nA           RIIACLDVKDG-------RVVKGTNFENLRDSGDPVELGKFYSEIG-IDELVFLDITASVEKR-------
2cyjA           ----------------------------------------------------------------------
2czgB           ----------------------------------------------------------------------
2e1mA           ----------------------------------------------------------------------
3c6eA           WVDIVLEHGSCVTTMAKNKPTLDF-----ELIKTEAKQPATLRKYCEAKLTNTTTESRCPTQGEPSLNEE
1amkA           AIAAKLTKDAWNQVVLAYEPVWAIGTG---KVATPEQAQEVHLLL-------------------------
2dwcB           ----------------------------------------------------------------------
1ak5A           ITIGWIREKYGDKVKVGAGNIV------------DGEGFRYLADAG-ADFIKIGIGRGQA-------TAV
1bhyA           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
2dwcA           ----------------------------------------------------------------------
2cfyA           ----------------------------------------------------------------------
2czgA           ----------------------------------------------------------------------
2dzvA           KEFRRHSTYYNPIYRAGVRNFLAEAKASGVDDLPVFHAKEFTEIAREEGIKTVFLTTGFVYLVSLYGTEE
2c6qA           EFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLS---------
2bznD           EFVKDVRKRFPQHTIMAGNVVTG-------------EMVEELILSG-ADIIKVGIGPGSVCTTRKKTGVG
1cc4A           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
2a4aA           SVKKLLTNKILKVIIEVGELK---------TEDLIIKTTLAVLNGN-ADFIKTSTGKVQINATPSSVEYI
2culA           ----------------------------------------------------------------------
1dbtA           PSLIAVTQLTSTSEQIMKDE--------LLIEKSLIDTVVHYSKQAEESGLDGVVCS-------VHEAKA
2bznA           EFVKDVRKRFPQHTIMAGNVVT-------------GEMVEELILSG-ADIIKVGIGPGSVCTTRKKTGVG
2bxrA           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
1cc6A           ----------------------------------------------------------------------
1btmA           -------------------------------------------------------------------CGH
3b8iE           KIRAALEARVDPALTIIARTNA-----ELIDVDAVIQRTLAYQEAG-ADGICL------------VGVRD
1ad4A           ------------------------------NVESAVTRVKAMMDEG-ADIIDVGGVSTRPGHEMITV---
1d7lA           ----------------------------------------------------------------------
3cpiG           ----------------------------------------------------------------------
1dbtB           GTPAGKKRPSLIAVTQLTSTSEQIMKDELLIEKSLIDTVVHYSKQAEESGLDGVVCSVHEAKAIYQAVS-
1b37A           ----------------------------------------------------------------------
2bxsA           ----------------------------------------------------------------------
3b8iA           KIRAALEARVDPALTIIARTNA-----ELIDVDAVIQRTLAYQEAG-ADGICLVGVRDF-----------
2a87B           ----------------------------------------------------------------------
1ec7C           ESIVALA-QRFPQARITLDPN------GAWSLNEAIKIGKYLKG-----------SLAYAEDPCGAEQGF
2cffA           YAEKLRKIVSSKVLEDPSFLKSLREIDVEPVFSLVTRGGRVAFKGWLAEERLKEYGLEEIVHTEIEKDGT
2e77A           RDIEEIAGHSGLPVFVKGIQH--------------PEDADMAIKR-GASGIWVSNHGARQLYEAPGSFDT
2bwgD           EFVKLVRAKFPEHTIMAGNVVT-------------GEMVEELILSG-ADIIKVGVGPGSVCTTRTKTGVG
2dzsA           STPIVLMTYYNPIYRAGVRNFLAAAKASGVDGFHAKEFTEIAREEGIKTVFLAAPNTPDMTTGFVYLVSE
3dl2B           ----------------------------------------------------------------------
3cpjG           ----------------------------------------------------------------------
3cnpA           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
1aogB           ----------------------------------------------------------------------
3d4oA           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3cnsB           ----------------------------------------------------------------------
2bc1A           ----------------------------------------------------------------------
2dkiA           ----------------------------------------------------------------------
2bs2A           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------
2brxA           ----------------------------------------------------------------------
3ctyB           ----------------------------------------------------------------------
3cnsA           ----------------------------------------------------------------------
3bi8A           ETIKFVIDKVNKRIPVIAGT-------GSNNTAASIAMSKWAESIG-VDGLLVITPYYNKTT--------
2c72A           ----------------------------------------------------------------------
2a7rC           EFVKDVRKRFPQHTIMAGNVVT-------------GEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGY
2du8A           ----------------------------------------------------------------------
1b9bA           EGFYGLDKEEAKRVVIAYEPVWA------IGTGRVATPQQAQEVHAFIRK--------------------
2a87A           ----------------------------------------------------------------------
3eb2B           AVVRATIEAAQRRVPVVAGV-------ASTSVADAVAQAKLYEKLGA------------DGILAILEAYF
1d7yA           ----------------------------------------------------------------------
3d1cA           ----------------------------------------------------------------------
1cjcA           ----------------------------------------------------------------------
2ehhC           KVIEFAVKRAAGRIKVIAGTG-------GNATHEAVHLTAHAKEVG-ADGALVVVPYYNKTQRGLYEHFK
3bh1C           ----------------------------------------------------------------------
2bmuB           ----------------------------------------------------------------------
3c4aA           ----------------------------------------------------------------------
2dp3A           ALGKELGESKMLWKEVVIAYEPVWSIGTGVVAT----PEQAEEVHVGL----------------------
2bznB           EFVKDVRKRFPQHTIMAGNVVTGEMVEELILS--GADIIKVGIGPG----------SVCTTRKKTGVGYP
2dzxB           GILVVDLPVFHAKEFTEIARAAGIKTVFLAAPNTPDERLKVIDDMT-TGFVYLVSLYGTTEEIPKTAYD-
3cnjA           ----------------------------------------------------------------------
3cpiH           ----------------------------------------------------------------------
2amfE           ----------------------------------------------------------------------
2dkhA           ----------------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
1b37B           ----------------------------------------------------------------------
1cj2A           ----------------------------------------------------------------------
2b9wA           ----------------------------------------------------------------------
2bwgB           EFVKLVRAKFPEHTIMAGNVVT-------------GEMVEELILSG-ADIIKVGVGPGSVCTTRTKTGVG
2c6qB           -----------------------------------GEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGY
2e4gA           ----------------------------------------------------------------------
3b3rA           ----------------------------------------------------------------------
1cl0A           ----------------------------------------------------------------------
3c4nA           ----------------------------------------------------------------------
3cqjA           ETGVRVPSMCLSAHRRFPLGSRAQGLE---IMRKAIQFAQDVGIRV-IQLAGYDVYYQEANNETRRRFRD
3d4oB           ----------------------------------------------------------------------
3coxA           ----------------------------------------------------------------------
2dw6A           MRIEAVLEEIGKDAQLAVDAN------GRFNLETGIAYAKMLRDYP-LFWYEE---------------VG
2agkA           CGKDRIVVDLSCRKTQDGRWIVAMNKWQTLTDLELNADTFRELRKY-TNEFLIHAGGIDELLVS------
3cqhA           AIVETGVRVPSCLSAHRRFPLGSEDDAVRAQGLEIRKAIQFAQDVG-IRVIQLAGYDVYYQEANNETRRR
1d5tA           ----------------------------------------------------------------------
3d8xA           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
3djeB           ----------------------------------------------------------------------
2ciqA           ----------------------------------------------------------------------
3c24A           ----------------------------------------------------------------------
3cgbA           ----------------------------------------------------------------------
3dghB           ----------------------------------------------------------------------
1ec7A           ----DFKLKGGVLAGEEEAESIVALAQRFPQARITLDPNGAWSLNEAIKIGKYLKGSLAYAEDPCGAEQG
2cduB           ----------------------------------------------------------------------
2dqwB           ------------------------------PPERALERAREMVAEG-ADILDLGAESPV-----------
1eehA           ----------------------------------------------------------------------
1b8sA           ----------------------------------------------------------------------
2e4gB           ----------------------------------------------------------------------
2amfA           ----------------------------------------------------------------------
3cphH           ----------------------------------------------------------------------
1b73A           ----------------------------------------------------------------------
1c0iA           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
2c76A           ----------------------------------------------------------------------
2aqwA           YVLIKTTNKDSFIFQNELSINDKQAYIVADETQKATEL--------------KIEQNNEFIGFVVGSNAF
2bmuA           ----------------------------------------------------------------------
1e0dA           ----------------------------------------------------------------------
3eanC           ----------------------------------------------------------------------
2eggB           ----------------------------------------------------------------------
2du2A           SPRDIEEIAGHSGLPVFV------------KGIQHPEDADMAIKRG-ASGIWVSNHGARQLYEAPGSFDT
2d4aA           ----------------------------------------------------------------------
2c75B           ----------------------------------------------------------------------
3eanD           ----------------------------------------------------------------------
3eanA           ----------------------------------------------------------------------
3ctyA           ----------------------------------------------------------------------
1eepB           ELIKKIKTKYNLDLIAGNIVTKEAALDL---ISVGADCLKVGIGPGSICTTRIVAGVGVPQITAICD---
2dw7A           MRIEAVLEEIGKDAQLAVDAN------GRFNLETGIAYAKMLRDYP-LFWYEE----------------V


                         .         *         .         .         .         .         +:350
query           QPAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEIITKTAQGRVHEIRP
3ej8A           TVFPQRSDGKHDFRVWNAQLIRYAGY-QMPDGSIRGDPANVEITQLCIDLGWKPKY------GRFDVLPL
1djqA           QQGHTIPWVKLVKQVSKKPVLGVGRYTDPEKMIEIVTKGYADIIGCARPSIADPFLPQKVEQGRYDDIRV
3e7gC           TVFPQRSDGKHDFRVWNAQLIRYAGY-QMPDGSIRGDPANVEFTQLCIDLGWKPKYGRFDVVPLVLQANG
1djnA           QQGHTIPWVKLVKQVSKKPVLGVGRYTDPEKMIEIVTKGYADIIGCARPSIADPFLPQKVEQGRYDDIRV
3dwjB           ITVFPQRSDGKHDFRLWNSQLIRYAGYQMPDGTIRGDAATLEFTQLCIDLGWKPRYGRFDV------LPL
1bwkA           EGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYD
3dqtB           TVFPQRAPGRGDFRIWNSQLVRYAGY-RQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQ---
3e7sB           TVFPQRAPGRGDFRIWNSQLVRYAGYR-QQDGSVRGDPANVEITELCIQHGWTPGNGRFDV---------
3dqsA           TVFPQRAPGRGDFRIWNSQLVRYAGY-RQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQ---
1dd7A           TVFPQRSDGKHDFRLWNSQLIRYAG-YQTIRGDAATLEFTQLCIDLGWKPRYGRFDVLPLV----LQADG
3e7gA           TVFPQRSDGKHDFRVWNAQLIRYAGY-QMPDGSIRGDPANVEFTQLCIDLGWKPKYGRFDV------VPL
1dwxA           TVFPQRSDGKHDFRLWNSQLIRYAGY-QMPDGTIRGDAATLEFTQLCIDLGWKPRYGRFDVLPLVLQADG
3e68A           TVFPQRSDGKHDFRLWNSQLIRYAG-YQMPDGTIRGDAATLEFTQLCIDLGWKPRYGRFDVLPLVLQADG
3eahB           TVFPQRCPGRGDFRIWNSQLVRYAGY-RQQDGSVRGDPANVEITELCIQHGWTPGNGRF-------DVLP
3c56A           EPKLDFERLQEVKRLTNIPLVLHGASAIPDNVRKSYLDAGGDLKGSKGV---PFEFLQESVKGGINKVNT
3e65B           TVFPQRSDGKHDFRLWNSQLIRYAGYQMPD-GTIRGDAATLEFTQLCIDLGWKPRYGRFDVLPLVLQADG
1df1A           TVFPQRSDGKHDFRLWNSQLIRYAGYQMPD-GTIRGDAATLEFTQLCIDLGWKPRYGRFDVLPLVLQADG
2dv2A           VL----EPVADGFRNYLKGKYRVPAEVLLVDKAQLLTLSAPEMTVLLGGLRVLGANVGQSRHGVFTAREQ
1bwlA           EGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYD
2aeaD           YGNNMDRLIKNLRHDLNLPSLPIIQVAIASGGGYIDKSNVVCVDAKGLPLKSDNLHLTTEAQVQL-----
3e65A           TVFPQRSDGKHDFRLWNSQLIRYAG-YQMPDGTIRGDAATLEFTQLCIDLGWKPRYGRFDVLPLVLQADG
3dwjA           TVFPQRSDGKHDFRLWNSQLIRYAGY-QMPDGTIRGDAATLEFTQLCIDLGWKPRYGRFDVLPLVLQADG
3e68B           TVFPQRSDGKHDFRLWNSQLIRYAGY-QMPDGTIRGDAATLEFTQLCIDLGWKPRYGRFDVLPLVLQADG
3e7mA           TVFPQRSDGKHDFRLWNSQLIRYAGY-QMPDGTIRGDAATLEFTQLCIDLGWKPRYGRFDVLPLVLQADG
2abbA           GKPYSEAFRQKVRERFHGVIIGAGAYTAEKAEDLIGKGL-IDAVAFGRDYIANPDLVARLQKKAELNPQS
3e7sA           FPQRAP--GRGDFRIWNSQLVRYAGYR-QQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQA--
1dwxB           TVFPQRSDGKHDFRLWNSQLIRYAGYQ-MPDGTIRGDAATLEFTQLCIDLGWKPRYGRFDVLPLVLQADG
2an0A           TIFPPEEKGEKQVEIWNHQLIRYAGYEDPASRSLTAACEQLGWRGERTDFDLLPLIFRMRGDEQ------
3eahA           TVFPQRCPGRGDFRIWNSQLVRYAGY-RQQDGSVRGDPANVEITELCIQHGWTPG-------NGRFDVLP
3c52B           DF----ERLQEVKRLTNIPLVLHGASAIPDNVRKSYLDA--GGDLKGSKGVPFEFLQESVKGGINKVNTD
3drwA           IFTYNRLEDSILGGMIILDELNFEILQV-HTTYYLMYITHRDNPLSEEELAKSLEFGTTLAAARASLGIR
1b3oB           RPQATAYKVSEYARRFGVPVIADGGIQNVGHIAKALALG-ASTVMMGSLLAATTEAPGEDKGSIHKFVPY
2dv1A           ---AVLEPVADGFRNYLKGKYRVPAEVLLVDKAQLLTLSAPEMTVLLGGLRVLGANVGQSRHGVFTAREQ
2an2A           PEEKGEKQVEIWNHQIRYAGYEGEAIGDPASCSLTAACEQLGWRGERTDFDLLPLIFRMKGDEQPVWYEL
3cb3A           -AYDHEGHAA-LALQFDTPIATGEMLTSAAEHGDLIRHRAADYLMPDAPRVGGITPFLKIASAEHAGLML
3bjsA           ----FASYREVAKITPLVPIAAGENHYTRFEFGQMLDAGAVQVWQPDLSKCGGITEGIRIAAASAYRIPI
3cb3B           LDAYDHEGHAALALQFDTPIATGEMLTSAAEHGDLIRHRAADYLMPDAPRVGGITPFLKIASAEHAGLML
3dfhA           LPPNQTEWLDNIRSQSSVSLGLGELFNNPEEWKSLIANRRIDFIRCHVSQIGGITPALKLGHCQNFGVRI
2e68B           A-----NVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAG-ASMVQVGTALQEEGPGIFTRLEDELLEIMA
3bjsB           ----FASYREVAKITPLVPIAAGENHYTRFEFGQMLDAGAVQVWQPDLSKCGGITEGIRIAAASAYRIPI
3bsmA           -----QESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADASLYHVRT
1a53A           EINKENQRKLISMIPSNVVKVAESGISERNEIEELRKLG-VNAFLIGSSLMRNPEKIKE-----------
1bkhB           -RINRGGQVR-LNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQAEAAGIGL
3ddmA           ADRPAAEWA-ELAQAAPMPLAGGENIAGVAAFETALAARSLRVMQPDLAKWGGFSGCLPVARVVAAGLRY
2e66A           ----------------------------------------------------------------------
1d3hA           ERDLSTQTIREMYALTRVPIIGVGGVSSGQDALEKIRAG-ASLVQLYTATFWGPPVVGKVKRELEALLK-
2ejrA           ------------------------GVEGAAFQSRLPHDRMTSQEAACFDIISGPQQTQKVFLFIRNRTEA
3c52A           DF----ERLQEVKRLTNIPLVLHGASAIPDNVRKSYL--DAGGDLKGSKGVPFEFLQESVKGGINKVNTD
2djxA           -PTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAG-ASMVQVGTALQEEGPGIFTRLEDELLEIMA
3dipB           ----NIPAVADLRRQTRAPICGGENLAGTRRFHEMLCADAIDFVMLDLTWCGGLSEGRKIAAAETHARPL
2dw4A           ---------------ACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVL
2b4gA           LPTALANVNAFFRRCPDKLVFGCGGVYSGEEAFLHILAG-ASMVQVGTALHDEGPIIFARLNKELQEIMT
1d3gA           GGLSGKPLRDLSTQTIRVPIIGVGGVSSGQDALEKIRAG-ASLVQLYTLTFWGPPVVGKVKRE-LEALLK
1chrA           VGRENTQALRRLSDNNRVAIMADESLSTLASAFDLARDRSVDVFSLKLCNMGGVSATQKIAAAEASGIAS
