[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ55697.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "1cjaA.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "3ecpA.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "4atjA.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "2an9A.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "2czvB.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "1dw9A.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "3d1mB.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "3c7kA.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "3e8aC.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "2dftA.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "1e4vA.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "2dftC.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "2bhvA.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "2d4uB.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "3cnnA.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "2ancB.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "3bb1D.bssp"
#ERROR : Can't open dsspfile "3b85B.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "1e9sK.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "3dfdA.bssp"
#ERROR : Can't open dsspfile "2a5vA.bssp"
#ERROR : Can't open dsspfile "3cddA.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "2axnA.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "2ax4B.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "2a5vB.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "1d6aA.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "2e85A.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "2ax4A.bssp"
#ERROR : Can't open dsspfile "3e70C.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "2bwjB.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "2bhvC.bssp"
#ERROR : Can't open dsspfile "1d2zD.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "2aqwA.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "3cddE.bssp"
#ERROR : Can't open dsspfile "2a78A.bssp"
#ERROR : Can't open dsspfile "3ci2A.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "2bsqE.bssp"
#ERROR : Can't open dsspfile "2bwjF.bssp"
#ERROR : Can't open dsspfile "3c85A.bssp"
#ERROR : Can't open dsspfile "1chdA.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"
#ERROR : Can't open dsspfile "3c5vA.bssp"
#ERROR : Can't open dsspfile "3e3xA.bssp"
#ERROR : Can't open dsspfile "2c95B.bssp"

## Summary of PDB Search
:243
    1e-35   7%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    2e-34  28%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-33  11%  3cmvH  [x.x.x] PROTEIN RECA
    4e-33  23%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
    9e-33  14%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-31   8%  2bifA  [c.37.1 - c.60.1] PROTEIN
    2e-31   7%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    3e-31   8%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    1e-30  19%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-30  14%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    7e-30   9%  3cmvG  [x.x.x] PROTEIN RECA
    2e-29   9%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    4e-29  11%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    5e-29   9%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    9e-29  11%  1d1cA  [c.37.1 - b.34.3] MYOSIN
    3e-28  14%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    5e-28   9%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-27  10%  1aroP  [e.8.1] T7 RNA POLYMERASE
    1e-27  12%  3cmvC  [x.x.x] PROTEIN RECA
    2e-27  15%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    4e-27  12%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    7e-27   8%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    1e-26  12%  2b8tA  [x.x.x] THYMIDINE KINASE
    2e-26   9%  2akaB  [x.x.x] DYNAMIN-1
    3e-26  12%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    4e-26  10%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    6e-26  10%  3cmvA  [x.x.x] PROTEIN RECA
    6e-26  10%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    9e-26  18%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-25  10%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    2e-25  12%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    3e-25  13%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    3e-25  12%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    4e-25  15%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    2e-24   8%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    3e-24  10%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    3e-24  12%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    3e-24  11%  1e98A  [c.37.1] THYMIDYLATE KINASE
    4e-24  14%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    5e-24   9%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-23  10%  2b8tB  [x.x.x] THYMIDINE KINASE
    1e-23  11%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-23  15%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-23  13%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    3e-23  11%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    3e-23   7%  2axzC  [x.x.x] PRGX
    5e-23  12%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    9e-23  27%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    1e-22  12%  2cckA  [x.x.x] THYMIDYLATE KINASE
    2e-22   8%  4dcgA  [x.x.x] VP39
    2e-22   6%  2ctsA  [x.x.x] CITRATE SYNTHASE
    2e-22  10%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    2e-22  11%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    4e-22  27%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-22  11%  1e0jA  [c.37.1] DNA HELICASE
    7e-22  11%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    8e-22  11%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    8e-22  11%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    9e-22  25%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    1e-21  11%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    1e-21  11%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    3e-21  11%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    4e-21  28%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-21  11%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-21   9%  2cgtH  [x.x.x] 60 KDA GROEL
