[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ55595.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "2ausA.bssp"
#ERROR : Can't open dsspfile "2dpiA.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "3d1mB.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "3ecpA.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "2e85A.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "2bx9A.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "2an9A.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "2aunA.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"

## Summary of PDB Search
:253
    4e-17  30%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
    1e-16   8%  1aroP  [e.8.1] T7 RNA POLYMERASE
    8e-16  11%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    2e-15  13%  2ausA  [x.x.x] PSEUDOURIDINE SYNTHASE
    3e-14  13%  2dpiA  [x.x.x] DNA POLYMERASE IOTA
    4e-14  11%  2akaB  [x.x.x] DYNAMIN-1
    6e-14   5%  2axzC  [x.x.x] PRGX
    6e-14  26%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    1e-13  10%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    2e-13   7%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    3e-13   9%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-13   8%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-13  27%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    7e-13  14%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
    1e-12   8%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-12  10%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-12   9%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-12  10%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    6e-12  10%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    7e-12  12%  3cmvH  [x.x.x] PROTEIN RECA
    8e-12  15%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    8e-12   8%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    9e-12   9%  2bifA  [c.37.1 - c.60.1] PROTEIN
    9e-12   9%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-11   9%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-11  11%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    3e-11   8%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-11  10%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    4e-11   8%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-11  11%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    5e-11  11%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    6e-11  13%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
    7e-11   8%  1adoA  [c.1.10] ALDOLASE
    7e-11   8%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    7e-11   7%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    9e-11   8%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
    9e-11   9%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-10   9%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-10  11%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    1e-10  10%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE
    1e-10  10%  2b8tA  [x.x.x] THYMIDINE KINASE
    2e-10   9%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-10   9%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-10   9%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    2e-10   6%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    3e-10   8%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    4e-10  11%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
    6e-10   8%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    6e-10   9%  1aldA  [c.1.10 (2aldA)] ALDOLASE A
    7e-10  16%  2a1fF  [x.x.x] URIDYLATE KINASE
    8e-10  10%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    9e-10  10%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    9e-10  25%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-09   8%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    1e-09   3%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    1e-09  10%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-09   8%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-09  10%  3cmvG  [x.x.x] PROTEIN RECA
    2e-09   8%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-09   9%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    2e-09   8%  2c4rL  [x.x.x] RIBONUCLEASE E
    3e-09   8%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-09   8%  3cmvA  [x.x.x] PROTEIN RECA
    4e-09  16%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN
    4e-09  12%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    4e-09  13%  3cmvC  [x.x.x] PROTEIN RECA
    4e-09   4%  1e98A  [c.37.1] THYMIDYLATE KINASE
    1e-08   9%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    1e-08  10%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    1e-08   7%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    2e-08  15%  3d1mB  [x.x.x] SONIC HEDGEHOG PROTEIN
    2e-08  13%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-08  10%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    2e-08  10%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284
    3e-08   5%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    3e-08  25%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  16%  2a1fD  [x.x.x] URIDYLATE KINASE
    3e-08   5%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    5e-08  10%  2b8tB  [x.x.x] THYMIDINE KINASE
    7e-08   4%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    7e-08  16%  2a1fC  [x.x.x] URIDYLATE KINASE
    9e-08   8%  2bhvD  [x.x.x] COMB10
    1e-07  10%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
    1e-07  16%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284
    2e-07   5%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN
    2e-07   6%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-07   4%  2bx2L  [x.x.x] RIBONUCLEASE E
    3e-07  15%  2a1fE  [x.x.x] URIDYLATE KINASE
    4e-07  16%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284
    4e-07   9%  2b8tC  [x.x.x] THYMIDINE KINASE
    4e-07  13%  3ecpA  [x.x.x] TN5 TRANSPOSASE
    4e-07  11%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    5e-07  41%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-07   6%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    5e-07   3%  2cckA  [x.x.x] THYMIDYLATE KINASE
    5e-07   8%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    5e-07  29%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    6e-07   6%  3czjA  [x.x.x] BETA-GALACTOSIDASE
    6e-07  10%  2e85A  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    6e-07   8%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    7e-07   6%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    7e-07   6%  3dymA  [x.x.x] BETA-GALACTOSIDASE