3c4uA           PKLDF-ERLQEVKRLTNIPLVLHGASAIPDNVRKSYL--DAGGDLKGSKGVPFEFLQESVKGG-------
2dzwB           YGTTEEDLLRRAKRICRNKVAVGFGVSKREHVVSLLKEG-ANGVVVGSALVKIIGEKGREATEFLKKKVE
3c61A           --TALANVNAFYRRCPGKLIFGCGGVYTGEDAFLHVLAG-ASMVQVGTALHEEGPAIFERLTAELLDVMA
1b3oA           PQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALG-ASTVMMGSLLAATTEAPGEDKGSIHKFVPY
1a48A           ----------------ILPLVARGKVVDAGSAYDVIMENSIPEKGILLTKLSE-FWFKFLSNDVRNHLVD
3b5vA           -----NQAKLISMIPSNVVKVAAFGISARNEIAELRALG-VNAFSIHSSLMRNPEKIKE-----------
2djlA           LPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAG-ASMVQVGTALQEEGPGIFTRLEDELLEIMA
3dfyA           RREDIEGLK-FVRFHSPFPVAADESARTKFDVMRLVKEEAVDYVNIKLMKSGISDALAIVEIAESSGLKL
1al8A           ----MALEEVVKAAQGRIPVFLDGGVRRGTDVFKALALG-AAGVFIGRPVVFSLAAEGEAGVKKVLQM--
2e68A           -PTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAG-ASMVQVGTALQEEGPGIFTRLEDELLEIMA
2dzsB           YGTTEEDLLRRAKRICRNKVAVGFGVSKREHVVSLLKEG-ANGVVVGSALVKIIGEKGREATEFLKKK--
3dg6A           PADDVLSRRR-LVGQLDMPFIADESVPTPADVTREVLGGSATAISIKTARTGFTGSTRVHHLAEGLGLDM
2c3zA           EINKENQRKLISMIPSNVVKVAESGISERNEIEELRKLG-VNAFLIGSSLMRNPEKIKE-----------
3c56B           KS-----------YLDAGGDLKGSKGVPFEFLQESVKGGINKVNTDTDLRIAFIAEV-------------
3bpwB           EMNYIRTYFPNCYILSPGIGAQNGDLHKTLTNGYHKSY-EKILINIGRAITKNPYPQKAAQMYY------
2dzwA           ------DLLRRAKRICRNKVAVGFGVSKREHVVSLLKEG-ANGVVVGSALVKIIGEKGREATEFLKKKVE
3eezA           QPGETLDDIAAIRPLHSAPVSVDECLVTLQDAARVARDGLAEVFGIKLNRVGGLTRAARMRDALTHGIDM
3dg3A           -ADDVLSRRR-LVGQLDMPFIADESVPTPADVTREVLGGSATAISIKTARTGFTGSTRVHHLAEGLGLDM
2bahA           LAWDDLVDHAELARRIRTPLCLDESVASASDARKALALGAGGVINLKVARVGGHAESRRVHDAQSFGAPV
1bkhC           -RINR-GGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQAEAAGIGL
2b4gB           LPTALANVNAFFRRCPDKLVFGCGGVYSGEEAFLHILAG-ASMVQVGTALHDEGPIIFARLNKELQEIMT
2a1yA           TGGWQLAALRWCAKAASKPIIADGGIRTNGDVAKSIRFG-ATMVMIGSLFAGHEESPGETIEKLYKEYFG
3dgbA           -RNNR-AGMVRLNASSPAPIMADESIECVEDAFNLAREGAASVFALKIAKNGGPRATLRTA---------
3c3nA           NVNAFYRRCPDK------LVFGCGGVYSGEDAFLHILAG-ASMVQVGTALQEEGPGIFTRLEDELLEIMA
1dtnA           -LQHDYEGHQRIQSKLNVPVQMGENWLGPEEMFKALSIGACRLAMPDAMKIGGVTGWIRASAAQQFGIPM
2dzpA           PKTAYDLLRRAK-RICRNKVAVGFGVSKREHVVSLLKEG-ANGVVVGSALVKIIGEKGREATEFLKKK--
1b57A           TPTILRDSQEYVSKKHNLPVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWAT-----------------
3dtvD           AAPDSDDAIPEVERRLGVPVVSSSPAG-FWDAVRLAGGGAKARPGYGRL---------------------
2drvA           -----------------------------------LRKGEVDEDIIPLLKKINSIENYFTCSGRISVEPH
1bkhA           -RINRGGQVR-LNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQAEAAGIGL
2dzuA           PKTAYDLLRRAK-RICRNKVAVGFGVSKREHVVSLLKEG-ANGVVVGSALVKIIGEKGREATEFLKKK--
2dzuB           MTTGFYDLLRRAKRICRNKVAVGFGVSKREHVVSLLKEG-ANGVVVGSALVKIIGEKGREATEFLKKK--
2e09B           PKTAY-DLLRRAKRICRNKVAVGFGVSKREHVVSLLKEG-ANGVVVGSALVKIIGEKGREATEFLKKK--
1al7A           MALEEV----VKAAQGRIPVFLDGGVRRGTDVFKALALG-AAGVFIGRPVVFSLAAEGEAGVKKVLQM--
3dfyL           RREDIEGLKF-VRFHSPFPVAADESARTKFDVMRLVKEEAVDYVNIKLMKSGISDALAIVEIAESSGLKL
2dztB           IPKTAYDLLRRAKRICRNKVAVGFGVSKREHVVSLLKEG-ANGVVVGSALVKIIGEKGREATEFLKKK--
3ct2A           ISRNNRAGMVRLNASSPAPIMADESIECVEDAFNLAREGAASVFALKIAKNGGPRATLRTA---------
3cb3C           DAYDHEGHAA-LALQFDTPIATGEMLTSAAEHGDLIRHRAADYLMPDAPRVGGITPFLKIASAEHAGLML
3dfyF           RREDIEGLK-FVRFHSPFPVAADESARTKFDVMRLVKEEAVDYVNIKLMKSGISDALAIVEIAESSGLKL
1dqwA           GGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDDVVSTG-SDIIIVGRGLFAKGRDAKVEGERY------
2dztA           IPKTAYDLLRRAKRICRNKVAVGFGVSKREHVVSLLKEG-ANGVVVGSALVKIIGEKGREATEFLKKK--
3cb3D           DAYDHEGHAA-LALQFDTPIATGEMLTSAAEHGDLIRHRAADYLMPDAPRVGGITPFLKIASAEHAGLML
2ehhA           TVAQEVDIP---IIIYNIPSRTCVEISVDTMFKLASECENIVASKESTPNMDRISEIVKRLGESFSVLSG
2e09A           DMTTGFDLLRRAKRICRNKVAVGFGVSKREHVVSLLKEG-ANGVVVGSALVKIIGEKGREATEFLKKK--
2a4aB           IKAIKEYIKNNPEKNNKIGLKVSGGISDLNTASHYILLARRFLFRIGSS---------------------
2dzpB           YGTTEEDLLRRAKRICRNKVAVGFGVSKREHVVSLLKEG-ANGVVVGSALVKIIGEKGREATEFLKKK--
3dfyB           RREDIEGLK-FVRFHSPFPVAADESARTKFDVMRLVKEEAVDYVNIKLMKSGISDALAIVEIAESSGLKL
3eb2D           ---------RAIADAVEIPVVFQRSDLTLDVIARLAEHPRIRYIKDASTNTGRLLSIINRCG---DALQV
3dfyE           RREDIEGLKF-VRFHSPFPVAADESARTKFDVMRLVKEEAVDYVNIKLMKSGISDALAIVEIAESSGLKL
3derA           RREDIEGLKF-VRFHSPFPVAADESARTKFDVMRLVKEEAVDYVNIKLMKSGISDALAIVEIAESSGLKL
3dk9A           ----------------------------------------------------------------------
1dj8A           ----------------------------------------------------------------------
3dbyR           ----------------------------------------------------------------------
1dncA           VHSEFMHDHADYGFPSCEGKFNWRVIKEKRDAYQNNLTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPH
2btmA           HIRSVVSRLFGPEAAEAIRIQYGGSVKPDNIRDFLAQQQ-IDGALVGGASLEPASFLQLVEAGR------
1bg8A           ----------------------------------------------------------------------
3eb2A           -DAQIESYFRAIADAVEIPVVIYTFQRSDLTLDVIARLAEHPRIRYIKDASTNTGRLLSIINRCGDALQV
2dzxA           IPKTAYDLLRRAKRICRNKVAVGFGVSKREHVVSLLKEG-ANGVVVGSALVKIIGEKGREATEFLKKK--
3bofA           QTLPYVS----------NVPLSLDIQNVDLTERALRAYPGRSLFNSAKVDEEELEMKIN-----------
2dzvB           TPAERLDLLRRAKRICRNKVAVGFGVSKREHVVSLLKEG-ANGVVVGSALVKIIGEKGREATEFLKKK--
3d4oC           ----------------------------------------------------------------------
2bc0A           ----------------------------------------------------------------------
1a0dA           LDNLARFL--------------------------------------------------------------
1ad1B           VEEELNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLG-VDIINDQWAGLYDHRMFQVVAKYDAEIVLM
3dbyH           YIAVLEFLKKGEVPPVFHELHYHLVWLTDAAGHAGSISGGLDLVEKRLKEKSEEFTKHFEQFYLKAVEMT
2bznC           YPQLSAMECADAAHGLKGHIISDGGCSCPGDVAKAFGAG-ADFVMLGGMLAGHSESGGELIERDGKKY--
2e77C           LPAIAERVNKRV------PIVFDSGVRRGEHVAKALASG-ADVVALGRPVLFGLALGGWQGAYSVLDY--
2a0nA           --KTMLELVEKVAEQIDIPFTVGGGIHDFETASELILRG-ADKVSINTAAVENPSLITQIAQTFGSQAVV
2cyjA           --------------------------------------------------IEEVRFGLVKIDGKEFDHDI
2czgB           ----------------------------------------------------------------------
2e1mA           ----------------------------------------------------------------------
3c6eA           QDKRFVCKHSMVDRGWGCGLFGKGGIVTCAMFRCKKNME-GKVVQPENLEYTIVITPHSGEEHAGKHGKE
1amkA           --RKWVSENIGTDVAAKLRILYGGSVN-AANAATLYAKPDINGFLVGGASLKPEFRIIDATR--------
2dwcB           ----------------------------------------------------------------------
1ak5A           IDVVAERNKYFEETGIYIPVCSDGGIVYDYHMTLALAMG-ADFIMLGRYFARFEESPTRKV---------
1bhyA           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
2dwcA           ----------------------------------------------------------------------
2cfyA           ----------------------------------------------------------------------
2czgA           ----------------------------------------------------------------------
2dzvA           IPKTAYDLLRRAKRICRNKVAVGFGVSKREHVVSLLKEG-ANGVVVGSALVKIIGEKGREATEFLKKK--
2c6qA           ----AVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAG-ADFVMLGGMLAGHSESGGELIERDGKKYKL
2bznD           YPQSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAG-ADFVMLGGMLAGHSESGGELIERDGKKY--
1cc4A           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
2a4aA           IKAIKEYIKNNPEKNNKIGLKVSGGISDLNTASHYILLA-RRFLSDNFRIGSSSLVI-------------
2culA           ----------------------------------------------------------------------
1dbtA           IYQAVSPSFLTVTPGIRMSEDAANDQVRVATPAIAREKG-SSAIVVGRSITKAEDPVKAYKAVR------
2bznA           YPQLAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAG-ADFVMLGGMLAGHSESGGELIERDGKKY--
2bxrA           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
1cc6A           ----------------------------------------------------------------------
1btmA           IRSVVSRLFG-PEAAEAIRIQYGGSVKPDNIRDFLAQQQ-IDGPLVGGASLEPASFLQLVEAGR------
3b8iE           -----FAHLEAIAEHLHIPLMVTYGNPQLRDDARLARLGVVNGHAAYFAAIKATYDCLREERGAVASDLT
1ad4A           -EEELNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLG-VDIINDQWAGLYDHRMF-------------
1d7lA           ----------------------------------------------------------------------
3cpiG           ----------------------------------------------------------------------
1dbtB           ------PSFLTVTPGIRMSEDAANDQVRVATPAIAREKG-SSAIVVGRSITKAEDPVKAYKAVR------
1b37A           ----------------------------------------------------------------------
2bxsA           ----------------------------------------------------------------------
3b8iA           ------AHLEAIAEHLHIPLMVTYGNPQLRDDARLARLGVVNGHAAYFAAIKATYDCLREERGAVASDLT
2a87B           ----------------------------------------------------------------------
1ec7C           S---GREVMAEFRRATGLPTATNMIATDWRQMGHTLSLQSVDIPLADPHFWTMQGSVRVAQMCHEFGLTW
2cffA           LQEHDFSLTKKIAIEAEVKVLAAGGISSENSLKTAQKVH-TETNGLLKGVIVGRAF--------------
2e77A           LPAIA------ERVNKRVPIVFDSGVRRGEHVAKALASG-ADVVALGRPVLFGLALGGWQGAYSVLDY--
2bwgD           YPQLSAVIEADSAHGLKGHIISDGGCTCPGDVAKAFGAG-ADFVMLGGMFSGHTECAGEVIRKLKLFY--
2dzsA           IPKTAYDLLRRAKRICRNKVAVGFGVSKREHVVSLLKEG-ANGVVVGSALVKIIGEKGREATEFLKKK--
3dl2B           ----------------------------------------------------------------------
3cpjG           ----------------------------------------------------------------------
3cnpA           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
1aogB           ----------------------------------------------------------------------
3d4oA           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3cnsB           ----------------------------------------------------------------------
2bc1A           ----------------------------------------------------------------------
2dkiA           ----------------------------------------------------------------------
2bs2A           --------------------------------------------GDIIAYVAKGTLIATGGYGRIYKNTT
3bi2A           ----------------------------------------------------------------------
2brxA           ----------------------------------------------------------------------
3ctyB           ----------------------------------------------------------------------
3cnsA           ----------------------------------------------------------------------
3bi8A           -QKGLVKHFKAVSDAVSTPIIRTGLNITPGTLKELCEDKNIVAVKEASGNISQIAQIKALCGDKLD----
2c72A           ----------------------------------------------------------------------
2a7rC           PQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAG-ADFVMLGGMLAGHSESGGELIERDGKKYKL
2du8A           ----------------------------------------------------------------------
1b9bA           ----LLSEMYDEETAGSIRILYGGSIKPDNFLGLIVQKD-IDGGLVGGASLKESFI--------------
2a87A           ----------------------------------------------------------------------
3eb2B           PLKDAQIESRAIADAVEIPVVFQRSDLTLDVIARLAEHPRIRYIKDASTNTGRLSIINRCGDALQVFSAS
1d7yA           ----------------------------------------------------------------------
3d1cA           ----------------------------------------------------------------------
1cjcA           ----------------------------------------------------------------------
2ehhC           TVAQEVDIP---IIIYNIPSRTCVEISVDTMFKLASECENIVASKESTPNMDRISEIVKRLGESFSVLSG
3bh1C           ----------------------YIEMQSQHIRERREALGGKLYLEMGGKLF---------DDMHASRVLP
2bmuB           ----------------------------------------------------------------------
3c4aA           ----------------------------------------------------------------------
2dp3A           --RKWFVEKVAAEGAQHIRIIYGGSANGSNCEKLGQCPN-IDGFLVGGASL-KPEFMTMIDI--------
2bznB           QLSAVMECAD-AAHGLKGHIISDGGCSCPGDVAKAFGAG-ADFVMLGGMLAGHSESGGELIERDGKKY--
2dzxB           -------LLRRAKRICRNKVAVGFGVSKREHVVSLLKEG-ANGVVVGSALVKIIGEKGREA---------
3cnjA           ----------------------------------------------------------------------
3cpiH           ----------------------------------------------------------------------
2amfE           ----------------------------------------------------------------------
2dkhA           ----------------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
1b37B           ----------------------------------------------------------------------
1cj2A           ----------------------------------------------------------------------
2b9wA           ----------------------------------------------------------------------
2bwgB           YPQLSAVICADSAHGLKGHIISDGGCTCPGDVAKAFGAG-ADFVMLGGMFSGHTECAGEVIRKLKLFY--
2c6qB           PQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAG-ADFVMLGGMLAGHSESGGELIERDGKKYKL
2e4gA           ----------------------------------------------------------------------
3b3rA           ----------------------------------------------------------------------
1cl0A           ----------------------------------------------------------------------
3c4nA           ----------------------------------------------------------------------
3cqjA           GLKESVEMASRAQVTLAMEIMDYPLMNSISKALGYAHYLNNPWFQLLSAWDNDVQMELQAGIGHIVAVHV
3d4oB           ----------------------------------------------------------------------
3coxA           ----------------------------------------------------------------------
2dw6A           DPLDYALQ-AALAEFYPGPMATGENLFSHQDARNLLRYGGRDWLQFDCALSYGLCEYQRTLELKTHGWSP
2agkA           ------KLFEWTKDYDDLKIVYAGGAKSVDDLKLVDELSHKVDLTFGSSLDIFGGNLVKFEDCC------
3cqhA           FRDGLKE---------------------------------------------------------------
1d5tA           ----------------------------------------------------------------------
3d8xA           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
3djeB           ----------------------------------------------------------------------
2ciqA           --------------------------------------------------IKETDKEVVLTHPADETTSV
3c24A           ----------------------------------------------------------------------
3cgbA           ----------------------------------------------------------------------
3dghB           ----------------------------------------------------------------------
1ec7A           --FSGREVMAEFRRATGLPTATNMIATDWRQMGHTLSLQSVDIPLADPHFWTMQGSVRVAQMCHEFGLTW
2cduB           ----------------------------------------------------------------------
2dqwB           -EEEKRRLLPVLEAVLSLGVPVSVDTRKPEVAEEALKLG-AHLLNDVTGLRDERMVALAARHG-------
1eehA           ----------------------------------------------------------------------
1b8sA           ----------------------------------------------------------------------
2e4gB           ----------------------------------------------------------------------
2amfA           ----------------------------------------------------------------------
3cphH           ----------------------------------------------------------------------
1b73A           ----------------------------------------------------------------------