    6e-21  12%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    1e-20  10%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    1e-20   9%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
    2e-20  10%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE
    2e-20  12%  2bdtA  [x.x.x] BH3686
    2e-20   9%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-20  11%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
    3e-20  13%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    4e-20  10%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    4e-20  10%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    4e-20  12%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
    5e-20  11%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    5e-20  12%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284
    9e-20  11%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    1e-19  16%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE
    1e-19  12%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    2e-19  11%  1e0jB  [c.37.1] DNA HELICASE
    2e-19  10%  2b8tC  [x.x.x] THYMIDINE KINASE
    2e-19  11%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-19  11%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    2e-19  15%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM
    3e-19  12%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-19  10%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-19   8%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    9e-19   6%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
    1e-18  12%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    2e-18  11%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-18  10%  3cmxA  [x.x.x] PROTEIN RECA
    2e-18  13%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280
    2e-18  10%  421pA  [x.x.x] H-RAS P21 PROTEIN
    3e-18   8%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    3e-18  12%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-18   8%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN
    5e-18  13%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    6e-18  14%  3cmtD  [x.x.x] PROTEIN RECA
    6e-18  18%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-18  20%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    8e-18  12%  2cckB  [x.x.x] THYMIDYLATE KINASE
    1e-17   9%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    1e-17  19%  2d2eA  [x.x.x] SUFC PROTEIN
    1e-17  26%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    1e-17  10%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B
    1e-17  12%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    1e-17  10%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-17  10%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-17   9%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    1e-17  20%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-17  10%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-17  14%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-17   9%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN
    3e-17  12%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    3e-17   8%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284
    4e-17   7%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    4e-17   8%  3bczC  [x.x.x] PROTEIN MEMO1
    5e-17  10%  3cmvE  [x.x.x] PROTEIN RECA
    5e-17  15%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE
    6e-17   8%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN
    7e-17  10%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    7e-17  15%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE
    7e-17  28%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    8e-17  20%  2d2fA  [x.x.x] SUFC PROTEIN
    9e-17  11%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-16  16%  3c8uA  [x.x.x] FRUCTOKINASE
    1e-16  13%  2bx2L  [x.x.x] RIBONUCLEASE E
    1e-16  18%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-16  13%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    2e-16   8%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    2e-16   7%  3dymA  [x.x.x] BETA-GALACTOSIDASE
    2e-16  11%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    2e-16   9%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    2e-16  17%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE
    3e-16  22%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    3e-16  10%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-16   8%  2c9oC  [x.x.x] RUVB-LIKE 1
    4e-16  12%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-16  12%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-16   8%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN
    6e-16  13%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    6e-16  10%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    7e-16  14%  1e6cA  [c.37.1] SHIKIMATE KINASE
    8e-16   9%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    8e-16  11%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-15  14%  2c0bL  [x.x.x] RIBONUCLEASE E
    1e-15  12%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    1e-15  10%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    1e-15   8%  3da4A  [x.x.x] COLICIN-M
    1e-15  10%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-15  27%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-15  11%  3adkA  [x.x.x] ADENYLATE KINASE
    2e-15   8%  3czjA  [x.x.x] BETA-GALACTOSIDASE
    2e-15  15%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE
    3e-15  10%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE
    3e-15  14%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE
    3e-15   9%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    4e-15  15%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-15  25%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-15  15%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    7e-15  14%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    7e-15   9%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE
    8e-15  10%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE
    8e-15  15%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    8e-15   7%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    8e-15  19%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    8e-15  15%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-14   9%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-14  13%  1aldA  [c.1.10 (2aldA)] ALDOLASE A
    1e-14  12%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    2e-14   9%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    2e-14  15%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-14   9%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284
    3e-14  15%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
    4e-14  15%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-14  13%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
    4e-14   8%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE
    5e-14  10%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
    5e-14  10%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    5e-14  12%  3cm0A  [x.x.x] ADENYLATE KINASE
    6e-14  11%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
    6e-14   9%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    7e-14   7%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284
    7e-14  12%  2boeX  [x.x.x] ENDOGLUCANASE E-2
    7e-14  10%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    8e-14  12%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE
    8e-14  14%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN
    8e-14  27%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    8e-14   8%  1cjaA  [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)
    8e-14  16%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    9e-14  14%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    9e-14  14%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    9e-14   8%  3ecpA  [x.x.x] TN5 TRANSPOSASE
    1e-13   9%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    1e-13  15%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-13  15%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-13  14%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-13   7%  2c4rL  [x.x.x] RIBONUCLEASE E
    2e-13   9%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
    2e-13  13%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN
    3e-13  12%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-13  10%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    5e-13  15%  2a1fF  [x.x.x] URIDYLATE KINASE
    6e-13  10%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    6e-13  10%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1
    6e-13  13%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-13  13%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE
    6e-13  11%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    7e-13  12%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN
    8e-13  10%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    9e-13  17%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-12  10%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
    1e-12  15%  4atjA  [a.93.1] PROTEIN (PEROXIDASE C1A)
    1e-12  14%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    1e-12  14%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    2e-12  11%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-12  13%  2an9A  [x.x.x] GUANYLATE KINASE
    2e-12  14%  1adoA  [c.1.10] ALDOLASE
    2e-12  11%  2bofX  [x.x.x] ENDOGLUCANASE E-2
    2e-12   9%  2c9gA  [x.x.x] PENTON PROTEIN
    2e-12  15%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-12  10%  2czvB  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    3e-12  11%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2
    3e-12  13%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639
    3e-12  13%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-12  14%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    3e-12  11%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-12  12%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6
    4e-12  12%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    4e-12  15%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    4e-12  20%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    4e-12  16%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    4e-12  13%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-12   9%  2c7cH  [x.x.x] 60 KDA CHAPERONIN
    5e-12  14%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-12  10%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    6e-12  13%  3a00A  [x.x.x] GUANYLATE KINASE
    8e-12  12%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    1e-11  15%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-11  10%  3cmvB  [x.x.x] PROTEIN RECA
    1e-11  21%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    1e-11  10%  1e2iB  [c.37.1] THYMIDINE KINASE
    1e-11  11%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    1e-11  13%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN
    2e-11  11%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE
    2e-11  12%  1e2iA  [c.37.1] THYMIDINE KINASE
    2e-11   6%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
    2e-11  13%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
    2e-11   8%  1e2kA  [c.37.1] THYMIDINE KINASE
    3e-11  14%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-11  14%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    4e-11  13%  2anbA  [x.x.x] GUANYLATE KINASE
    6e-11  10%  3be4A  [x.x.x] ADENYLATE KINASE
    6e-11   7%  1dw9A  [a.35.1 - d.72.1] CYANATE LYASE
    7e-11   9%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    8e-11   8%  3ec1A  [x.x.x] YQEH GTPASE
    9e-11  14%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    9e-11  11%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    1e-10  20%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-10   8%  2ancF  [x.x.x] GUANYLATE KINASE