    9e-07  22%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    1e-06  17%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN
    2e-06   2%  4dcgA  [x.x.x] VP39
    2e-06   5%  2b8tD  [x.x.x] THYMIDINE KINASE
    2e-06  13%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-06  17%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN
    3e-06   3%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    3e-06   4%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    3e-06  12%  1d1cA  [c.37.1 - b.34.3] MYOSIN
    3e-06   9%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
    4e-06   3%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN
    5e-06   9%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    5e-06  31%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-06  21%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-06  10%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    7e-06  11%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    7e-06   3%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-06   9%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    8e-06  10%  3bm2B  [x.x.x] PROTEIN YDJA
    8e-06   9%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-05   6%  3dyoA  [x.x.x] BETA-GALACTOSIDASE
    1e-05  13%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    1e-05   9%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-05   9%  2c7cH  [x.x.x] 60 KDA CHAPERONIN
    2e-05   5%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    2e-05   4%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    2e-05   7%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    2e-05   8%  1e0jB  [c.37.1] DNA HELICASE
    2e-05   6%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
    2e-05  16%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    2e-05   8%  2cgtH  [x.x.x] 60 KDA GROEL
    2e-05  16%  2ancD  [x.x.x] GUANYLATE KINASE
    3e-05  21%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-05  12%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    3e-05  11%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    3e-05   6%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE
    4e-05  10%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    4e-05  31%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-05   6%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    6e-05  15%  3ec1A  [x.x.x] YQEH GTPASE
    6e-05  26%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    7e-05   4%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN
    7e-05  39%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-05  20%  2d2fA  [x.x.x] SUFC PROTEIN
    7e-05   5%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    8e-05  10%  2boeX  [x.x.x] ENDOGLUCANASE E-2
    8e-05  11%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    9e-05  18%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    9e-05  12%  3c8uA  [x.x.x] FRUCTOKINASE
    9e-05   6%  3cmvE  [x.x.x] PROTEIN RECA
    1e-04  12%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-04  35%  2bx9A  [x.x.x] TRYPTOPHAN RNA-BINDING ATTENUATOR
    1e-04  18%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN
    1e-04  10%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-04  21%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-04  19%  1d8jA  [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    1e-04   6%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE
    1e-04  14%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-04  20%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE
    2e-04   8%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    2e-04  12%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    2e-04   4%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639
    2e-04  15%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-04   8%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE
    2e-04   9%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284
    2e-04  10%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-04   8%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2
    2e-04  16%  2anbA  [x.x.x] GUANYLATE KINASE
    2e-04   8%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE
    3e-04  10%  2an9A  [x.x.x] GUANYLATE KINASE
    3e-04   3%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    3e-04  16%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    3e-04   8%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280
    3e-04   7%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    4e-04   3%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    4e-04   4%  2c0bL  [x.x.x] RIBONUCLEASE E
    4e-04   5%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-04   3%  421pA  [x.x.x] H-RAS P21 PROTEIN
    5e-04  13%  2aunA  [x.x.x] HYPOTHETICAL PROTEIN
    7e-04   7%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    7e-04   4%  2cckB  [x.x.x] THYMIDYLATE KINASE
    7e-04  10%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    7e-04   8%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    7e-04   6%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    7e-04  16%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    7e-04   8%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    0.001  11%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
:253

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVSIDQSAIRGSRRSNPATYTGLLDPIRKAFAKANGVKPSLFSANSEGACPACNGAGVIYTDLAMMAGVA
3b60A           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2ausA           ----------------------------------------------------------------------
2dpiA           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
3d7wA           -------------QTTGEEYFSFITLLRDYVSSGSNNIPLLRQSTSEGQRFVLVELNAGGDTITAAIDVT
3dfnC           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2bhjA           --------------------------------------------------------GEILHD-----TLH
2b8tA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2bx9A           -------------------------------------------------CPKCERAGEIEGT--------
2aumB           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
3dt4A           EIISFGSGYGGNSLLGKKCFALRIASRLAKEEGWLAEHMLILGITGKKKYLAAAFPACGKTNLAMMNPTL
1ak2A           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TVCETCEGKRFQASVLKYTLGGRTISDVLEMSVXXXXXXXXXXXXXLPAAHAILTRLADVGLGYLSLGQP
3b60A           ----------------------------------------------------------------------
1aroP           ----------------------KNDFSDIELAAIPFNT--------LADHYGERLAREQLALEHESYEMG
2ausC           ---------------------REVIVKDDKAETNPKWGFPPDK----------RPIELHIQYGVINLDKP
2ausA           ---------------------REVIVKDDKAET--------------NPKWGFRPIELHIQYGVINLDKP