1c0iA           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
2c76A           ----------------------------------------------------------------------
2aqwA           EEKIIRNKFPDSYILSPGIGAQNGDLYKTLKNGYNKDYE-KLLINVGRAITPDPKKSSESYYNQIIQIF-
2bmuA           ----------------------------------------------------------------------
1e0dA           ----------------------------------------------------------------------
3eanC           ----------------------------------------------------------------------
2eggB           ----------------------------------------------------------------------
2du2A           LPAIAE------RVNKRVPIVFDSGVRRGEHVAKALASG-ADVVALGRPVLFGLALGG------------
2d4aA           ----------------------------------------------------------------------
2c75B           ----------------------------------------------------------------------
3eanD           ----------------------------------------------------------------------
3eanA           ----------------------------------------------------------------------
3ctyA           ----------------------------------------------------------------------
1eepB           --------VYEACNNTNICIIADGGIRFSGDVVKAIAAG-ADSVMIGNLFAGTKESPSEEIIYNGKKFKS
2dw7A           GDPLDYALQAALAEFYPGPMATGENLFSHQDARNLLRRPDRDWLQFDCALSYGLCEYQRTLEVKTHGWSP


                         .         .         .         .         *         .         .:420
query           CIGCNECIHRRLVDKLPFACAINPYASRELDGPLPPARTPRRVLVVGGGPAGMELAGLLAERGHEVTLWE
3ej8A           VLQANGRDPELFEIPPDLVLEVAMFRELELKWYALPAVANMLLEVGGLEFGWYMGTEIGVRDFCDVQRYN
1djqA           CIGCNVCISRWEIGGPPMICTQRRGWHPEKFRQTKNKDSVLIVGAGPSGSEAARVLMESGYTVHLTDTAE
3e7gC           ------RDPELFEIPPDLVLEVAMFRELELKWYALPAVANMLLEVGGEFPGWYMGTEIGVRDFCDVQRYN
1djnA           CIGCNVCISRWEIGGPPMICTQNATAGEEYRRGWHPEKFRQTKNKDSVLIVGAGPSGSEAARVLMESGYT
3dwjB           VLQADGQ--------DPEVFEIPPDLVLEV-----TMEHPKYEWFQELGLKWYALPAVANMLLEVGGLEF
1bwkA           RDTFYQMSAHGYID--------------------------------------------------------
3dqtB           ----------------------------------------------------------------------
3e7sB           ----------------------------------------------------------------------
3dqsA           ----------------------------------------------------------------------
1dd7A           QDPEVFEIPPDL--------VLEVTMELGLKWYALPAVANMLLEVGGLEFPAMNVAVLHSFQKQNVTIMD
3e7gA           VLQANGR---------------------------------------------------------------
1dwxA           Q---------------------------------------------------------------------
3e68A           ----------------------------------------------------------------------
3eahB           LL--------------------------------------------------------------------
3c56A           DTDLRIAEVRKVANEDK--SQFDLRKFFSPAQLALKNVVKERMKLLG-----------------------
3e65B           QDPEVFEIPPDLVLEVTMEHPKYEFQELGLKWYALPAVANMLLEVFPACPFNGWYMGTEVRDFCDTQRYN
1df1A           Q---------------------------------------------------------------------
2dv2A           AL--------------------------------------------------------------------
1bwlA           RDTFYQMSAHGYID--------------------------------------------------------
2aeaD           ----------------------------------------------------------------------
3e65A           ----------------------------------------------------------------------
3dwjA           ----------------------------------------------------------------------
3e68B           QDPEVFEIPPDLVLEVT-----------------------------------------------------
3e7mA           ----------------------------------------------------------------------
2abbA           FYGGGAEGYT------------------------------------------------------------
3e7sA           ----------------------------------------------------------------------
1dwxB           QDPEVFEIPPDLVLEVTM----------------------------------------------------
2an0A           ----------------------------------------------------------------------
3eahA           LL--------------------------------------------------------------------
3c52B           TDLRIAFI--------------------------------------------------------------
3drwA           GPDDYVGLKVPFKLRFEEAKSRLRMREYKVV-VIPTRLVQNPVLTVGLGDTISAGAFLTYL---------
1b3oB           LIAGIQ----------------------------------------------------------------
2dv1A           AL--------------------------------------------------------------------
2an2A           ----------------------------------------------------------------------
3cb3A           APHFAMELHVHLAAAYPREPWVEH---FEWLEPLERIEIRDGRMLVPTRP-GLGLTLSGQVKAWTREEAQ
3bjsA           NAHSSATGLNHAATIHFLAATENAGYFEACVSKFNFEIGADGCVEPPDAPLGIEV---------------
3cb3B           APHFAMELHVHLAAAYPREPWVEHFEWLE-PLFNERIEIRDGRMLVPTRP-GLGLTLSGQVKAWTREEAQ
3dfhA           AWHCPMTPIGAAVNTHLNVHLHNAAIQEHVEYNGNTHKVFPNAAEPING-----YLYASEIAGIGVEIDR
2e68B           RKGY------------------------------------------------------------------
3bjsB           NAHSSATGLNHAATIHFLAATENAGYFEACVSKFGTFEIGADGCVEPPDAPGLGIE-VDESIFEKYPAVD
3bsmA           GFHGPTD---------------------------------------------------------------
1a53A           ----------------------------------------------------------------------
1bkhB           YGGTMLEGSIGTLASAHAFLTLQLTWGTELFGPLLPPQYRDFQLHIPRTPLGLTLDEQRLARFA------
3ddmA           CPHYLGAGIGLQASAHLLAAVPGLASPGLLGVDANDN--PLRSLLSPALATLHEGRITLGGAGLGVTPDL
2e66A           ----------------------------------------------------------------------
1d3hA           EQGFG-----------------------------------------------------------------
2ejrA           TLQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKVIIIGSGVSGLAAARQLQSFGMDVTLLE
3c52A           TDLRIAFIAEVRKVANEDKSQFDLRKFFSPAQLALKNVVKERMKLLG-----------------------
2djxA           RKGY------------------------------------------------------------------
3dipB           APHTG-----------------------------------------------------------------
2dw4A           VHRVHSYLERHGLINFGIYKRIKP----------LPTKKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLE
2b4gA           NKGYK-----------------------------------------------------------------
1d3gA           EQGFG-----------------------------------------------------------------
1chrA           YGGTMDSTIGTSVALQLYSTVPSLPFGCELIGPFVPLEIRDYELQVPTGVHGMTLDEDKVRQYARV----
3c4uA           ----------------------------------------------------------------------
2dzwB           AL--------------------------------------------------------------------
3c61A           KKGY------------------------------------------------------------------
1b3oA           LIAGIQ----------------------------------------------------------------
1a48A           IAPGKTIFDYLPAKLSEYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAWKEYVKTGTVHGLKQPQGLKE
3b5vA           ----------------------------------------------------------------------
2djlA           RKGY------------------------------------------------------------------
3dfyA           MIGCMGESSLGINQSVHFALGTGAFEFHDLDSHLMLVF-RGKFIQDGPR---------------------
1al8A           ----------------------------------------------------------------------
2e68A           RKGY------------------------------------------------------------------
2dzsB           ----------------------------------------------------------------------
3dg6A           VMGNQIDGQIGTACTVSFGTAFTSRHAGELSNFLTVPLQISDGQLHRRPGPGLGIEIDPKLAHYRT----
2c3zA           ----------------------------------------------------------------------
3c56B           ----------------------------------------------------------------------
3bpwB           ----------------------------------------------------------------------
2dzwA           AL--------------------------------------------------------------------
3eezA           FVMATGGSVLADAEALHLAATIPDHACHAWACQDMLTVGGRGPRNIDG----------------------
3dg3A           VMGNQIDGQIGTACTVSFGTAFESRHAGELSNFLDPLQISDGQLHRRPGPLGIEI---------------
2bahA           WCGGML----------------------------------------------------------------
1bkhC           YGGTMLEGSIGTLASAHAFLTLQLTWGTELFGPLL-----------------------------------
2b4gB           NKGY------------------------------------------------------------------
2a1yA           SFVEHKGSLEDTLIEM------------------------------------------------------
3dgbA           ----------------------------------------------------------------------
3c3nA           RKGY------------------------------------------------------------------
1dtnA           SSHLFQEISAHLLAATPTAHWLQRLDLAGSVIEPTLTFEGGNAVIPDLPGVGIIWRE-KEIGKYLV----
2dzpA           ----------------------------------------------------------------------
1b57A           ----------------------------------------------------------------------
3dtvD           ----------------------------------------------------------------------
2drvA           VNAKWLGKWHREVSLYEVLEAIKKHR-------SGQLWFLVRSPILHVGAKTLEDAVKLVNLAVSCGFKY
1bkhA           YGGTMLEGSIGTLASAHAFLTLQLTWGTELFGPLLPPQYRDFQLHIPRTPLGLTL---------------
2dzuA           ----------------------------------------------------------------------
2dzuB           ----------------------------------------------------------------------
2e09B           ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
3dfyL           MIGCMGESSLGINQSVHFALGTGAFEFHDLDSHLMLKEEVFRGKFIQDGP--------------------
2dztB           ----------------------------------------------------------------------
3ct2A           ----------------------------------------------------------------------
3cb3C           APHFAMELHVHLAAAYPREPWVEHF---EWLEPLERIEIRDGRMLVPTRP--------------------
3dfyF           MIGCMGESSLGINQSVHFALGTGAFEFHDLDSHLMLKEEVFRGKFIQDGP--------------------
1dqwA           ----------------------------------------------------------------------
2dztA           ----------------------------------------------------------------------
3cb3D           APHFAMELHVHLAAAYPREPWVE---HFEWLEPLERIEIRDGRMLVPTRP--------------------
2ehhA           DDSLTLPMMALGAKGVISVANVMPREVKEL----IRAALEGDFRRAREIHYYLHDLFKVLFIETNPIPVK
2e09A           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2dzpB           ----------------------------------------------------------------------
3dfyB           MIGCMGESSLGINQSVHFALGTGAFEFHDLDSHLMLKEEVFRGKFIQDGP--------------------
3eb2D           FSASAAVMLIGGVGWMAGPACIAPRQSVAKAQRWDEALMVNEAFAKFNLAACIKAG--LALQGYDV----
3dfyE           MIGCMGESSLGINQSVHFALGTGAFEFHDLDSHLMLKEEVFRGKFIQDGP--------------------
3derA           MIGCMGESSLGINQSVHFALGTGAFEFHDLDSHLMLKEEVFRGKFIQDGP--------------------
3dk9A           -----------------------------------------TCVNVGCVPKKVMWNTAVHSEFMHDHADY
1dj8A           ----------------------------------------------------------------------
3dbyR           ----------------------------------------------------------------------
1dncA           ILIATGGMPSTP----HESQIPGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMI
2btmA           ----------------------------------------------------------------------
1bg8A           ----------------------------------------------------------------------
3eb2A           FSASAHIPAAVMLIGGVGWMAIAPRQSVAKAQRWDEALMVNEAFAKFNLAACIKAG--LALQGYDV----
2dzxA           ----------------------------------------------------------------------
3bofA           ----------------------------------------------------------------------
2dzvB           ----------------------------------------------------------------------
3d4oC           ------------------------------------GLTGKHVVIIGGDARQLEIIRKLSTFDAKISLVG
2bc0A           ------------------------------YDDDDKDRWGSKIVVVGANHAGTACIKTMLTNYGDANEIV
1a0dA           ----------------------------------------------------------------------
1ad1B           HNGNGNRDEPVVEEMLTSLLAQ------------------------------------------------
3dbyH           GYLRTELHHFPALKKF------------------------------------------------------
2bznC           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2a0nA           VAID------------------------------------------------------------------
2cyjA           VIYPSGRIERRMKEISKKKHGTSHKLDPE-ELEKYLVEDFDVLLVGTGIYGMLSLLPESKKLVEDKEVIE
2czgB           ------------------------MIKLRDELGTATTDSAQKILLLGSGELGKEIAIEAQRLGVEVVAVD
2e1mA           ---------------------------------LNPPGPPKRILIVGAGIAGLVAGDLLTRAGHDVTILE
3c6eA           IKPQSSITELTGYGTVTMECSPRTLDFEMVLLQMENWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVT
1amkA           ----------------------------------------------------------------------
2dwcB           ------------------------------ELGTATTDSAQKILLLGSGELGKEIAIEAQRLGVEVVAVD
1ak5A           ----------------------------------------------------------------------
1bhyA           -----------------------------------SADAEYDVVVLGGGPGGYSAAFAAADEGLKVAIVE
2dpoA           -----------------------------------------DVLIVGSGLVGRSWAMLFASGGFRVKLYD
2dwcA           ---------------------VVMIKLRD-ELGTATTDSAQKILLLGSGELGKEIAIEAQRLGVEVVAVD
2cfyA           ----------------------------------MVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAA
2czgA           ----------------------------------ATTDSAQKILLLGSGELGKEIAIEAQRLGVEVVAVD
2dzvA           ----------------------------------------------------------------------
2c6qA           FYG---MSSEMAMKKYAGGVAEYRAS-EGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKEL----
2bznD           ----------------------------------------------------------------------
1cc4A           -----------------------------------------QVAIIGAGPSGLLLGQLLHKAGIDNVILE
3cntB           ----------------------------------------KKVIIIGAGIAGLKASTLHQNGIQDCLVLE
2a4aA           ----------------------------------------------------------------------
2culA           ------------------------------------------VLIVGAGFSGAETAFWLAQKGVRVGLLT
1dbtA           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2bxrA           ------------------------------------------VVVIGGGISGLSAAKLLTEYGVSVLVLE
3cukA           -----------------------------------------RVVVIGAGVIGLSTALCIHERYHSVLQPL
1cc6A           -----------------------------------------QVAIIGAGPSGLLLGQLLHKAGIDNVILE
1btmA           ----------------------------------------------------------------------
3b8iE           ----------------------------------------------------------------------
1ad4A           ----------------------------------------------------------------------
1d7lA           -----------------------------------------QVAIIGAGPSGLLLGQLLHKAGIDNVILE
3cpiG           ------------------------------------------VIVLGTGITECILSGLLSVDGKKVLHID
1dbtB           ----------------------------------------------------------------------
1b37A           -----------------------------------------RVIVVGAGMSGISAAKRLSEAGITDLLIL
2bxsA           ------------------------------------------VVVIGGGISGLSAAKLLTEYGVSVLVLE
3b8iA           ----------------------------------------------------------------------
2a87B           ----------------------------------------RDVIVIGSGPAGYTAALYAARAQLAPLVFE
1ec7C           GSHSNNHFDISLAMFTHVAAAAKITAIDTHWIWQE-----------------------------------