    1e-10  20%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-10  16%  2a1fC  [x.x.x] URIDYLATE KINASE
    2e-10  27%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-10   8%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF
    2e-10  15%  2a1fD  [x.x.x] URIDYLATE KINASE
    2e-10  14%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-10  10%  2b8tD  [x.x.x] THYMIDINE KINASE
    2e-10  12%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    2e-10  10%  3dlbB  [x.x.x] ARGONAUTE
    3e-10   5%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    4e-10  13%  3d1mB  [x.x.x] SONIC HEDGEHOG PROTEIN
    4e-10  13%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    6e-10  14%  3a00B  [x.x.x] GUANYLATE KINASE
    6e-10  21%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    6e-10  17%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    8e-10  21%  3c7kA  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    9e-10   8%  3dyoA  [x.x.x] BETA-GALACTOSIDASE
    1e-09   8%  1e2kB  [c.37.1] THYMIDINE KINASE
    1e-09  19%  3e8aC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    1e-09  15%  3cmuA  [x.x.x] PROTEIN RECA
    1e-09  13%  2dftA  [x.x.x] SHIKIMATE KINASE
    1e-09   9%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    2e-09  12%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    2e-09  15%  2a1fE  [x.x.x] URIDYLATE KINASE
    2e-09  16%  1azsC  [c.37.1 - a.66.1] GS-ALPHA
    3e-09  10%  1e4vA  [c.37.1 - g.41.2] ADENYLATE KINASE
    3e-09  10%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    3e-09  12%  3cmwC  [x.x.x] PROTEIN RECA
    3e-09   8%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    4e-09   9%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    4e-09   7%  1e2nA  [c.37.1] THYMIDINE KINASE
    4e-09  20%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-09  14%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    5e-09   7%  2bhvD  [x.x.x] COMB10
    5e-09  10%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
    6e-09  13%  2dftC  [x.x.x] SHIKIMATE KINASE
    6e-09  20%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-09  11%  2bhvA  [x.x.x] COMB10
    8e-09  14%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4
    8e-09  10%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
    8e-09   8%  2d4uB  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    9e-09  14%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    1e-08  13%  2ancD  [x.x.x] GUANYLATE KINASE
    1e-08   9%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-08  10%  3cnnA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    2e-08  16%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    2e-08   7%  1eamA  [c.66.1] PROTEIN (VP39)
    2e-08   5%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)
    3e-08   9%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    4e-08  12%  2ancB  [x.x.x] GUANYLATE KINASE
    5e-08  15%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    7e-08  31%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    8e-08   8%  1d8jA  [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    9e-08  13%  3bb1D  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    9e-08  12%  3b85B  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    1e-07  10%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    2e-07  20%  1e9sK  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-07  10%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107
    3e-07  16%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    3e-07   8%  1e2hB  [c.37.1] THYMIDINE KINASE
    3e-07   9%  3dfdA  [x.x.x] PROTEIN YQBN
    4e-07  16%  2a5vA  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    8e-07  13%  3cddA  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    8e-07   7%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
    8e-07  14%  2axnA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    9e-07  18%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    1e-06  10%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    1e-06  20%  2ax4B  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    2e-06  15%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-06  16%  2a5vB  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    5e-06  22%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    7e-06  12%  1d6aA  [d.165.1] POKEWEED ANTIVIRAL PROTEIN
    8e-06   8%  1e2lA  [c.37.1] THYMIDINE KINASE
    9e-06  10%  1e2mA  [c.37.1] THYMIDINE KINASE
    1e-05  10%  2e85A  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    1e-05  12%  1e2lB  [c.37.1] THYMIDINE KINASE
    2e-05  13%  2cdnA  [x.x.x] ADENYLATE KINASE
    2e-05  20%  2ax4A  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    2e-05  14%  3e70C  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    3e-05  15%  1e2jB  [c.37.1] THYMIDINE KINASE
    3e-05  19%  2bwjB  [x.x.x] ADENYLATE KINASE 5
    3e-05  10%  1e2hA  [c.37.1] THYMIDINE KINASE
    6e-05  10%  1e2mB  [c.37.1] THYMIDINE KINASE
    6e-05  19%  2bwjD  [x.x.x] ADENYLATE KINASE 5
    7e-05   6%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN
    7e-05  11%  1e2nB  [c.37.1] THYMIDINE KINASE
    8e-05  14%  2bhvC  [x.x.x] COMB10
    1e-04  10%  1d2zD  [a.77.1] DEATH DOMAIN OF TUBE
    1e-04   6%  1bccF  [f.27.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    2e-04   8%  2aqwA  [x.x.x] PUTATIVE OROTIDINE-MONOPHOSPHATE-DECARBOXYLASE
    2e-04   9%  1e2jA  [c.37.1] THYMIDINE KINASE
    2e-04   8%  1dwmA  [d.40.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    3e-04  12%  3cddE  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    3e-04  18%  2a78A  [x.x.x] RAS-RELATED PROTEIN RAL-A
    3e-04  12%  3ci2A  [x.x.x] CHYMOTRYPSIN INHIBITOR 2
    4e-04  17%  1ckeA  [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    4e-04  22%  3dkvA  [x.x.x] ADENYLATE KINASE
    4e-04   7%  2bsqE  [x.x.x] TRAFFICKING PROTEIN A
    5e-04  13%  2bwjF  [x.x.x] ADENYLATE KINASE 5
    5e-04  10%  3c85A  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    6e-04  15%  1chdA  [x.x.x] CHEB METHYLESTERASE