2dpiA           TEMVEKRLQQLQSDELSAVTVSGHVYNNQSINLLDVLHIRLLVGSQIAAEEAMYNQLGCAGVASKLLAKL
2akaB           --------------------------------------------------------TLVDLPGMT-KVPV
2axzC           ----------------------------------------------------------------------
1e69A           ------------------------------------------------------------------RDQK
2d0kA           ----------------------------------------------IGNENALPWNLPADLA-WFKRNTL
2dwpA           -------------------------------------------------CALAALRDVKSYLAKEGGQIA
1dhiA           ----------------------------------------------IGMENAMPWNLPASLA-WFKRNTL
3dfpC           --------------------------------------------------------------------SH
3b5jA           ------------------------------------------------LAGAHDFISELREGYNTIVGEQ
3d7wA           NLYVVAYEAGNQSYFLSDAPAGAETQDFSGTTSSSQPFNGSYPDLERYAG-----HRDQIPLGIDQLIQS
3dfnC           --------------------------------------------------------------------SH
3dmdC           ----------------------------------------------------------------------
1dhjA           -------------------------------------------------ENAMPWNLPASLAWFK-RNTL
3dauA           ----------------------------------------------IGMENAMPWNLPADLA-WFKRNTL
2drcA           ----------------------------------------------IGMENAMPFNLPADLAWFK-RNTL
3cmvH           ---------------------------------------------------ALTPKAEIEGEIGD-SHMG
2d3wB           ------------------------------------------------------------------TRSV
3dfnD           --------------------------------------------------------------------SH
2bifA           --------------------------------------------------LAALNDVRKFLSEEG-GHVA
3dfpD           --------------------------------------------------------------------SH
3dfoD           --------------------------------------------------------------------SH
2c03B           --------------------------------------------------------------------LI
3dfqA           --------------------------------------------------------------------SH
3dmdB           ----------------------------------------------------------------------
3dfnA           --------------------------------------------------------------------SH
2c03A           ------------------------------------------------------------------RDLI
5dfrA           --------------------------------------------------------LPADLA-WFKRNTL
3b55A           -------------------------------------------------------QIAKWLEAHA-KPLK
1adoA           --------------------------------------------------------------------SH
3dfqC           --------------------------------------------------------------------SH
2dwoA           ----------------------------------------------------------------------
6aldA           --------------------------------------------------------------------SH
3dfqD           --------------------------------------------------------------------SH
3dftD           --------------------------------------------------------------------SH
2c04A           ------------------------------------------------------------------RDLI
2bhjA           HKATSCLGSIMNPKSLTR--GPRDKPTPLEELLPHAIEFINQYYGSFEHLARLEAVTKEIET-TGTYQLT
2b8tA           --------------------------------------------------------GFVVIISGL-DKNF
1drbA           ----------------------------------------------IGMENAMPWNLPACLAWFK-RNTL
3dftC           --------------------------------------------------------------------SH
2ccgA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3eiuA           --------------------------------------------------------GYMYTDLAT-LYER
1draA           ----------------------------------------------IGMENAMPWNLPAELA-WFKRNTL
3dm5A           ----------------------------------------------------------------------
1aldA           --------------------------------------------------------------------QY
2a1fF           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------IGMENAMPWNLPAD-LAWFKRNTL
2c61B           ------------------------------------------------------------------LYER
2bbsA           --------------------------------------------------------------------IV
1ai4B           ----------------------------------------------------------------------
1e9cA           -------------------------------------------------KLSQGVTLVVDRYAFSGVAYT
1dyhA           ----------------------------------------------IGMENAMPWNLPAD-LAWFKRNTL
3b2qB           --------------------------------------------------MGRGYPGYMYTDLAT-LYER
3cmvG           ---------------------------------------------------------ALTPKAEI-EGLA
3bv4A           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2c4rL           -------------------------------------------------ARQHIAALGRPDFSSK-IKLY
3dfoC           --------------------------------------------------------------------SH
3cmvA           ------------------------------------------------------------------AEIG
3d1mA           -----------------------------------------------------LAYKQFIPNVAEKTLGA
3bjdB           -----------------------------------------------VATAQTRRWLARAIYADLSRALS
3cmvC           ---------------------------------------------------------ALTPKAEI-EGLA
1e98A           ------------------------------------------------------------------VAFT
2ccgB           ------------------------------------------------KVIPALKEGKVVLCDRY-IDSS
2a2zD           --------------------------------------------------------------------TE
1eilA           ------------------------------------------------LGYLGFAVKDVPAWDHF-LTKS
3d1mB           -----------------------------------------------------LTPLAYQFIPNVATLGA
3cddF           ----------------------------------------------------------------------
1e3mB           ------------------------------------------------------------------PIDR
2dr3B           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
3dtbB           --------------------------------------------------------------------VT
2b8tB           ------------------------------------------------------------------DKNF
1e9fA           ------------------------------------------------------------------VAFT
2a1fC           ----------------------------------------------------------------------
2bhvD           -------------------------------------------------FAHMGKAVLIPKGSKVIGYYS
1accA           --------------------------------------------------------------------RD
2dr3A           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2awnD           ------------------------------------------------------------------LADK
2bx2L           -------------------------------------------------------------------KLY
2a1fE           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3ecpA           ------------------------------------------------SKAAQEGAYRFIRN---PNVSA