2cffA           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2bwgD           ----------------------------------------------------------------------
2dzsA           ----------------------------------------------------------------------
3dl2B           -----------------------------------SSKSVNKITVVGGGELGIACTLAISAKGIADRLVL
3cpjG           ------------------------------------------VIVLGTGITECILSGLLSVDGKKVLHID
3cnpA           ----------------------------------------KKVIIIGAGIAGLKASTLHQNGIQDCLVLE
3bi4B           ----------------------------------------KKVIIIGAGIAGLKASTLHQNGIQDCLVLE
1aogB           ------------------------------------------LVVIGAGSGGLEAAWNAATLYKKRVAVI
3d4oA           --------------------------------------TGKHVVIIGGDARQLEIIRKLSTFDAKISLVG
3bi2B           ----------------------------------------KKVIIIGAGIAGLKASTLHQNGIQDCLVLE
3bi4A           ----------------------------------------KKVIIIGAGIAGLKASTLHQNGIQDCLVLE
3cnsB           ----------------------------------------KKVIIIGAGIAGLKASTLHQNGIQDCLVLE
2bc1A           ---------------------------RTLYDDDDKDRWGSKIVVVGANHAGTACIKTMLTNYGDANEIV
2dkiA           --------------------------------PAHTEAVPSQVLIVGCGPAGLTLAAQLAAFPDIRTCIV
2bs2A           NAVVCEGTG--------TAIALETGIAQLGNMEA---VQFHPTPLFPSGILLTEGCRGDGGILRDVDGHR
3bi2A           ----------------------------------------KKVIIIGAGIAGLKASTLHQNGIQDCLVLE
2brxA           ------------------------------------SEDHEVAVVVGGGKLARKYIEVAEKFNSSETFKD
3ctyB           ------------------------------------ARSGFSVAILDKAVAGGLTAEAPLVENYLGFKSI
3cnsA           ----------------------------------------KKVIIIGAGIAGLKASTLHQNGIQDCLVLE
3bi8A           ----------------------------------------------------------------------
2c72A           -----------------------------------------DVVVVGGGISGMAAAKLLHDSGLNVVVLE
2a7rC           ----------------------------------------------------------------------
2du8A           -----------------------------------------RVVVIGAGVIGLSTALCIHERYHSVLQPL
1b9bA           ----------------------------------------------------------------------
2a87A           ------------------------------------HHPVRDVIVIGSGPAGYTAALYAARAQLAPLVFE
3eb2B           AHIPAAVMLIGGVGWMAGPACIAPRQSVAKAQRWDEALMVNEAFAKFNLAACIKAG--LALQGYDV----
1d7yA           -----------------------------------------PVVVLGAGLASVSFVAELRQAGYQGLITV
3d1cA           ----------------------------------------TDVIILEKGTVGHSFKHWPKSTRTITPSFT
1cjcA           -----------------------------------------QICVVGSGPAGFYTAQHLLKHHSRAHVDI
2ehhC           DDSLTPMMALGAKGVISVANNVMPREVKE----LIRAALEGDFRRAREIHYYLHDLFKVLFIETNPIPVK
3bh1C           GFT---------PDNKIAMLDRIKDEVEILVCINAKDLERHKIRAISYEEDVLRLVDVFRDRGFLVEH--
2bmuB           ---------------------------------------HEVAVVVGGGKLARKYIEVAEKFNSSETFKD
3c4aA           -----------------------------------------KILVIGAGPAGLVFASQLKQARPLWAIDI
2dp3A           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
2dzxB           ----------------------------------------------------------------------
3cnjA           ------------------------------------------AVVIGTGYGAAVSALRLGEAGVQTLMLE
3cpiH           ------------------------------------------VIVLGTGITECILSGLLSVDGKKVLHID
2amfE           ---------------------------------------AMKIGIIGVGKMASAIIKGLKQTPHELIISG
2dkhA           --------------------------------PAHTEAVPSQVLIVGCGPAGLTLAAQLAAFPDIRTCIV
3cgvA           ------------------------------------------VLVVGGGPGGSTAARYAAKYGLKTLIEK
1b37B           -----------------------------------------RVIVVGAGMSGISAAKRLSEAGITDLLIL
1cj2A           -----------------------------------------QVAIIGAGPSGLLLGQLLHKAGIDNVILE
2b9wA           ----------------------------------------SRIAIIGAGPAGLAAGMYLEQAGHDYTILE
2bwgB           ----------------------------------------------------------------------
2c6qB           FYGMSSE---------------------------------------------------------------
2e4gA           ------------------------------------SGKIDKILIVGGGTAGWMAASYLGKALQGTADIT
3b3rA           ------------------------------------------AVVIGTGYGAAVSALRLGEAGVQTLMLE
1cl0A           --------------------------------------KHSKLLILGSGPAGYTAAVYAARANLQPVLIT
3c4nA           ------------------------------------------IVVIGAGRGAACAFYLRQLAPGRSLLLV
3cqjA           KD--------------------------------------------------------------------
3d4oB           -----------------------------------------HVVIIGGDARQLEIIRKLSTFDAKISLVG
3coxA           ------------------------------------------ALVIGSGYGGAVAALRLTQAGIPTQIVE
2dw6A           SRCIPH----------------------------------------------------------------
2agkA           ----------------------------------------------------------------------
3cqhA           ----------------------------------------------------------------------
1d5tA           ------------------------------------------VIVLGTGLTECILSGIMSVNGKKVLHMD
3d8xA           -----------------------------------------KVTIIGSGPAAHTAAIYLARAEIKPILYE
2aefB           ----------------------------------------RHVVICGWSESTLECLRELRGSEVFVLAED
3djeB           -----------------------------------------SLLIVGAGTWGTSTALHLARRGYTNVTVL
2ciqA           HILKYGATVYS--WKLKSEEQLWLSTAAKLDGSKPVRG-GIPLVFPVFGKNSTDEHLSKLPQHGLARNST
3c24A           ----------------------------------------KTVAILGAGGKGARITRKIHDSAHHLAAIE
3cgbA           ------------------------------------------YVIIGGDAAGSAAQIVRNDENANVVTLE
3dghB           ------------------------------------------LIVIGGGSAGLACAKEAVLNGARVACLD
1ec7A           GSHSNNHFDISLAMFTHVAAAA------------------------------------------------
2cduB           -----------------------------------------KVIVVGCTHAGTFAVKQTIADHPDADVTA
2dqwB           ----------------------------------------------------------------------
1eehA           --------------------------------------QGKNVVIIGLGLTGLSCVDFFLARGVTPRVMD
1b8sA           ------------------------------------------AVVIGTGYGAAVSALRLGEAGVQTLMLE
2e4gB           --------------------------------------KIDKILIVGGGTAGWMAASYLGKALQGTTLLQ
2amfA           -----------------------------------------KIGIIGVGKMASAIIKGLKQTPHELIISG
3cphH           ------------------------------------------VIVLGTGITECILSGLLSVDGKKVLHID
1b73A           -----------------------------------------KIGIFDSGVGGLTVLKAIRNRYRKVDIVY
1c0iA           --------------------------------------SQKRVVVLGSGVIGLSSALILARKGYSVHILA
2aejB           ----------------------------------------RHVVICGWSESTLECLRELRGSEVFVLAED
2c76A           -----------------------------------------DVVVVGGGISGMAAAKLLHDSGLNVVVLE
2aqwA           ----------------------------------------------------------------------
2bmuA           ---------------------------------------HEVAVVVGGGKLARKYIEVAEKFNSSETFKD
1e0dA           ----------------------------------------KNVVIIGLGLTGLSCVDFFLARGVTPRVMD
3eanC           ------------------------------DDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMV
2eggB           ----------------------------------NITLDGKRSDIIYNQNGVGMLVYQGALAFEKWTGQW
2du2A           ----------------------------------------------------------------------
2d4aA           ------------------------------------------ITILGAGKVGMATAVMLMMRGYDDLLLI
2c75B           -----------------------------------------DVVVVGGGISGMAAAKLLHDSGLNVVVLE
3eanD           ------------------------------------LDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAA
3eanA           ------------------------------------LDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAA
3ctyA           ------------------------------------ARSGFSVAILDKAVAGGLTAEAPLVENYLGFKSI
1eepB           YGMV------------------------------------------------------------------
2dw7A           SRCIPHGGHQMSLNLGLGGNESYPDLFQPYGGFPDGVRVENGHITMPDLPIGFEG---------------


                         .         .         +         .         .         .         .:490
query           REEQLGGQMRIXXXXXXXXXYHDFVTWQEGRLRRAGVTVELGRTATVDNVLSFXXXXXXXXXXXXPRRLP
3ej8A           ILEEVGRRMGLETHKLASLWKDQINIAVLHSFQKQNVTIMDHHSAAESFMK-------------------
1djqA           KIGGHLNQVAALPGLGEWSYHRDYRETQITKLLKKNKESQLAKPMTADDVLQYGADKVIIATGARWNTDG
3e7gC           ILEEVGRRM-------------------------------------------------------------
1djnA           VHLTDTAEKIGGHLNQVAALPGLGEWSYHRDYRETQITKLLKKPMTADDVLQYGADKVIIATGARWNTDG
3dwjB           PACPFNGW--YMGTEIGVRDFCDTQRYN--ILEEVGRRMGLETHTLASLWKDRAVTEINVAVLHSFQKQN
1bwkA           ----------------------------------------------------------------------
3dqtB           ----------------------------------------------------------------------
3e7sB           ----------------------------------------------------------------------
3dqsA           ----------------------------------------------------------------------
1dd7A           HHTASESFMK------------------------------------------------------------
3e7gA           ----------------------------------------------------------------------
1dwxA           ----------------------------------------------------------------------
3e68A           ----------------------------------------------------------------------
3eahB           ----------------------------------------------------------------------
3c56A           ----------------------------------------------------------------------
3e65B           ILEEVGRRMGL-----------------------------------------------------------
1df1A           ----------------------------------------------------------------------
2dv2A           ----------------------------------------------------------------------
1bwlA           ----------------------------------------------------------------------
2aeaD           ----------------------------------------------------------------------
3e65A           ----------------------------------------------------------------------
3dwjA           ----------------------------------------------------------------------
3e68B           ----------------------------------------------------------------------
3e7mA           ----------------------------------------------------------------------
2abbA           ----------------------------------------------------------------------
3e7sA           ----------------------------------------------------------------------
1dwxB           ----------------------------------------------------------------------
2an0A           ----------------------------------------------------------------------
3eahA           ----------------------------------------------------------------------
3c52B           ----------------------------------------------------------------------
3drwA           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
2dv1A           ----------------------------------------------------------------------
2an2A           ----------------------------------------------------------------------
3cb3A           V---------------------------------------------------------------------
3bjsA           ----------------------------------------------------------------------
3cb3B           VGTR------------------------------------------------------------------
3dfhA           ----------------------------------------------------------------------
2e68B           ----------------------------------------------------------------------
3bjsB           GP--------------------------------------------------------------------
3bsmA           ----------------------------------------------------------------------
1a53A           ----------------------------------------------------------------------
1bkhB           ----------------------------------------------------------------------
3ddmA           ----------------------------------------------------------------------
2e66A           ----------------------------------------------------------------------
1d3hA           ----------------------------------------------------------------------
2ejrA           ARDRVGGRVA--------TFRKGNYVADLGTGLGGNPMAVVSKQVNMELAKIKKCPLYEANGQAVPKEKD
3c52A           ----------------------------------------------------------------------
2djxA           ----------------------------------------------------------------------
3dipB           ----------------------------------------------------------------------
2dw4A           ARDRVGGRVA------------------------------------------------------------
2b4gA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
1chrA           ----------------------------------------------------------------------
3c4uA           ----------------------------------------------------------------------
2dzwB           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
1a48A           SQEFPEPIFT------------------------------------------------------------
3b5vA           ----------------------------------------------------------------------
2djlA           ----------------------------------------------------------------------
3dfyA           ----------------------------------------------------------------------
1al8A           ----------------------------------------------------------------------
2e68A           ----------------------------------------------------------------------
2dzsB           ----------------------------------------------------------------------
3dg6A           ----------------------------------------------------------------------
2c3zA           ----------------------------------------------------------------------
3c56B           ----------------------------------------------------------------------
3bpwB           ----------------------------------------------------------------------
2dzwA           ----------------------------------------------------------------------
3eezA           ----------------------------------------------------------------------
3dg3A           ----------------------------------------------------------------------
2bahA           ----------------------------------------------------------------------
1bkhC           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
3dgbA           ----------------------------------------------------------------------
3c3nA           ----------------------------------------------------------------------
1dtnA           ----------------------------------------------------------------------
2dzpA           ----------------------------------------------------------------------
1b57A           ----------------------------------------------------------------------
3dtvD           ----------------------------------------------------------------------
2drvA           SNIKSILIVEIRSTERD----VLLGENGEIFVGEEYLNKIVEIAND------------------------
1bkhA           ----------------------------------------------------------------------
2dzuA           ----------------------------------------------------------------------
2dzuB           ----------------------------------------------------------------------
2e09B           ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
3dfyL           ----------------------------------------------------------------------
2dztB           ----------------------------------------------------------------------
