[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ55679.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2ae3B.bssp"
#ERROR : Can't open dsspfile "2ae5B.bssp"
#ERROR : Can't open dsspfile "2advC.bssp"
#ERROR : Can't open dsspfile "1cp9B.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "1ai6A.bssp"
#ERROR : Can't open dsspfile "1cp9A.bssp"
#ERROR : Can't open dsspfile "1e3aA.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "2advB.bssp"
#ERROR : Can't open dsspfile "2ae5A.bssp"

## Summary of PDB Search
:854
    e-117  23%  2ae3B  [x.x.x] GLUTARYL 7-AMINOCEPHALOSPORANIC ACID ACYLASE
    e-111  23%  2ae5B  [x.x.x] GLUTARYL 7-AMINOCEPHALOSPORANIC ACID ACYLASE
    e-106  22%  2advC  [x.x.x] GLUTARYL 7- AMINOCEPHALOSPORANIC ACID ACYLASE
    4e-57  21%  1cp9B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    5e-49  23%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    3e-25  26%  1ai6A  [d.153.1] PENICILLIN AMIDOHYDROLASE
    1e-22  24%  1cp9A  [d.153.1] PENICILLIN AMIDOHYDROLASE
    6e-20  22%  1e3aA  [d.153.1] PENICILLIN AMIDASE ALPHA SUBUNIT
    3e-13  35%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    2e-07  52%  2advB  [x.x.x] GLUTARYL 7- AMINOCEPHALOSPORANIC ACID ACYLASE
    3e-05  15%  2ae5A  [x.x.x] GLUTARYL 7-AMINOCEPHALOSPORANIC ACID ACYLASE
:854

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxELELPALSAPVTVYRDEYGITHLYADT
2ae3B           ----------------------------------------------------------------------
2ae5B           ----------------------------------------------------------------------
2advC           ----------------------------------------------------------------------
1cp9B           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
1ai6A           ---------------------------------------------------SEIKIVRDEYGMPHIYAND
1cp9A           --------------------------------------------------STQIKIERDNYGVPHIYAND
1e3aA           --------------------------------------------------SSEIKIVRDEYGMPHIYAND
1e3aB           ----------------------------------------------------------------------
2advB           ----------------------------------------------------------------------
2ae5A           -------------------------------------------APIAAYKPRSNEILWDGYGVPHIYGVD


                         .         .         *         .         .         .         .:140
query           PEDLFTAQGYVHAQDRFWSMDFNRHVTAGRLAELFGADQVPTDAYLRTMGWRRVAEAEYDLLAEETRRYL
2ae3B           ----------------------------------------------------------------------
2ae5B           ----------------------------------------------------------------------
2advC           ----------------------------------------------------------------------
1cp9B           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
1ai6A           TWHLFYGYGYVVAQDRLFQMEMARRSTQGTVAEVLGKDFVKFDKDIRRNYWPDAIRAQIAALSPEDMSIL
1cp9A           TYSLFYGYGYAVAQDRLFQMEMAKRSTQGTVSEVFGKDYISFDKEIRNNYWPDSIHKQINQLPSQEQDIL
1e3aA           TWHLFYGYGYVVAQDRLFQMEMARRSTQGTVAEVLGKDFVKFDKDIRRNYWPDAIRAQIAALSPEDMSIL
1e3aB           ----------------------------------------------------------------------
2advB           ----------------------------------------------------------------------
2ae5A           APSAFYGYGWAQARSHGDNILRLYG---------------------------------------------


                         +         .         .         .         .         *         .:210
query           DAYAEGVNAYLEGKSATEVSLEYAVLAATNSEYEIEPWSAVDSLAWLKAMAWDLAGNMHDEIARASLLAR
2ae3B           ----------------------------------------------------------------------
2ae5B           ----------------------------------------------------------------------
2advC           ----------------------------------------------------------------------
1cp9B           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
1ai6A           QGYADGMNAWIDKVNTN--PETLLPKQFNTFGFTPKRWEPFDVAMFVGTMANRFSDSTSEIDNLALLLKD
1cp9A           RGYADGMNAWINTKPDDLMPKQFIDY-----DFLPSQWTSFDVAMIMVGTLANRFSDMNSEIDNLALLTA
1e3aA           QGYADGMNAWI--DKVNTNPETLLPKQFNTFGFTPRWEPFDVAMIFVGTMANRFSDSTSEIALLTALKDK
1e3aB           ----------------------------------------------------------------------
2advB           ----------------------------------------------------------------------
2ae5A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GLPREQVEELYPAYPEEQHAPILAGGRVRDGKFVLXXXXXXXXXXXXXXIPATAAVRALAGLQEPLEAIP