3cddD           -----------------------------------------------------IKVIVNTDVGEPFQRI-
2awnB           ----------------------------------------------------------------------
2ccjB           ------------------------------------------------KEGKVVLCDRYIDSSLAYQGYA
2cckA           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3bk7A           ------------------------------------------------------------------LDRE
3czjA           --------------------------------------------------GDKKQLLTPLRDQFTRAPLD
2e85A           -------------------------------------------------------PLLAEKCAAA-PKGN
2d4hB           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3dymA           ------------------------------------------------------------------RAPL
2d62A           -------------------------------------------------------------------NRK
2aunB           ----------------------------------------------------TLRQLEVHGVDYHLVEAR
4dcgA           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2aumA           ------------------------------------------------VLEATLRQLEVHGVDYHLVEAR
1e9dA           ------------------------------------------------KLSQGVTLVVDRYAFSG-VAYT
1e2dA           ------------------------------------------------LSQGVTLVVDRYAFSGV--AFT
1d1cA           ----------------------------------------------------------------------
3dffA           --------------------------------------------------------LDHLRVAHRHGRFL
2akaA           ------------------------------------------------------------------RTSD
2a2zA           ------------------------------------------------KEKPVLFFERSVYSDRYIFASN
2awnC           ------------------------------------------------------------------LDRK
2bbtB           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------VQKMAISELMADVGISVDMDYGPS
2c61A           -------------------------------------------------ALTAAEYLAYEHGMHVLVILT
1e9rE           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
3dyoA           ------------------------------------------------------------------PLDN
2bkeA           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
2czvA           ------------------------------------------------VKKNVALGFSLRPLLYSNPYE-
1e0jB           ------------------------------------------------------------------AETD
3di4A           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
2cgtH           -----------------------------------------------------------LDVVEG-MQFD
2ancD           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
3cr7C           ------------------------------------------------------------------KGLY
3bb1B           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2boeX           ------------------------------------------------IRDRIASVPQGTWFAHHNPGQ-
2dr3F           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
3cmvE           ---------------------------------------------------------ALTPKAEIE-GLA
3bb1C           ----------------------------------------------------------------------
2bx9A           -PCPACSGKGVILTAQGYTLL-----DFIQKHL-------------------------------------
2aumB           ----------------------------------------------------TLRQLEVHGVDYHLVEAR
3eiuB           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1d8jA           --------------------------------------------------------GDTHPLTLDEILDE
3cr7D           ------------------------------------------------------------------KGLY
3bb1E           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3bgwD           ---------------------------------------------------SIL--TEPELIKEC-PLTP
3cbnA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2a30D           --------------------------------------------------------------------TE
2dr3D           ----------------------------------------------------------------------
3dt4A           PGWKVECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVIDEPLAPGVT
1ak2A           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1e4yA           ------------------------------------------------------------------NGFL
2an9A           ----------------------------------------------------------------------
2b8wA           ------------------------------------------------------------------RSKS
3c95A           ---------------------------------------------------------IEKLLFNYRARNF
2axpA           ------------------------------------------------------------------RVRG
2a5gA           -------------------------------------------------LHRIINDREMRDAIILIFANK
2ccjA           ----------------------------------------------------------------------
2c0bL           ------------------------------------------------------------------IKLY
1e9sD           ----------------------------------------------------------------------
421pA           ------------------------------------------------------------------PMVL
2aunA           -------------------------------------------------TLRQLEVHGVDYHLGRHVEAR
1e3mA           -------------------------------------------------IALAYIGSYVPAQKVEIGPID
2cckB           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
3a1wA           ------------------------------------------------------------------EMEK
3d3kA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LTTLSGGERQRLKLATHMGDKGGIYVLDEPTTGXXXXXXXXXXXXXDRIVDSGKSVIVIEHHQAVMAHAD
3b60A           ---LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDEL-QKNRTSLVIAHRLSTIEQAD
1aroP           EARFRKMFERQLLITTLLPKMIARINDWFEEVKAKRGKRPTAFQFLQEIKPEAVAYITIKTTLALTSADN
2ausC           PGPTSHEVVAWIKRILNLEKAGHGGTLDPKVSGVLPVALERATRVVQALLPAGKEYVALMHLHGDVPEDK
2ausA           PGPTSHEVVAWIKRILNLEKAGHGGTLDPKVSGVLPVALERATRVVQALLPAGKEYVALMHLHGDVPEDK
2dpiA           VSGVFKPNQQTVLLPESCQHHSLNHIKEIPGIGYKTAKCLEALGI-NSVRDLQTFSPKILEKELGISVAQ
2akaB           GDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAK-EVDPQGQRTIGVITKDLMDEGTD
2axzC           --EEVSSIIKPYPIVDSFGKDYDLTIQTVLKNALTISINRNLKEAQYYINQIKNISINGYYDLEINYLKQ
1e69A           LSLLSGGEKALVGLALMEIKPSPFYVLDEVDSPLDDYNAERFKRLLKENSK-HTQFIVITHNKIVMEAAD
2d0kA           NKPVIYGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAADVPEIFVIGGGRVEQFLPKAQ
2dwpA           VFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDFMKRISC
1dhiA           DKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGREQFLPKAQ
3dfpC           PALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRNPCIGG
3b5jA           GAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTVIIIAHRLSTVKNAD
3d7wA           VTALRFPGGQTKTQARSILIL--IQMISEAARF------NPILWRARQYINSGASFLPDVYMLELETSWG
3dfnC           PALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRNPCIGG
3dmdC           ---TAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFEAVKIDGIILTKLDAARGGAA
1dhjA           DKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEVIGGGRVYEQFLPKAQ
3dauA           NKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGVPEIMVIGGGRVEQFLPKAQ
2drcA           DKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGREQFLPKAQ
3cmvH           LAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKI
2d3wB           NVGFSGGEKKRNDILQMAVLEPELCILDESDSLDIDALKVVADGVNSLRDGKRSFIIVTHYRILDYIKPD
3dfnD           PALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRNPCIGG
2bifA           VFDATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIE
3dfpD           PALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIG
3dfoD           PALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIG
2c03B           LVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKGVTGLVLTKLGDARGGAA
3dfqA           PALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRNPCIGG
3dmdB           ---TAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNAVKIDGIILTKLDAARGGAA
3dfnA           PALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRNPCIGG
2c03A           LVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGLVLTKLDGDARGGAAL
5dfrA           DKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVEIMVIGGGRVYEFLPKAQ
3b55A           TTNPTASLNDLKPLKNVGSAS--IVGLGEATHGAHEVFTKHRIVKYLVSEK-GFTNLVLEEGWDRALELD
1adoA           PALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRNPCIGG
3dfqC           PALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADRVNPCIGG
2dwoA           --DATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEADDFMKRISC
6aldA           PALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRNPCIGG
3dfqD           PALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIG
3dftD           PALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIG
2c04A           LVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVVLTKLDGDARGGAAL
2bhjA           LDELIFATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYANNGNIRSAITVFQRSDGK
2b8tA           KGEPFGPIAKLFTYADKITKLTAICNECGAEAT------HSLRKIDGKHADYNDDIVKIGCQEFYSAVCR
1drbA           DKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGREQFLPKAQ
3dftC           PALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIG
2ccgA           --YQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFEKVIEGYQ
1bifA           --DATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATDFMRRIEC
3eiuA           AGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVA----RELHRKGIYPPINVLPSLSRLMN
1draA           DKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVEIMVIGGGRVYEFLPKAQ
3dm5A           -VDTAGRHKEDKALIEEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEAPIGSIIVTKLDGAKGGGA
1aldA           PALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRNPCIGG
2a1fF           ----SQPIYKRILLK-----LSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGNLFRGAKL
4dfrA           DKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGREQFLPKAQ
2c61B           AGIVKGAKGSVTQIPILSMPGDDITHPIPDLSG----YITEGQIVVARELHRKGIYPPINVLPSLSRLMN
2bbsA           LITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKAD
1ai4B           -----QSDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAAVPMPFDKWSASGYE
1e9cA           GAKENFSLDWCKQPDVGLPKPDLVLFLQLQLAD----AAKRGAFGHERYENGAFQERALRCFHQMKDTTL
1dyhA           DKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGREQFLPKAQ
3b2qB           AGIVKGAKGSVTQIPILSMPGDDITHPIPDLSG----YITEGQIVVARELHRKGIYPPINVLPSLSRLMN
3cmvG           ARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVTRVKVVKNIAAPFKQA
3bv4A           --LTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADRVNPCIGG
1e3aB           ----TQSDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAAVPMPFDKYSASGYE
2c4rL           TGEIPLFSHYQIESQIEVRLPSGGSIVIDSTEALTAIDINSARGDIEETAFNNLEAADEIARQLRLRDLG
3dfoC           PALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADRVNPCIGG
3cmvA           LAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKI
3d1mA           SGRYEGKITRNSERFKELTPNPDIIFKDEENTGADRLMTQRCKDKLNALAISGVKLRVTEGWDEDGHHSE
3bjdB           EEDFQKRLEQEIAAQSREHPSQYVFSGSASRAQLQVFLRHQWFRTFRLYRD-AADLLVNLTDVDEAAALA
3cmvC           ARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGSETRVKVVKNKIAAPFKQA
1e98A           GAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHE---RYENGAFQERALRCFHQLMKDTTL
2ccgB           LAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSLDQEDLEKVIEGYQEIHNESQ
2a2zD           WTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPKHESWLLHRTLKTNDYLQEV
1eilA           VGLMAAGSAGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDDAAALERMKLRQAGVAF-TRGDEALMQQ
3d1mB           SGRYEGKITRNSERFLTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAQWPGVKLRVTEGWDEDGHHS
3cddF           --IKAAGIKADVTDSEIGRYRPLIIVNEEVTTAEGAAKRGQWERQRSIG-KSNAEYTVTGWRIPQTGKLW
1e3mB           IFTRVGTFVETETANILHNATEYSLVLDEIGRGTYDGLSLAWACAENLANKIKALTLFATHYFETQLPEK
2dr3B           ----DIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQVLAGTGCTSIFVSQVSVERGFGG
2c9yA           --VIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRR-SDDNEKALKIRLQAYH
2bbsB           ------GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKAD
2a1fD           ----SQPIYKRILLK-----LSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGLFRGAKL
3dtbB           ITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIPAGVPLVYEALSWQHGVFVG
2b8tB           KGEPFGPIAKLFTYADKITKLTAICNECGAEAT-------HSLRKIDGKHADYNDDIVKIGCQEFYSAVC
1e9fA           GAKENFSLDWCKQPDVGLPKPDLVLFLQLQLAAFQERALRCFHQLMKDTTL-NWKMVDASKSIEAVHEDI
2a1fC           ----SQPIYKRILLK-----LSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAK
2bhvD           NNNKMGEYRLDIVWSRIITPHGINIMLTNGYNGLVGELIERNFQRYGVPLGDYLLMQLMRQSGMGIQVVN
1accA           KRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDI-----RKILSGYIVEIEDTEGLKEVIND
2dr3A           ---TDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQVLAGTGCTSIFVSQVSGVEHGVD
3bjqB           --------QARV---------VDPILSTHARGYRQSTLIGKKLFPVAPVAQYGGKILTFGKEAFRLYNTK
2awnD           IVVLDAGRVAQVGKPLELYHYPADRFVAPKMNFLPVKVTATAIDQVQVELPMPNRVWLPVESRDVQVGAN
2bx2L           TGEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSARGDIEE-TAFNTNLEAADEIAR
2a1fE           ----SQPIYKRILLK-----LSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNFRGAKL
2dr3C           ------REFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQVLAGTGCTSIFVSQVSGVEHGVD
2b8tC           -----GPIAKLFTYADKITKLTAICNECGAEATHSLRKID------GKHADYNDDIVKIGCQEFYSAVCR
3ecpA           EAIRKAGAMQTVKLAQEFPE----LLAIEDTTSLSYRHQVAEELG-KLGSIQDKSRGWWVHSVLLEATTF
3cddD           --QIEQGETPHELLARLAKQRG-VLLTSDTFGNLVITRASKTKAGVSLI--LGDNVKAARGRFSWRQRFS
2awnB           ----------------------------------------------------GRTMIYVTHDQVAMTLAD