3ct2A           ----------------------------------------------------------------------
3cb3C           ----------------------------------------------------------------------
3dfyF           ----------------------------------------------------------------------
1dqwA           ----------------------------------------------------------------------
2dztA           ----------------------------------------------------------------------
3cb3D           ----------------------------------------------------------------------
2ehhA           TACWMLGMCEKEFRLPLTEMSPENENKLREVLKKYNLPL-------------------------------
2e09A           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2dzpB           ----------------------------------------------------------------------
3dfyB           ----------------------------------------------------------------------
3eb2D           ----------------------------------------------------------------------
3dfyE           ----------------------------------------------------------------------
3derA           ----------------------------------------------------------------------
3dk9A           GFPSCEGKFNWRVIKEKRDAYSRLNAIYQNNLTKSHIEIIRGHAAFTSSGKKYTAPHILIATGGMPSTPH
1dj8A           ----------------------------------------------------------------------
3dbyR           ----------------------------------------------------------------------
1dncA           RHDKVLRSF-----------DSMISTNCTEELENAGVEVLKFSQVK------------------------
2btmA           ----------------------------------------------------------------------
1bg8A           ----------------------------------------------------------------------
3eb2A           ----------------------------------------------------------------------
2dzxA           ----------------------------------------------------------------------
3bofA           ----------------------------------------------------------------------
2dzvB           ----------------------------------------------------------------------
3d4oC           FDQLDDGFIG------------------------------------------------------------
2bc0A           VFDQNSNISF------------------------------------------------------------
1a0dA           ----------------------------------------------------------------------
1ad1B           ----------------------------------------------------------------------
3dbyH           ----------------------------------------------------------------------
2bznC           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2a0nA           ----------------------------------------------------------------------
2cyjA           KPTKE-----------------------------------------------------------------
2czgB           ----------------------------------------------------------------------
2e1mA           NANRVGGRIK------------------------------------------------------------
3c6eA           FKNPHAKKQDV-----------------------------------------------------------
1amkA           ----------------------------------------------------------------------
2dwcB           RYANAPAMQ-------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1bhyA           RYKTLGGVCLN-----------------------------------------------------------
2dpoA           IEPRQITGAL------------------------------------------------------------
2dwcA           RYA-------------------------------------------------------------------
2cfyA           LLGQALQDSR------------------------------------------------------------
2czgA           RYANAPAMQ-------------------------------------------------------------
2dzvA           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
1cc4A           RQTPDYVLGRI-----------------------------------------------------------
3cntB           ARDRVGGRLQ------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2culA           QSLDAVMM--------------------------------------------------------------
1dbtA           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2bxrA           ARDRVGGRTY------------------------------------------------------------
3cukA           DIKVYADRFT------------------------------------------------------------
1cc6A           RQTPDYVLGRI-----------------------------------------------------------
1btmA           ----------------------------------------------------------------------
3b8iE           ----------------------------------------------------------------------
1ad4A           ----------------------------------------------------------------------
1d7lA           RQTPDYVLGR------------------------------------------------------------
3cpiG           KQDHYGGEA-------------------------------------------------------------
1dbtB           ----------------------------------------------------------------------
1b37A           EAT-------------------------------------------------------------------
2bxsA           ARDRVGGRTY------------------------------------------------------------
3b8iA           ----------------------------------------------------------------------
2a87B           GTSFGGALMTTYPGFRNGITGPELMDEMREQALRFGADLRMEDSVVTADGQTHRARAVILAMGAAARYLQ
1ec7C           ----------------------------------------------------------------------
2cffA           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2bwgD           ----------------------------------------------------------------------
2dzsA           ----------------------------------------------------------------------
3dl2B           LDLSEGTKGA------------------------------------------------------------
3cpjG           KQDHYGGEA-------------------------------------------------------------
3cnpA           ARDRVGGRLQ------------------------------------------------------------
3bi4B           ARDRVGGRLQ------------------------------------------------------------
1aogB           DVQMVHGPPFF-----------------------------------------------------------
3d4oA           FDQLDFIGV-------------------------------------------------------------
3bi2B           ARDRVGGRLQ------------------------------------------------------------
3bi4A           ARDRVGGRLQ------------------------------------------------------------
3cnsB           ARDRVGGRLQ------------------------------------------------------------
2bc1A           VFDQNSNIS-------------------------------------------------------------
2dkiA           EQ--------------------------------------------------------------------
2bs2A           FMPDYEPEK-------------------------------------------------------------
3bi2A           ARDRVGGRLQ------------------------------------------------------------
2brxA           FIGIQITRA-------------------------------------------------------------
3ctyB           VGSELAKLFADHAANYAKIREGVEVRSIKKTQGGFDIETN-DDTYHAKYVI--------ITTGTTHKHLG
3cnsA           ARDRVGGRLQ------------------------------------------------------------
3bi8A           ----------------------------------------------------------------------
2c72A           ARDRVGGRT-------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2du8A           DIKVYADRFT------------------------------------------------------------
1b9bA           ----------------------------------------------------------------------
2a87A           GTSFGGALMTNYPGFRNGITGPELMDEMREQALRFGADLRMEKSVVTADGQTHRARAVILAMGAAARYLQ
3eb2B           ----------------------------------------------------------------------
1d7yA           VGDEAERPYDRPPLSKDFMAHGDAEKIRLDCKRAPEVEWLLGHTVALSDGRTLPYGTLVLATGAAPRALP
3d1cA           SNGFGPDNAISDTSPAFTFNEETYAEYLQVVANHYELNIFENTVVTNITTETYHADYIFVATGDYNFPKK
1cjcA           YEKQLVPFG-------------------------------------------------------------
2ehhC           TACWMLGMCEKEFRLPLTEMSPENENKLREVLKKYNLPL-------------------------------
3bh1C           ----------------------------------------------------------------------
2bmuB           FIGIQ-----------------------------------------------------------------
3c4aA           VEKNDEQEVL------------------------------------------------------------
2dp3A           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
2dzxB           ----------------------------------------------------------------------
3cnjA           MGQLWNQPG-------------------------------------------------------------
3cpiH           KQDHYGGEA-------------------------------------------------------------
2amfE           SSLERSKEIA------------------------------------------------------------
2dkhA           EQKEGPMELG------------------------------------------------------------
3cgvA           RPEIGSPVRC------------------------------------------------------------
1b37B           EATDHIG---------------------------------------------------------------
1cj2A           RRTPDYVLGR------------------------------------------------------------
2b9wA           RTDHVGGKCH------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
2e4gA           LLQ-------------------------------------------------------------------
3b3rA           MGQLWNQPGP------------------------------------------------------------
1cl0A           GMEKGGQLTT------------------------------------------------------------
3c4nA           EEGGLPNEE-------------------------------------------------------------
3cqjA           ----------------------------------------------------------------------
3d4oB           FDQLDGFIG-------------------------------------------------------------
3coxA           MGRSWDT---------------------------------------------------------------
2dw6A           ----------------------------------------------------------------------
2agkA           ----------------------------------------------------------------------
3cqhA           ----------------------------------------------------------------------
1d5tA           RNPYYG----------------------------------------------------------------
3d8xA           ----------------------------------------------------------------------
2aefB           ENVRKKVLRS------------------------------------------------------------
3djeB           DPYPVPSAI-------------------------------------------------------------
2ciqA           WEFLGQTKENPPTVQFGLKPEIANPELTKLWPMDYLLILT------------------------------
3c24A           IAPEGRDRL-------------------------------------------------------------
3cgbA           KGEIYSYAQ-------------------------------------------------------------
3dghB           FVKPTPTLGT------------------------------------------------------------
1ec7A           ----------------------------------------------------------------------
2cduB           YEMNDNISFL------------------------------------------------------------
2dqwB           ----------------------------------------------------------------------
1eehA           TRMTPPGLDK------------------------------------------------------------
1b8sA           MGQLWNQPGP------------------------------------------------------------
2e4gB           APDIPTLGVG------------------------------------------------------------
2amfA           S---------------------------------------------------------------------
3cphH           KQDHYGGEAA------------------------------------------------------------
1b73A           LGDTARVPYGI-----------------------------------------------------------
1c0iA           RDLPEDV---------------------------------------------------------------
2aejB           ENVRKKVLRS------------------------------------------------------------
2c76A           ARDRVGGRTY------------------------------------------------------------
2aqwA           ----------------------------------------------------------------------
2bmuA           FIGIQ-----------------------------------------------------------------
1e0dA           TRMTPPGLDK------------------------------------------------------------
3eanC           R---------------------------------------------------------------------
2eggB           PDVN------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2d4aA           A---------------------------------------------------------------------
2c75B           ARDRVGGRTY------------------------------------------------------------
3eanD           LLGQALKDSR------------------------------------------------------------
3eanA           LLGQALKDS-------------------------------------------------------------
3ctyA           VGSELAKLFADHAANYAKIREGVEVRSIKKTQGGFDIETN-DDTYHAKYVI--------ITTGTTHKHLG
1eepB           ----------------------------------------------------------------------
2dw7A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           IPGADAPFVVDGHAVLAGTAQIGERVLLTAAEDHMQPLTIAGYLADHGHHVHLVYQTPGPAPLVGKYTIX
3ej8A           ----------------------------------------------------------------------
1djqA           TNCLTHDPIPGADQVMDGKKKIGKRVVILNADTYFMAPSLAEKLATAGHEVTIVSGVHLANYMHFTLEYP
3e7gC           ----------------------------------------------------------------------
1djnA           TNCLTHDPIPGADQVMDGKKKIGKRVVILNADTYFMAPSLAEKLATAGHEVTIVSGVHLANYMHFTLEYP
3dwjB           VTIMD-----------------------------------------------------------------
1bwkA           ----------------------------------------------------------------------
3dqtB           ----------------------------------------------------------------------
3e7sB           ----------------------------------------------------------------------
3dqsA           ----------------------------------------------------------------------
1dd7A           ----------------------------------------------------------------------
3e7gA           ----------------------------------------------------------------------
1dwxA           ----------------------------------------------------------------------
3e68A           ----------------------------------------------------------------------
3eahB           ----------------------------------------------------------------------
3c56A           ----------------------------------------------------------------------
3e65B           ----------------------------------------------------------------------
1df1A           ----------------------------------------------------------------------
2dv2A           ----------------------------------------------------------------------
1bwlA           ----------------------------------------------------------------------
2aeaD           ----------------------------------------------------------------------
3e65A           ----------------------------------------------------------------------
3dwjA           ----------------------------------------------------------------------
3e68B           ----------------------------------------------------------------------
3e7mA           ----------------------------------------------------------------------
2abbA           ----------------------------------------------------------------------
3e7sA           ----------------------------------------------------------------------
1dwxB           ----------------------------------------------------------------------
2an0A           ----------------------------------------------------------------------