2ae3B           ----------------------------------------------------------------------
2ae5B           ----------------------------------------------------------------------
2advC           ----------------------------------------------------------------------
1cp9B           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
1ai6A           KYGVSQGMAVFNQLKWL-----------------------------------------------------
1cp9A           LKDKQLGVEFFNQINWLNNPNAP-----------------------------------------------
1e3aA           Y-GVSQGMAV-FNQLKWLVNPSAPTTIAVQE----------SNYPLKFNQQNSQTAALLPRYDLPAPMLD
1e3aB           ----------------------------------------------------------------------
2advB           ----------------------------------------------------------------------
2ae5A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RTFGPASSDLGSNSWVVSGEHTASGLPLLANDPHLGAVMPSIWYQMGLHCTTVDESCPFDVTGFTFPGLT
2ae3B           -----------SNSWAVAPGKTANGNALLLQNPHLSWTTDYFYYEAHLVT------PDFEIYGATQIGLP
2ae5B           ------------NSWAVAPGKTANGNALLLQNPHLSWTTDYFYYEAHLVTPD------FEIYGATQIGLP
2advC           ------------------------------------------LYEAHLVTPD------FEIYGATQIGLP
1cp9B           -----------SNVWLVGKTKASGAKAILLNGPQFGWFNPAYTYGIGLHGAG------FNIVGNTPFAYP
1ai4B           -----------SNMWVIGKSKAQDAKAIMVNGPQFGWYAPAYTYGIGLHG------AGYDVTGNTPFAYP
1ai6A           ----------------------------------------------------------------------
1cp9A           ----------------------------------------------------------------------
1e3aA           RPAKGADGALGKNRETIAAQFAQGGANGLA----------------------------------------
1e3aB           ----------GSNMWVIGKSKAQDAKAIMVNGPQFGWYAPAYTYGIGLHG------AGYDVTGNTPFAYP
2advB           -----------SNSWAVAPGKTANGNALLLQNPHLS----------------------------------
2ae5A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GVVIGANDTIAWGFTNLGPDVIDLYLEKLDGDSAIVDGAPEPLETRTETIRVAGGDDVEITVRSSRHGPL
2ae3B           VIKFAFNQRMGITNTVNGMVGATNYRLTLQDGGYLYDGQVRPFERPQASYRLRQADDKPLEIRSSVHGPV
2ae5B           VIRFAFNQRMGITNTVNGMVGATNYRLTLQDGGYLYDGQVRPFERRQASYRLRQADDKPLEIRSSVHGPV
2advC           VIRFAFNQRMGITNTVNGMVGATNYRLTLQDGGYLYDGQVRPFERRQASYRLRQADDKPLEIRSSVHGPV
1cp9B           AILFGHNGHVSWGSTAGFGDGVDIFAEQVSPEDPLHQGQWKKMLSRQETLNVKGEQPITFEIYRTVHGNV
1ai4B           GLVFGHNGVISWGSTAGFGDDVDIFAERLSAEKPLHNGKWVKMLSREETITVKNGQAETFTVWRTVHGNI
1ai6A           ----------------------------------------------------------------------
1cp9A           ----------------------------------------------------------------------
1e3aA           ----------------------------------------------------------------------
1e3aB           GLVFGHNGVISWGSTAGFGDDVDIFA--------------------------------------------
2advB           ----------------------------------------------------------------------
2ae5A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LSDPELGAQLRTFAAKAPVTPEGEPAETAQDGDYAVAISWTALTPGRTADAIFLLNRARTFDEFREAART
2ae3B           FE---------------------------RADGTAVAVRVAGLDRPGMLEQYFDMITADSFDDYEAALAR
2ae5B           FE---------------------------RADGTAVAVRVAGLDRPGMLEQYFDMITADSFDDYEAALAR
2advC           FE---------------------------RADGTAVAVRVAGLDRPGMLEQYFDMITADSFDDYEAALAR
1cp9B           VKRD-----------------------KTTHTAYSKARAWDGKEL-TSLMAWVKQGQAQNWQQWLDQAQN
1ai4B           LQTD-------------------------QTTQTAYAKSRAWDGKEVASLLAWTHQMAKNWQQWTQQA-A
1ai6A           ----------------------------------------------------------------------
1cp9A           ----------------------------------------------------------------------
1e3aA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2advB           ----------------------------------------------------------------------
2ae5A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           FEVPAQNLIYADTSGNIGYQAPGKIPVRGKGDGRWPAPGWDSDYDWKEYLPFEELPTVVNPDSGFIVTAN
2ae3B           MQVPTFNIVYADREGTINYSFNGVAPKRAEGFWQGLVPGDSSRYLWTETHPLDDLPRVTNPPGGFVQNSN
2ae5B           MQVPTFNIVYADREGTINYSFNGVAPKRAEGFWQGLVPGDSSRYLWTETHPLDDLPRVTNPPGGFVQNSN
2advC           MQVPTFNIVYADREGTINYSFNGVAPKRAEGFWQGLVPGDSSRYLWTETHPLDDLPRVTNPPGGFVQNSN
1cp9B           -QALTINWYYADKDGNIGYVHTGHYPDRQINHDPRLPVSGTGEWDWKGIQPFANNPKVYNPKSGYIANWN
1ai4B           KQALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWKGLLPFEMN---------------