2ccjB           RGIGVEEVRALNEFAI-------NGLYPDLTIYLNVSAEVGRERIIKNNRLDQEDLKFHEKVEGYQEIIQ
2cckA           -----AYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSEDLKFHEKVIEYQEIIR
1bglA           ---VSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAQHQGKTLFISRKTYIDGSGQ
3bk7A           LHQLSGGELQRVAIAAALLRKAHFYFFDEPSSYLDIRQRLKVARVIRRLANEGKAVLVVEHDLAVLDYLS
3czjA           NDGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAQHQGKTLFISRKTYRIDGSG
2e85A           WVVIDGGSAPENDIVIRELRPTRLLIVDATDMG-----LNPGEIRIIDPDDIAEMFMMTTHNMPLNYLID
2d4hB           --------NLPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFKTKTLSG
2b0lC           -----------------------VQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIADRVGITRSVLE
3dymA           DNDIGVSEATRIDPNAERWKAAGHYQAEAALLQCTADTLADAVLITTAHAQHQGKTLFISRKTYRIDGSG
2d62A           PRELSGGQRQRVALGRAII-RRPKVFLDEPLSNLDAKLRVKRAELKKLQRQLGVTTIYVTHDQ--VEATG
2aunB           YRYLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDLLSAFHRHG
4dcgA           ----PHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQ
2b8tD           ----------------------------------------------------NDDIVKIGCQEFYSAVCR
3bb1G           --------------------------------------------------------VLIENSGRCNKNDS
2aumA           YRYLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADI-----SVL
1e9dA           GAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGA----FQERALRCFHQMKDTTL
1e2dA           GAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAF---QERALRCFHQLMKDTTL
1d1cA           ---LLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITR--QAMDIVGFSQEEQMIFKIIA
3dffA           DSIYRKLPDGRWLTAHVEGRQKLAVNDHSPDSD---HDLVGEVADDIRSIIDEFDPTLVVTCAAIGEHPD
2akaA           YHKYLKVKQGDSDLFKLTVSDKRYIWYNPDPKE-------------------------------------
2a2zA           LYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLLEKLHYKH
2awnC           PKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLKRLGRTMIYVTHDQVAMTLAD
2bbtB           --------RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKAD
1dkiA           SGSAGSSRVQRALKENFGYNQSVHQINRGDFSKQDWEAQI-------DKELSQNQPVYYQGVGKVGGHA-
2c61A           DITNYAEALRQMGAARNEVPGRRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDL
1e9rE           -----DEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASK
3dt7A           ----KNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIPAGVPLVYEALSWQGVFVGA
3bm2B           ---AAGSDDKAIDKARNAPFRAPLIITVVAKVP-RWEQESAGCAVAQAAVAQGFGGIWRSGALTESPVVR
3dt2A           --SWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIPAGVPLVYEALSWQGVFVGA
3dyoA           DIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAQHQGKTLFISRKTYRIDGSG
2bkeA           --------------------------------------------------VYDIAVIITNQVVPGI--RI
3dt4C           ------KEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIPAGVPLVYEALSWQGVFVGA
2c7cH           ---LSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKLLIIAEDVEGEALATVVNTMR
1afrA           -----------------------ARQAKEHGDIKLAQICG------TIAADEKRHETAYTKIVELFEIDP
1e2fA           ---ENFSLDWCKQPDVGLPKPDLVLFLQLQLAD---AAKRGAFGHERYENGAFQERALRCFHQLMKDTTL
2czvA           --RANLLRFMMKAWKLVEKYKVRRFLTSSAQEK---WDVRYPRDLISLGVVIGMEIPQAKASISM--YPE
1e0jB           RLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGK
3di4A           ------HEAELVHDVLNVFCTTGQYFKASPVRPGDYLEFFAEI---DLLG-------NLSACPGGDCSSE
1cr1A           ---AETDRLLAKLAYMRSGLGCDVIILDHISI--RKMIDNLMTKLKGFAKSTGVVLVVICHSGALRQLSD
2cgtH           RGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLIIAEDVEGEALTLVVNTMR
2ancD           --------------------------------------------------------IVNDDFDTALTDLK
2d3wA           ------GEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQLDYIKPD
1e59A           ---TKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNSLRALVK
2e85B           ---IDGGSAPENDIVAIRELRPRLLIVDATDMGLNPGEIRIIDPD-----DIAEMFMMTTHNMPLNYLID
3cr7C           KKAREGVIKEFTGISAPY-EAPANPEVHVKNYE-------------------------------------
3bb1B           ----GIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLASDIPVVLIENSGRCNSDEKLP
2bbtA           ----------------------------------------------------------VTSKMEHLKKAD
3b2qA           --TNYAEALRQMGAARNEVP---GRRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPI
3ec1A           -------------------------------------------------------PPLVPRSLSVKERKT
2cbzA           ----------------------------------------------------NKTRILVTHSMSYLPQVD
2bv7A           ---KYHGWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKVRLFLVNYTATIDVIYYTRMNAELN
2awnA           --------------------------------------------------RLGRTMIYVTHDQVAMTLAD
2d2fA           -------------------------------------------------------VITHYQRILNYIQPD
2b8wB           ----YVTELTHRIRSKSSVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSKLKKGTSQKDETNLPRLC
2boeX           ---ITGQVDALMSAAQAAGKIPILVVSNAPGRDSHSAYRSWIDEFAAGLKNRPAYIIVEPDLISMSSCMQ
2dr3F           --------------------------------------------------GTGCTSIFVSQVSGFGPGVE
1cr4A           ---------LAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFAK--STGVVLVVICHGGALRQLSD
3c8uA           ------GAAEVGPECRVAIIEGNYLLFDAPGWRDLTAIWDVSIRLEDLEARLVQRWLDHGLNHDAVARAQ
3cmvE           ARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVEGENVVGSETRVKVKNKIAAPF
3bb1C           ----------------------------------------------------IPVVLIENSGRCNKNDSD
2bx9A           ----------------------------------------------------------------------
2aumB           YRYLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADISVLLS---
3eiuB           ---VKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELHRKGI----YPPINVLPSLSRLMN
2bboA           -------------------------------------------------------RILVTSKMEHLKKAD
1d8jA           TQHLDIGLKQKQWLMTEALVNNKIEVIDGKYAF-------------------------------------
3cr7D           KKAREGVIKEFTGISAPYEA-PANPEVHVKNYE-------------------------------------
3bb1E           ----------------------------------------------------DIPVVLIENSGRCNKNDS
1cr0A           -----------------------VIILDHISIRKMIDNLMTKLKGFAK--STGVVLVVICHLRALRQLSD
1dp0A           --GVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAQHQGKTLFISRTYRIDGSGQ
3bgwD           EHFSPGKHFNIYFTMQDLDRKGQSVDFTSIAAR-------------------------------------
3cbnA           ----TLDHPTDIVCRKSDYICSRTLIRADKAAFDLDENLVRDLR--------KGRELKVEIIVEYEGH--
2d3wC           ----------------------------------------------------------HYQRILDYIKPD
2a30D           WTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPKHESWLLHRTLKTNDYLQEV
2dr3D           --------------------------------------------------GTGCTSIFVSQVSVERGFGG
3dt4A           ITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIPAGVPLVYEALSWQGVFVGA
1ak2A           --------PDSLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEPLISDDNKKALKIREAYHTQTT
2anbA           --------------------------------------------------------IVNDDFDTALTDLK
1e4yA           LDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVK-FNPPKVEGKDDVTGE
2an9A           ----------------------------------------------------EYDYLIVNDDFDALTDLK
2b8wA           VSFFPDFVWTLRDFSDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFFDRPVH
3c95A           PGTLDYAEQQRWLEHRRQVFT--PEFLQGYADE-------------------------------------
2axpA           DEYIEGKDIDSILELYREVSNAGLHTYSWDTGQ-------------------------------------
2a5gA           QDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCA-------------------------------------
2ccjA           ----------------------------------------------------QEDLKFHEKVIEYQEIIH
2c0bL           TGEIPLFSHYQIESQIESAFQREVRLPSGGSIVNSARDIEETAFNTNLEAADEIARQLRLRDLGVIDFID
1e9sD           -----DEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDGFLEGTLAESLFAGSNESKALTS
421pA           VGNKCDLAARTVESRQAQDLARSYGIPYIETSA-------------------------------------
2aunA           YRYLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDISVLLSAFH
1e3mA           RIFTRVGFVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACAENLANKALTLFATHYFETQLPEK
2cckB           ------INGLYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQEIRFKSVNADQPENVVEDTY
3bb1F           ----------------------------------------------------IPVVLIENSGRCNKNDSD
2ck3C           ----APYSGCSMGEYFRDNGKHALIIYDDLSKQ-AVAYRQMSLLLRRPPGREAYPGDVFYLHSRLERAAK
3dm5B           ---------------------------------------------------------IVTKLDGAKGGGA
2dr3E           ------REFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILRVLAGTGCTSIFVSQVSVVEHGVD
3a1wA           KVILAMTAIDEAKKIDRYELQKHLGIPVVFTSS-------------------------------------
3d3kA           ---LRDQPWYKAAVAWANQNRAPVLSIDPPVHIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVG


                         .         .         .         +         .         .         .:280
query           WIIDLGPGAGHEGGRVVFEGTPAELVAARSTLTGQHLADYVGA
3b60A           EIVVV------EDGIIVERGTHSELLA-----QHGVYAQLHKM
1aroP           TTVQA------VASAIGRAIEDEAR------------------
2ausC           IRAVMKEFEGEIIQRTRKVYYIEILEIDGRDVLFRV-------
2ausA           IRAVMKEFEGEIIQRKVYY------------------------
2dpiA           RIQKLSF--GEDNSPVILSGPPQSFSEEDS-------------
2akaB           ARDVL------ENKLLPLRRGYIGVV-----------------
2axzC           IYQFLTDKIDSYLNAVNIINIFKII------------------
1e69A           LLHGV---TMVNGVSAIVPV-----------------------
2d0kA           KLYLT------HIDAEVEGDTHFPD------------------
2dwpA           YEASY--------QPLDPDKCDRD-------------------
1dhiA           KLYLT------HIDAEVEGDTHFPD------------------
3dfpC           VILFH-----ETLYQKADDGRPPQVIKSKGGVVG---------
3b5jA           RIIVM------EKGKIVEQGKHKELLSEPESL-----------
3d7wA           QQSTQ--VQHSTDGVFNNPIALAIA------------------
3dfnC           VILFH-----ETLYQKADDGRPPQVIKSKGGVVG---------
3dmdC           LSISY------VIDAPILFVGVGQGYDDRPFEKEWFLERIFG-
1dhjA           KLYLT------HIDAEVEGDTHFPDYE----------------
3dauA           KLYLT------HIDAEVEGDTHFPD------------------
2drcA           KLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSH--
3cmvH           AAPFKQAFQILYGEGINFYGELVDL------------------
2d3wB           YVHVL------YQGRIVKSGDFTLVKQLE-----EQGYGWLT-
3dfnD           VILFH-----ETLYQKADDGRPPQVIKSKGGVVG---------
2bifA           CYENSYESLDEEQDRDLSYIKI---------------------
3dfpD           GVI----LFHETLYQKADDGRPPQVIKSKGGVVG---------
3dfoD           GVI----LFHETLYQKADDGRPPQVIKSKGGVVG---------
2c03B           LSARH-----VTGKPIYFAGVSEKPEGLEPFYPERLAGRILG-
3dfqA           VILFH-----ETLYQKADDGRPPQVIKSKGGVVG---------
3dmdB           LSISY------VIDAPILFVGVGQGYDDRPFEKEWFLERIFG-
3dfnA           VILFH-----ETLYQKADDGRPPQVIKSKGGVVG---------
2c03A           SARHV------TGKPIYFAGVSEKPEGLEPFYPERLAGRILG-
5dfrA           KLYLT------HIDAEVEGDTHFPD------------------
3b55A           RYVLTGKG--------NPSQHLTPVFKTKELDLLDWIRQYNAN
1adoA           VILFH-----ETLYQKADDGRPPQVIKSKGGVVG---------
3dfqC           VILFH-----ETLYQKADDGRPPQVIKSKGGVVG---------
2dwoA           YEASYQPLDPDKCD-----------------------------
6aldA           VILFH-----ETLYQKADDGRPPQVIKSKGGVVG---------
3dfqD           GVI----LFHETLYQKADDGRPPQVIKSKGGVVG---------
3dftD           GVI----LFHETLYQKADDGRPPQVIKSKGGVVG---------
2c04A           SARHV------TGKPIYFAGVSEKPEGLEPFYPERLAGRILG-
2bhjA           HDFRLAGYQMPDGTIRGDAATLEFTQLCIDLGWKPRY------
2b8tA           HHH-------KVPNRPYLNSNSEEFIK----------------
1drbA           KLYLT------HIDAEVEGDTHFPD------------------
3dftC           GVI----LFHETLYQKADDGRPPQVIKSKGGVVG---------
2ccgA           EIIHN------ESQRFKSVNADQPL------------------
1bifA           YENSYESLDEEQ-------------------------------
3eiuA           SGIGA------GKTREDHKAVSDQ-------------------
1draA           KLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSH--
3dm5A           LSAV------AATGAPIKFIGTGEKIDDEPFDPPRFVSRLLG-
1aldA           VILFH-----ETLYQKADDGRPPQVIKSKGGVVG---------
2a1fF           AKA------GMNRVVGDHMGMLATVMN----------------
4dfrA           KLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSH--
2c61B           SGI------GAGKTREDHKAVSDQM------------------
2bbsA           KILI------LHEGSSYFYGTFSELQNLRPDFSSKLMS-----
1ai4B           TTQDG------PTGSLNISVGAKI-------------------
1e9cA           NWKMV------DASKSIEAVHEDIR------------------
1dyhA           KLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSH--
3b2qB           SGIGA------GKTREDHKAVSDQM------------------
3cmvG           EFQIL------YGEGINFYGELVDL------------------
3bv4A           VILFH-----ETLYQKADDGRPPQVIKSKGGVVG---------
1e3aB           TTQDG------PTGSLNISVGAKIL------------------
2c4rL           GLIVIDFIAVENRLREAVRQDRARI------------------
3dfoC           VILFH-----ETLYQKADDGRPPQVIKSKGGVVG---------
3cmvA           AAPF------KQAEFQILYGEGINFYG----------------
3d1mA           ESL-------HYEGRAVDITTSDRD------------------
3bjdB           RYLYG------ELGEEDEKGSHPRL------------------
3cmvC           EFQIL------YGEGINFYGELVDLGV----------------
1e98A           NWKMV------DASKRIEAVHEEIRVL----------------
2ccgB           RFKSV------NADQPL-ENVVEDTYQT---------------
2a2zD           PILTL------DVNEDF-KDKYESLVEK---------------
1eilA           RKVMG------LLCLQDPFGLPLEIYY----------------
3d1mB           EESL------HYEGRAVDITTSDRD------------------
3cddF           NINTL--VPVIDEIGLDEELIASILFSED--------------
1e3mB           EGVAN------VHLDALEHGDTIAFHSVQDGAASKAVAALAG-
2dr3B           PGVEH-----GVDGIIRLDLDEIDGELKRSLIVWKMR------
2c9yA           TQTTP------LIEYYRKRGIHSAIDASQT-------------
2bbsB           KILIL------HEGSSYFYGTFSELQN----------------
2a1fD           AKA------GMNRVVGDHMGMLATV------------------