3eahA           ----------------------------------------------------------------------
3c52B           ----------------------------------------------------------------------
3drwA           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
2dv1A           ----------------------------------------------------------------------
2an2A           ----------------------------------------------------------------------
3cb3A           ----------------------------------------------------------------------
3bjsA           ----------------------------------------------------------------------
3cb3B           ----------------------------------------------------------------------
3dfhA           ----------------------------------------------------------------------
2e68B           ----------------------------------------------------------------------
3bjsB           ----------------------------------------------------------------------
3bsmA           ----------------------------------------------------------------------
1a53A           ----------------------------------------------------------------------
1bkhB           ----------------------------------------------------------------------
3ddmA           ----------------------------------------------------------------------
2e66A           ----------------------------------------------------------------------
1d3hA           ----------------------------------------------------------------------
2ejrA           EMVEQEFNRL------------------------------------------------------------
3c52A           ----------------------------------------------------------------------
2djxA           ----------------------------------------------------------------------
3dipB           ----------------------------------------------------------------------
2dw4A           ----------------------------------------------------------------------
2b4gA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
1chrA           ----------------------------------------------------------------------
3c4uA           ----------------------------------------------------------------------
2dzwB           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
1a48A           ----------------------------------------------------------------------
3b5vA           ----------------------------------------------------------------------
2djlA           ----------------------------------------------------------------------
3dfyA           ----------------------------------------------------------------------
1al8A           ----------------------------------------------------------------------
2e68A           ----------------------------------------------------------------------
2dzsB           ----------------------------------------------------------------------
3dg6A           ----------------------------------------------------------------------
2c3zA           ----------------------------------------------------------------------
3c56B           ----------------------------------------------------------------------
3bpwB           ----------------------------------------------------------------------
2dzwA           ----------------------------------------------------------------------
3eezA           ----------------------------------------------------------------------
3dg3A           ----------------------------------------------------------------------
2bahA           ----------------------------------------------------------------------
1bkhC           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
3dgbA           ----------------------------------------------------------------------
3c3nA           ----------------------------------------------------------------------
1dtnA           ----------------------------------------------------------------------
2dzpA           ----------------------------------------------------------------------
1b57A           ----------------------------------------------------------------------
3dtvD           ----------------------------------------------------------------------
2drvA           ----------------------------------------------------------------------
1bkhA           ----------------------------------------------------------------------
2dzuA           ----------------------------------------------------------------------
2dzuB           ----------------------------------------------------------------------
2e09B           ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
3dfyL           ----------------------------------------------------------------------
2dztB           ----------------------------------------------------------------------
3ct2A           ----------------------------------------------------------------------
3cb3C           ----------------------------------------------------------------------
3dfyF           ----------------------------------------------------------------------
1dqwA           ----------------------------------------------------------------------
2dztA           ----------------------------------------------------------------------
3cb3D           ----------------------------------------------------------------------
2ehhA           ----------------------------------------------------------------------
2e09A           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2dzpB           ----------------------------------------------------------------------
3dfyB           ----------------------------------------------------------------------
3eb2D           ----------------------------------------------------------------------
3dfyE           ----------------------------------------------------------------------
3derA           ----------------------------------------------------------------------
3dk9A           ESQIPGASLGITSDGFFQLEELPGRSVIVGAGYI--AVEMAGILSALGSKTSLMIRHDKVLRSFDSMIST
1dj8A           ----------------------------------------------------------------------
3dbyR           ----------------------------------------------------------------------
1dncA           ----------------------------------------------------------------------
2btmA           ----------------------------------------------------------------------
1bg8A           ----------------------------------------------------------------------
3eb2A           ----------------------------------------------------------------------
2dzxA           ----------------------------------------------------------------------
3bofA           ----------------------------------------------------------------------
2dzvB           ----------------------------------------------------------------------
3d4oC           ----------------------------------------------------------------------
2bc0A           ----------------------------------------------------------------------
1a0dA           ----------------------------------------------------------------------
1ad1B           ----------------------------------------------------------------------
3dbyH           ----------------------------------------------------------------------
2bznC           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2a0nA           ----------------------------------------------------------------------
2cyjA           ----------------------------------------------------------------------
2czgB           ----------------------------------------------------------------------
2e1mA           ----------------------------------------------------------------------
3c6eA           ----------------------------------------------------------------------
1amkA           ----------------------------------------------------------------------
2dwcB           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1bhyA           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
2dwcA           ----------------------------------------------------------------------
2cfyA           ----------------------------------------------------------------------
2czgA           ----------------------------------------------------------------------
2dzvA           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
1cc4A           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2culA           ----------------------------------------------------------------------
1dbtA           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2bxrA           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
1cc6A           ----------------------------------------------------------------------
1btmA           ----------------------------------------------------------------------
3b8iE           ----------------------------------------------------------------------
1ad4A           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
3cpiG           ----------------------------------------------------------------------
1dbtB           ----------------------------------------------------------------------
1b37A           ----------------------------------------------------------------------
2bxsA           ----------------------------------------------------------------------
3b8iA           ----------------------------------------------------------------------
2a87B           VPGEQELRGVSSCATCDGFFFRDQDIAVIGGGDSA--MEEATFLTRFARSVTLVHRRDEFRA--------
1ec7C           ----------------------------------------------------------------------
2cffA           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2bwgD           ----------------------------------------------------------------------
2dzsA           ----------------------------------------------------------------------
3dl2B           ----------------------------------------------------------------------
3cpjG           ----------------------------------------------------------------------
3cnpA           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
1aogB           ----------------------------------------------------------------------
3d4oA           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3cnsB           ----------------------------------------------------------------------
2bc1A           ----------------------------------------------------------------------
2dkiA           ----------------------------------------------------------------------
2bs2A           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------
2brxA           ----------------------------------------------------------------------
3ctyB           VKGESEYFGTSYCSTCDGYLFKGKRVVTIGGGNSGAIAAIS--MSEYVKNVTIIEYMPKYMCENAYVQE-
3cnsA           ----------------------------------------------------------------------
3bi8A           ----------------------------------------------------------------------
2c72A           ----------------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2du8A           ----------------------------------------------------------------------
1b9bA           ----------------------------------------------------------------------
2a87A           VPGEQELLGVSSCATCDGFFFRDQDIAVIGG--GDSAMEEATFLTRFARSVTLVHRRD------------
3eb2B           ----------------------------------------------------------------------
1d7yA           TLQGATMPVHTLRTLEDAGLRPQSRLLIVGG--GVIGLELAATARTAGVHVSLVETQPRLMSRAAPATLA
3d1cA           PFKYG----IHYSEIEDFDNFNKGQYVVIGGNES--GFDAAYQLAKNGSDIALYTSPSVRLS--------
1cjcA           ----------------------------------------------------------------------
2ehhC           ----------------------------------------------------------------------
3bh1C           ----------------------------------------------------------------------
2bmuB           ----------------------------------------------------------------------
3c4aA           ----------------------------------------------------------------------
2dp3A           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
2dzxB           ----------------------------------------------------------------------
3cnjA           ----------------------------------------------------------------------
3cpiH           ----------------------------------------------------------------------
2amfE           ----------------------------------------------------------------------
2dkhA           ----------------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
1b37B           ----------------------------------------------------------------------
1cj2A           ----------------------------------------------------------------------
2b9wA           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
3b3rA           ----------------------------------------------------------------------
1cl0A           ----------------------------------------------------------------------
3c4nA           ----------------------------------------------------------------------
3cqjA           ----------------------------------------------------------------------
3d4oB           ----------------------------------------------------------------------
3coxA           ----------------------------------------------------------------------
2dw6A           ----------------------------------------------------------------------
2agkA           ----------------------------------------------------------------------
3cqhA           ----------------------------------------------------------------------
1d5tA           ----------------------------------------------------------------------
3d8xA           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
3djeB           ----------------------------------------------------------------------
2ciqA           ----------------------------------------------------------------------
3c24A           ----------------------------------------------------------------------
3cgbA           ----------------------------------------------------------------------
3dghB           ----------------------------------------------------------------------
1ec7A           ----------------------------------------------------------------------
2cduB           ----------------------------------------------------------------------
2dqwB           ----------------------------------------------------------------------
1eehA           ----------------------------------------------------------------------
1b8sA           ----------------------------------------------------------------------
2e4gB           ----------------------------------------------------------------------
2amfA           ----------------------------------------------------------------------
3cphH           ----------------------------------------------------------------------
1b73A           ----------------------------------------------------------------------
1c0iA           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
2c76A           ----------------------------------------------------------------------
2aqwA           ----------------------------------------------------------------------