1ai6A           ----------------------------------------------------------------------
1cp9A           ----------------------------------------------------------------------
1e3aA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2advB           ----------------------------------------------------------------------
2ae5A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           QAVVDSGYPHLLTTDWDYGYRSQRVVTLLEAAIADGGLTVEDMVDIQLDNENSGARALVPYLVEVDVXXX
2ae3B           DTYTPKDFPSYLAPQTPHSLRAQQSVRLMS---ENDDLTLERFMALQLSHRAVMADRTLPDLIPADPDPE
2ae5B           DTYTPKDFPSYLAPQTPHSLRAQQSVRLMS---ENDDLTLERFMALQLSHRAVMADRTLPDLIPADPDPE
2advC           DTYTPKDFPSYLAPQTPHSLRAQQSVRLMS---ENDDLTLERFMALQLSHRAVMADRTLPDLIPADPDPE
1cp9B           NSPAKNPASDLFAFLWGSADRVKEIDNRIE---AYDKLTADDMWAIQTSRVDLNHRLFTPFLTQAKLVSM
1ai4B           ----------------------------------------------------------------------
1ai6A           ----------------------------------------------------------------------
1cp9A           ----------------------------------------------------------------------
1e3aA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2advB           ----------------------------------------------------------------------
2ae5A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           XXXXXXXXXXWXXXXXXXXXXXXXYNATYRHLLPLVFDELGANPKIEASQAWLLLTSLVESPESEWWRGE
2ae3B           VQAAARLLAAWDREFTSDSRAALLFEEWARLFAGQNFAGQAGFATPWSLDKPV--------------STP
2ae5B           VQAAARLLAAWDREFTSDSRAALLFEE-------WARLFAGQNFAGQAGFAT-------PWSLDKPVSTP
2advC           VQAAARLLAAWDREFTSDSRAALLFEEWARLF---------AGQNFAGQAGFATPWSLDKPVSTPYG---
1cp9B           LQQWDGINQLSSDGKHYIHPGSAILDIWLKEMLKATLGQTVPAPFDKISTGAKLLYESLLEDKSPISQSF
1ai4B           ---------------------------------------------------------LNISVGAKILYEA
1ai6A           ----------------------------------------------------------------------
1cp9A           ----------------------------------------------------------------------
1e3aA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2advB           ----------------------------------------------------------------------
2ae5A           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           EVSSRDEALRVAMERAAAELTELLGEDVAAWRWGDLHTLTVRNASFGESGIAAVEWLFNRGPVATGGGSS
2ae3B           YGVRDPKAAVDQLRTAIANTKRKYGAI--DRPFGDASRMILNDVNVP-----------GAAGYGNLGSFR
2ae5B           YGVRDPKAAVDQLRTAIANTKRKYGAI--DRPFGDASRMILNDVNVP-----------GAAGYGNLGSFR
2advC           --VRDPKAAVDQLRTAIANTKRKYGAI--DRPFGDASRMILNDVNV-----------PGAAGYGNLGSFR
1cp9B           SGQPQNDVIRKTLNTTYQKMIEKYGDNPANWQTPATAL-------------TFRENNFFGIPQALPQENF
1ai4B           VQGDKSPIPQAVDLFAGKPQQEVVLAALEDTWETLSKRYGNNVSNWKTPAMALTFRANNFFGVPQAAAEE
1ai6A           ----------------------------------------------------------------------
1cp9A           ----------------------------------------------------------------------
1e3aA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2advB           ----------------------------------------------------------------------
2ae5A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           VVNATGWDPAQGYEVTTVPSMRMVVDLADVDNSQWINLTGNSGHAFHPHYADQLELWAAGTMLPMRMTRS
2ae3B           VFTWSDPDENGVRTPVHGETWVAMIEFSTPVRAYGLMSYGNSRQPGTTHYSDQIERVSRADFRELLLRRE
2ae5B           VFTWSDPDENGVRTPVHGETWVAMIEFSTPVRAYGLMSYGNSRQPGTTHYSDQIERVSRADFRELLLRRE
2advC           VFTWSDPDENGVRTPVHGETWVAMIEFSTPVRAYGLMSYGNSRQPGTTHYSDQIERVSRADFRELLLRRE
1cp9B           HQNEYHNRG---------TENDLIVFTEEGVSAWDVVAPGQSGFISPPHYQDQLSLYQQFGKKPLWLNSE
1ai4B           TRHQAEYQNRGTENDMIVFSPTTS---DRPVLAWDVVAPGQSGFIADKHYEDQLKMYENFGRKSLWLTKQ
1ai6A           ----------------------------------------------------------------------
1cp9A           ----------------------------------------------------------------------
1e3aA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2advB           ----------------------------------------------------------------------
2ae5A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           AVEEAAEHTLVLRP
2ae3B           QVEAAVQERTPFNF
2ae5B           QVEAAVQERTPFNF
2advC           QVEAAVQERTPFNF
1cp9B           DVAPYIESTETLII
1ai4B           DVEAHKESQEVLHV
1ai6A           --------------
1cp9A           --------------
1e3aA           --------------
1e3aB           --------------
2advB           --------------
2ae5A           --------------