3dtbB           AAMRS------EAKVIMHDPFAMRPFFGY--------------
2b8tB           RHHHK------VPNRPYLNSNSEEFIK----------------
1e9fA           RVLSE------DAIATATEKPLGEL------------------
2a1fC           LAKAG-----MNRVVGDHMGMLATV------------------
2bhvD           QILRDKSKIAPREGSRVFISPNTDIFFPINEVIAEFL------
1accA           RYDML------NISSLRQDGKTFIDFKKYNDKLPLYISN----
2dr3A           GIIRL------DLDEIDGELKRSLIVW----------------
3bjqB           RNTK--RIDFGYEGDPYSIVPSALE------------------
2awnD           MSLG------IRPEHLLPSDIADVILEGE--------------
2bx2L           QLRLR------DLGGLIVIDFIDMT------------------
2a1fE           AKAGM------NRVVGDHMGMLATV------------------
2dr3C           GIIRL------DLDEIDGELKRSLIVWKRGTSHSMRRHPF---
2b8tC           HHHKV------PNRPYL-NSNSEEFI-----------------
3ecpA           RTVG------LLHQEWWMRPDDPAD------------------
3cddD           KFTIKDSAGLPTVG-----------------------------
2awnB           KIVVL------DAGRVAQVGKPLELYH----------------
2ccjB           RFKSV------NADQPL-ENVVEDTYQT---------------
2cckA           FKSVN------ADQPLEVVEDTYQTIIKY--------------
1bglA           MAITVDVEVASDTPHPARIGLNCQLAQVAERVNWLG-------
3bk7A           DVI-----HVVYGEPGVYGIFSKPK------------------
3czjA           QMAIT-----VDVEVASD-------------------------
2e85A           QLKED-IGEVIFLGIQPDIVGFYYPMT----------------
2d4hB           GIQVNG------PRLESLVLTYVNAIS----------------
2b0lC           SAGVI------ESRSLGMKGTYIKVLNNK--------------
3dymA           QMAITVDVEVASDT-----------------------------
2d62A           DRI------AVNKGELQQVGTPDEVYYKVNTFVAGFIGS----
2aunB           LPAIHGPVAT---------------------------------
4dcgA           EYDYF------HMYFMLRTVYCNKT------------------
2b8tD           HHHKV------PNRPYLNSNSEEFI------------------
3bb1G           DEKVL------PNGIAWIPHLVQTITEVALNFVDKNLID----
2aumA           LSAFH------RHGLPAIHGPVATGLGL---------------
1e9dA           NWKMV------DASKSIEAVHEDIR------------------
1e2dA           NWKMV------DASKSIEAVHEDIRVLSEDAI-----------
1d1cA           GILH------LGNIKFEKGAGEGAVLK----------------
3dffA           HEAT------RDAALFATHEKNVPV------------------
2akaA           -------------------------------------------
2a2zA           ESWLL-----HRTLKTNFDYLQEVPI-----------------
2awnC           KIVVL------DAGRVAQVGKPLEL------------------
2bbtB           KILI------LHEGSSYFYGTFSELQNLRPDFSSKLMDSF---
1dkiA           FVID---------GADGRNFYHVNW------------------
2c61A           SGYIT------EGQIVVARELHRKG------------------
1e9rE           ALTS---------------------------------------
3dt7A           AMRSEATAAAEHKGKVIMHDPFAMRPFF-----GYNFGKYLAH
3bm2B           EAFGCREQDKIVG--FLYLGTPQLVPDPT--------------
3dt2A           AMRSEATAAAEHKGKVIMHDPFAMRPFF-----GYNFGKYLA-
3dyoA           QMA----------------------------------------
2bkeA           QLKKS------RGNRRIARVVDAPHLPEGEVVTEEGIRDA---
3dt4C           AMRSEATAAAEHKGKVIMHDPFAMRPFF-----GYNFGKYLAH
2c7cH           GIVKV------AAVKAPGFGDRRKA------------------
1afrA           DGTVL------AFADMMRKKISMP-------------------
1e2fA           NWKMV-----DASKSIE--------------------------
2czvA           IIL----------------------------------------
1e0jB           AHEEGRPVSITERNQQGDMPNLVLVRILKCRFTG---------
3di4A           ASCHPLLVEIFAPAEGLGDWPSPSVNGYD--------------
1cr1A           TIIAL------ERNQLVLVRILKCRFT----------------
2cgtH           GIVK------VAAVKAPGFGDRRKA------------------
2ancD           TIIRA------ERLRMSRQKQRHDALISK--------------
2d3wA           YVHVL------YQGRIVKSGDFTLVKQ----------------
1e59A           YLDNM------SEEEILELNIPTGVPL----------------
2e85B           QLKED-IGEVIFLGIQPDIVGFYY-------------------
3cr7C           -------------------------------------------
3bb1B           NGIAWIPHLVQTITEVALNKSESIFV-DKNLIDG---------
2bbtA           KILIL------HEGSSYFYGTFSELQNLR--------------
3b2qA           PDLSGYITEQIVVARELHR------------------------
3ec1A           DIVFS------GLGWVTCNDPGAQLVVHAPKGVDVFI------
2cbzA           VIIV------MSGGKISEMGSYQELLA-----RDGAFAEFLRT
2bv7A           YKV----------------------------------------
2awnA           KIVVL------DAGRVAQVGKPLELYH----------------
2d2fA           KVHV------MMDGRVVATGGPELALE-----LEAKGYEWLK-
2b8wB           IRKFF------PKKKCFVFDRPVHRRK----------------
2boeX           HVQQEVLE-----------------------------------
2dr3F           HGVD--GIIRLDLDEIDGELKRSLIVW----------------
1cr4A           TIIAL------ERNQLVLVRILKCRFT----------------
3c8uA           GNDLA------NARAIEAARLPADLT-----------------
3cmvE           KQAEFQILYGEGINFY---------------------------
3bb1C           EKV-------LPNGIAWIPHLVQTITEVESIFVDKNLID----
2bx9A           -------------------------------------------
2aumB           --------AFHRHGLPAIHGPVATGLGL---------------
3eiuB           SGI------GAGKTREDHKAVSDQ-------------------
2bboA           KILI------LHEGSSYFYGTFSELQNLQPDFSSKLMS-----
1d8jA           -------------------------------------------
3cr7D           -------------------------------------------
3bb1E           DEKVL------PNGIAWIPHLVQTI------------------
1cr0A           TIIAL------ERNQLVLVRILKCR------------------
1dp0A           MAITVDVE-----------------------------------
3bgwD           -------------------------------------------
3cbnA           -------------------------------------------
2d3wC           YVHV------LYQGRIVKSGDFTLVKQ----------------
2a30D           PILTL------DVNEYE--------------------------
2dr3D           PGVEH-----GVDGIIRLDLDEIDGELKR--------------
3dt4A           AMRSEATAAAEHKGKVIMHDPFAMRPF-----FGYNFGKYLAH
1ak2A           PLVEYYSKRGI-HSAIDASQTPDVVFASILAAFSKATS-----
2anbA           TIIRA------ERLRMSRQKQRHDALISK--------------
1e4yA           ELTTR------KDDQEETVRKRLVE------------------
2an9A           TIIRA------ERLRMSRQKQRHDALISK--------------
2b8wA           RRKL------AQLEKLQDEELD---------------------
3c95A           -------------------------------------------
2axpA           -------------------------------------------
2a5gA           -------------------------------------------
2ccjA           RFKSV------NADQPLENVVEDTY------------------
2c0bL           MTPV------RHQRAVENRLREAVR------------------
1e9sD           ARFVLSDKLPEHVT-----------------------------
421pA           -------------------------------------------
2aunA           RHGLP-----AIHGPVATGLGLQERLASLASVS----------
1e3mA           EGVAN------VHLDALEHGDTIAFHSVQDGAASKSYGLAV--
2cckB           QTII---------------------------------------
3bb1F           EKV-------LPNGIAWIPHLVQTITEVESIFVDKNL------
2ck3C           MNDA------FGGGSLTALPVIETQ------------------
3dm5B           LSAV------AATGAPIKFIGTGEKIDDEPFDPPRFVSRLLG-
2dr3E           GIIRL------DLDEIDGELKRSLIVWK---------------
3a1wA           -------------------------------------------
3d3kA           INYHS-----PFGCKFV--------------------------