2bmuA           ----------------------------------------------------------------------
1e0dA           ----------------------------------------------------------------------
3eanC           ----------------------------------------------------------------------
2eggB           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2d4aA           ----------------------------------------------------------------------
2c75B           ----------------------------------------------------------------------
3eanD           ----------------------------------------------------------------------
3eanA           ----------------------------------------------------------------------
3ctyA           VKGESEYFGKGTS---------------------------------------------------------
1eepB           ----------------------------------------------------------------------
2dw7A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           XXXXXXXXXXXXXXXMQRVVQIEEGRVATRNIYSDIPGEITGFDSVVVAAGGVPDDSLYHELKRHGKANV
3ej8A           ----------------------------------------------------------------------
1djqA           NMMRRLHELHVEELGDHFCSRIGRMEIYNIWGDGSKRTYRGPFDSLVLVTGRHSECTLWNEWAENDIKGI
3e7gC           ----------------------------------------------------------------------
1djnA           NMMRRLHELHVEELGDHFCSRIEPGRMEIYNIWGDTSHRWIEFDSLVLVTGRHSECTLWNEWAENDIKGI
3dwjB           ----------------------------------------------------------------------
1bwkA           ----------------------------------------------------------------------
3dqtB           ----------------------------------------------------------------------
3e7sB           ----------------------------------------------------------------------
3dqsA           ----------------------------------------------------------------------
1dd7A           ----------------------------------------------------------------------
3e7gA           ----------------------------------------------------------------------
1dwxA           ----------------------------------------------------------------------
3e68A           ----------------------------------------------------------------------
3eahB           ----------------------------------------------------------------------
3c56A           ----------------------------------------------------------------------
3e65B           ----------------------------------------------------------------------
1df1A           ----------------------------------------------------------------------
2dv2A           ----------------------------------------------------------------------
1bwlA           ----------------------------------------------------------------------
2aeaD           ----------------------------------------------------------------------
3e65A           ----------------------------------------------------------------------
3dwjA           ----------------------------------------------------------------------
3e68B           ----------------------------------------------------------------------
3e7mA           ----------------------------------------------------------------------
2abbA           ----------------------------------------------------------------------
3e7sA           ----------------------------------------------------------------------
1dwxB           ----------------------------------------------------------------------
2an0A           ----------------------------------------------------------------------
3eahA           ----------------------------------------------------------------------
3c52B           ----------------------------------------------------------------------
3drwA           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
2dv1A           ----------------------------------------------------------------------
2an2A           ----------------------------------------------------------------------
3cb3A           ----------------------------------------------------------------------
3bjsA           ----------------------------------------------------------------------
3cb3B           ----------------------------------------------------------------------
3dfhA           ----------------------------------------------------------------------
2e68B           ----------------------------------------------------------------------
3bjsB           ----------------------------------------------------------------------
3bsmA           ----------------------------------------------------------------------
1a53A           ----------------------------------------------------------------------
1bkhB           ----------------------------------------------------------------------
3ddmA           ----------------------------------------------------------------------
2e66A           ----------------------------------------------------------------------
1d3hA           ----------------------------------------------------------------------
2ejrA           ----------------------------------------------------------------------
3c52A           ----------------------------------------------------------------------
2djxA           ----------------------------------------------------------------------
3dipB           ----------------------------------------------------------------------
2dw4A           ----------------------------------------------------------------------
2b4gA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
1chrA           ----------------------------------------------------------------------
3c4uA           ----------------------------------------------------------------------
2dzwB           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
1a48A           ----------------------------------------------------------------------
3b5vA           ----------------------------------------------------------------------
2djlA           ----------------------------------------------------------------------
3dfyA           ----------------------------------------------------------------------
1al8A           ----------------------------------------------------------------------
2e68A           ----------------------------------------------------------------------
2dzsB           ----------------------------------------------------------------------
3dg6A           ----------------------------------------------------------------------
2c3zA           ----------------------------------------------------------------------
3c56B           ----------------------------------------------------------------------
3bpwB           ----------------------------------------------------------------------
2dzwA           ----------------------------------------------------------------------
3eezA           ----------------------------------------------------------------------
3dg3A           ----------------------------------------------------------------------
2bahA           ----------------------------------------------------------------------
1bkhC           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
3dgbA           ----------------------------------------------------------------------
3c3nA           ----------------------------------------------------------------------
1dtnA           ----------------------------------------------------------------------
2dzpA           ----------------------------------------------------------------------
1b57A           ----------------------------------------------------------------------
3dtvD           ----------------------------------------------------------------------
2drvA           ----------------------------------------------------------------------
1bkhA           ----------------------------------------------------------------------
2dzuA           ----------------------------------------------------------------------
2dzuB           ----------------------------------------------------------------------
2e09B           ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
3dfyL           ----------------------------------------------------------------------
2dztB           ----------------------------------------------------------------------
3ct2A           ----------------------------------------------------------------------
3cb3C           ----------------------------------------------------------------------
3dfyF           ----------------------------------------------------------------------
1dqwA           ----------------------------------------------------------------------
2dztA           ----------------------------------------------------------------------
3cb3D           ----------------------------------------------------------------------
2ehhA           ----------------------------------------------------------------------
2e09A           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2dzpB           ----------------------------------------------------------------------
3dfyB           ----------------------------------------------------------------------
3eb2D           ----------------------------------------------------------------------
3dfyE           ----------------------------------------------------------------------
3derA           ----------------------------------------------------------------------
3dk9A           NCTEELENAGVEVLKFSQVKEVKVSMVTAVPGRLPVMTMIPDVDCLLWAIGRVPNTKDVDEFQNTNVKGI
1dj8A           ----------------------------------------------------------------------
3dbyR           ----------------------------------------------------------------------
1dncA           ----------------------------------------------------------------------
2btmA           ----------------------------------------------------------------------
1bg8A           ----------------------------------------------------------------------
3eb2A           ----------------------------------------------------------------------
2dzxA           ----------------------------------------------------------------------
3bofA           ----------------------------------------------------------------------
2dzvB           ----------------------------------------------------------------------
3d4oC           ----------------------------------------------------------------------
2bc0A           ----------------------------------------------------------------------
1a0dA           ----------------------------------------------------------------------
1ad1B           ----------------------------------------------------------------------
3dbyH           ----------------------------------------------------------------------
2bznC           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2a0nA           ----------------------------------------------------------------------
2cyjA           ----------------------------------------------------------------------
2czgB           ----------------------------------------------------------------------
2e1mA           ----------------------------------------------------------------------
3c6eA           ----------------------------------------------------------------------
1amkA           ----------------------------------------------------------------------
2dwcB           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1bhyA           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
2dwcA           ----------------------------------------------------------------------
2cfyA           ----------------------------------------------------------------------
2czgA           ----------------------------------------------------------------------
2dzvA           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
1cc4A           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2culA           ----------------------------------------------------------------------
1dbtA           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2bxrA           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
1cc6A           ----------------------------------------------------------------------
1btmA           ----------------------------------------------------------------------
3b8iE           ----------------------------------------------------------------------
1ad4A           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
3cpiG           ----------------------------------------------------------------------
1dbtB           ----------------------------------------------------------------------
1b37A           ----------------------------------------------------------------------
2bxsA           ----------------------------------------------------------------------
3b8iA           ----------------------------------------------------------------------
2a87B           ----------------------------------------------------------------------
1ec7C           ----------------------------------------------------------------------
2cffA           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2bwgD           ----------------------------------------------------------------------
2dzsA           ----------------------------------------------------------------------
3dl2B           ----------------------------------------------------------------------
3cpjG           ----------------------------------------------------------------------
3cnpA           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
1aogB           ----------------------------------------------------------------------
3d4oA           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3cnsB           ----------------------------------------------------------------------
2bc1A           ----------------------------------------------------------------------
2dkiA           ----------------------------------------------------------------------
2bs2A           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------
2brxA           ----------------------------------------------------------------------
3ctyB           -IKKRNIPYIMNAQVTEIVGDGKKVTGVKYKDRTTGEEKLIETDGVFIYVGLIPQTSFVDSRQRTSVPGV
3cnsA           ----------------------------------------------------------------------
3bi8A           ----------------------------------------------------------------------
2c72A           ----------------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2du8A           ----------------------------------------------------------------------
1b9bA           ----------------------------------------------------------------------
2a87A           ----------------------------------------------------------------------
3eb2B           ----------------------------------------------------------------------
1d7yA           DFVARYHAAQGVDLRFERSVTGSVDGVVLLDDGTRIA-----ADMVVVGIGVLANDAL------------
3d1cA           ----------------------------------------------------------------------
1cjcA           ----------------------------------------------------------------------
2ehhC           ----------------------------------------------------------------------
3bh1C           ----------------------------------------------------------------------
2bmuB           ----------------------------------------------------------------------
3c4aA           ----------------------------------------------------------------------
2dp3A           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
2dzxB           ----------------------------------------------------------------------
3cnjA           ----------------------------------------------------------------------
3cpiH           ----------------------------------------------------------------------
2amfE           ----------------------------------------------------------------------
2dkhA           ----------------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
1b37B           ----------------------------------------------------------------------
1cj2A           ----------------------------------------------------------------------
2b9wA           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
3b3rA           ----------------------------------------------------------------------
1cl0A           ----------------------------------------------------------------------
3c4nA           ----------------------------------------------------------------------
3cqjA           ----------------------------------------------------------------------
3d4oB           ----------------------------------------------------------------------
3coxA           ----------------------------------------------------------------------
2dw6A           ----------------------------------------------------------------------
2agkA           ----------------------------------------------------------------------
3cqhA           ----------------------------------------------------------------------
1d5tA           ----------------------------------------------------------------------
3d8xA           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
3djeB           ----------------------------------------------------------------------
2ciqA           ----------------------------------------------------------------------
3c24A           ----------------------------------------------------------------------
3cgbA           ----------------------------------------------------------------------
3dghB           ----------------------------------------------------------------------
1ec7A           ----------------------------------------------------------------------
2cduB           ----------------------------------------------------------------------
2dqwB           ----------------------------------------------------------------------
1eehA           ----------------------------------------------------------------------
1b8sA           ----------------------------------------------------------------------
2e4gB           ----------------------------------------------------------------------
2amfA           ----------------------------------------------------------------------
3cphH           ----------------------------------------------------------------------
1b73A           ----------------------------------------------------------------------
1c0iA           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
2c76A           ----------------------------------------------------------------------
2aqwA           ----------------------------------------------------------------------
2bmuA           ----------------------------------------------------------------------
1e0dA           ----------------------------------------------------------------------
3eanC           ----------------------------------------------------------------------
2eggB           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2d4aA           ----------------------------------------------------------------------
2c75B           ----------------------------------------------------------------------
3eanD           ----------------------------------------------------------------------
3eanA           ----------------------------------------------------------------------
3ctyA           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
2dw7A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           HLLGDAYAPRRITFATQQAYALAxxx
3ej8A           --------------------------
1djqA           YLIGDAEAPRLIADATFTGHRVA---
3e7gC           --------------------------
1djnA           YLIGDAEAPRLIADATFTGHRVA---
3dwjB           --------------------------
1bwkA           --------------------------
3dqtB           --------------------------
3e7sB           --------------------------
3dqsA           --------------------------
1dd7A           --------------------------
3e7gA           --------------------------
1dwxA           --------------------------
3e68A           --------------------------
3eahB           --------------------------
3c56A           --------------------------
3e65B           --------------------------
1df1A           --------------------------
2dv2A           --------------------------
1bwlA           --------------------------
2aeaD           --------------------------
3e65A           --------------------------
3dwjA           --------------------------
3e68B           --------------------------
3e7mA           --------------------------
2abbA           --------------------------
3e7sA           --------------------------
1dwxB           --------------------------
2an0A           --------------------------
3eahA           --------------------------
3c52B           --------------------------
3drwA           --------------------------
1b3oB           --------------------------
2dv1A           --------------------------
2an2A           --------------------------
3cb3A           --------------------------
3bjsA           --------------------------
3cb3B           --------------------------
3dfhA           --------------------------
2e68B           --------------------------
3bjsB           --------------------------
3bsmA           --------------------------
1a53A           --------------------------
1bkhB           --------------------------
3ddmA           --------------------------
2e66A           --------------------------
1d3hA           --------------------------
2ejrA           --------------------------
3c52A           --------------------------
2djxA           --------------------------
3dipB           --------------------------
2dw4A           --------------------------
2b4gA           --------------------------
1d3gA           --------------------------
1chrA           --------------------------
3c4uA           --------------------------
2dzwB           --------------------------
3c61A           --------------------------
1b3oA           --------------------------
1a48A           --------------------------
3b5vA           --------------------------
2djlA           --------------------------
3dfyA           --------------------------
1al8A           --------------------------
2e68A           --------------------------
2dzsB           --------------------------
3dg6A           --------------------------
2c3zA           --------------------------
3c56B           --------------------------
3bpwB           --------------------------
2dzwA           --------------------------
3eezA           --------------------------
3dg3A           --------------------------
2bahA           --------------------------
1bkhC           --------------------------
2b4gB           --------------------------
2a1yA           --------------------------
3dgbA           --------------------------
3c3nA           --------------------------
1dtnA           --------------------------
2dzpA           --------------------------
1b57A           --------------------------
3dtvD           --------------------------
2drvA           --------------------------
1bkhA           --------------------------
2dzuA           --------------------------
2dzuB           --------------------------
2e09B           --------------------------
1al7A           --------------------------
3dfyL           --------------------------
2dztB           --------------------------
3ct2A           --------------------------
3cb3C           --------------------------
3dfyF           --------------------------
1dqwA           --------------------------
2dztA           --------------------------
3cb3D           --------------------------
2ehhA           --------------------------
2e09A           --------------------------
2a4aB           --------------------------
2dzpB           --------------------------
3dfyB           --------------------------
3eb2D           --------------------------
3dfyE           --------------------------
3derA           --------------------------
3dk9A           YAVGDVCGALLTPVAIAAGRKLA---
1dj8A           --------------------------
3dbyR           --------------------------
1dncA           --------------------------
2btmA           --------------------------
1bg8A           --------------------------
3eb2A           --------------------------
2dzxA           --------------------------
3bofA           --------------------------
2dzvB           --------------------------
3d4oC           --------------------------
2bc0A           --------------------------
1a0dA           --------------------------
1ad1B           --------------------------
3dbyH           --------------------------
2bznC           --------------------------
2e77C           --------------------------
2a0nA           --------------------------
2cyjA           --------------------------
2czgB           --------------------------
2e1mA           --------------------------
3c6eA           --------------------------
1amkA           --------------------------
2dwcB           --------------------------
1ak5A           --------------------------
1bhyA           --------------------------
2dpoA           --------------------------
2dwcA           --------------------------
2cfyA           --------------------------
2czgA           --------------------------
2dzvA           --------------------------
2c6qA           --------------------------
2bznD           --------------------------
1cc4A           --------------------------
3cntB           --------------------------
2a4aA           --------------------------
2culA           --------------------------
1dbtA           --------------------------
2bznA           --------------------------
2bxrA           --------------------------
3cukA           --------------------------
1cc6A           --------------------------
1btmA           --------------------------
3b8iE           --------------------------
1ad4A           --------------------------
1d7lA           --------------------------
3cpiG           --------------------------
1dbtB           --------------------------
1b37A           --------------------------
2bxsA           --------------------------
3b8iA           --------------------------
2a87B           --------------------------
1ec7C           --------------------------
2cffA           --------------------------
2e77A           --------------------------
2bwgD           --------------------------
2dzsA           --------------------------
3dl2B           --------------------------
3cpjG           --------------------------
3cnpA           --------------------------
3bi4B           --------------------------
1aogB           --------------------------
3d4oA           --------------------------
3bi2B           --------------------------
3bi4A           --------------------------
3cnsB           --------------------------
2bc1A           --------------------------
2dkiA           --------------------------
2bs2A           --------------------------
3bi2A           --------------------------
2brxA           --------------------------
3ctyB           YAAGDSGNFAQIASAVGDGCKAA---
3cnsA           --------------------------
3bi8A           --------------------------
2c72A           --------------------------
2a7rC           --------------------------
2du8A           --------------------------
1b9bA           --------------------------
2a87A           --------------------------
3eb2B           --------------------------
1d7yA           --------------------------
3d1cA           --------------------------
1cjcA           --------------------------
2ehhC           --------------------------
3bh1C           --------------------------
2bmuB           --------------------------
3c4aA           --------------------------
2dp3A           --------------------------
2bznB           --------------------------
2dzxB           --------------------------
3cnjA           --------------------------
3cpiH           --------------------------
2amfE           --------------------------
2dkhA           --------------------------
3cgvA           --------------------------
1b37B           --------------------------
1cj2A           --------------------------
2b9wA           --------------------------
2bwgB           --------------------------
2c6qB           --------------------------
2e4gA           --------------------------
3b3rA           --------------------------
1cl0A           --------------------------
3c4nA           --------------------------
3cqjA           --------------------------
3d4oB           --------------------------
3coxA           --------------------------
2dw6A           --------------------------
2agkA           --------------------------
3cqhA           --------------------------
1d5tA           --------------------------
3d8xA           --------------------------
2aefB           --------------------------
3djeB           --------------------------
2ciqA           --------------------------
3c24A           --------------------------
3cgbA           --------------------------
3dghB           --------------------------
1ec7A           --------------------------
2cduB           --------------------------
2dqwB           --------------------------
1eehA           --------------------------
1b8sA           --------------------------
2e4gB           --------------------------
2amfA           --------------------------
3cphH           --------------------------
1b73A           --------------------------
1c0iA           --------------------------
2aejB           --------------------------
2c76A           --------------------------
2aqwA           --------------------------
2bmuA           --------------------------
1e0dA           --------------------------
3eanC           --------------------------
2eggB           --------------------------
2du2A           --------------------------
2d4aA           --------------------------
2c75B           --------------------------
3eanD           --------------------------
3eanA           --------------------------
3ctyA           --------------------------
1eepB           --------------------------
2dw7A           --------------------------