    8e-04  15%  3bm2B  [x.x.x] PROTEIN YDJA
    8e-04  15%  3c5vA  [x.x.x] PROTEIN PHOSPHATASE METHYLESTERASE 1
    8e-04  31%  3e3xA  [x.x.x] BIPA
    0.001  11%  2c95B  [x.x.x] ADENYLATE KINASE 1
:243

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTTPPALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPP
2dwoA           ------SRVQKIWVPVDHR-PSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFN---
3b5jA           ----HDITFRNIRFRYDSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDL
3cmvH           ------DRSMDVETISTGSLSLDIAAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH
3b60A           -RATGDLEFRNVTFTYPGRPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGLRE
3dmdC           ----AVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAA---
2bifA           ---------------------------------LIVMVGLPARGKTYISKKLTRYLNFIGVPTREFN---
2dwpA           --------------------RVQKIWVPVDHRTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGE
1bifA           -------------------------------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQ
2d3wB           ------LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFLSP
2c03B           --TPAEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVA---
3cmvG           -MRLGEDRSMDVETISTGSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFID-AE
3c95A           --------------MVDLAGDISPLLELDSDTLRAVPVKLVHINKCPVLAQANTLRPEDADRLGINRNLK
3eiuA           GAAMNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFA
2c61B           ---MNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFI
1d1cA           --------------IFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQAGVLEQ
3dmdB           ----AVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAA---
2b8wA           --TGPMCLIENTNGRLMNPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTK
1aroP           ----------------------------------------------------------------------
3cmvC           --RLGEDRSMDVETISTLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH
1e69A           -------------LYLKGFKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFLPPAGS
2ccgA           ---------------------------------FITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGG
2ccgB           -------------------------------SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGG
2b8tA           -------------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKI
2akaB           ------EDLIPLVNRLQDAFSAIGQNADLDLPQI-AVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPL
3czpB           ---------------QARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPT
2czvA           --------------------GVKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYGKV
3cmvA           LGEDRSMDVETISTGSLSLDIAL-GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH
2a2zD           ------------------------------RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWC
2bbsA           --STTEVVMENVTAFWKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG---
3dm5A           ----KKEHIIKIVYEEKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGV-----
2bc9A           -MTGPMCLIENTNGRLMNPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQS---
3b85A           -------------VIRPKTLGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPA
1e9cA           ------------------------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPE
2c04A           --TPAEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVA---
2a5gA           ------------------------------KEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVEK
2ccjB           ---------------------------------FITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGG
2c61A           ---MNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFA
1e98A           ------------------------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPE
2c03A           --TPAEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVA---
3b2qA           GAAMNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFA
2b8tB           -------------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKI
3dt2A           GKKCFALRIASRLAKEAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWM
2awnD           -----SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM
1cr4A           ----HLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGL----
3eiuB           GAAMNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFGALER
2axzC           ----------------------------------------------------------------------
1e9fA           ------------------------------RGALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPE
3dhwC           ------IKLSNITKVFHQIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQEL
2cckA           ---------------------------------FITFEGPEGSGKTTVINEVYHRLVKDYDVIMTRE---
4dcgA           ---------------------LQRHGILDG-----ATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLHDP
2ctsA           ------------ASSTNLKDILADLKEQARIKTFRQQHGNTAVGQITVDMMYGGMRGMKGLVYETSVGIR
2c9yA           -------------------------------GIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAM
3d3kA           --------VPSISYELHKKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPQRPTVLCGPHVKGAQGI
2awnB           -----SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM
1e0jA           ----REHLSSSVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLE
3bh0A           ------SADGNITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHS---
3dt4A           GKKCFALRIASRLAKEAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWM
1e2dA           ------------------------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPE
2d62A           ----AEVKLINIWKRFGDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAGLEEPTRGQIYIEDNLVA
1dkiA           --VKSLLDSKGIHYNQGNLLTPVIEKVKPGEQSFVGQHAATGSVATATAQIMKYHNYPNKGLKDYTYTLS
3a1wA           -----------------------------------ALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKK
3b2qB           -----------PKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSVVFAAMGIT
2awnC           ------------SVQLQNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLGVGMVFQ--------
1e9rA           ----SGGKLKRMTREKAKQVTVAGVPMPRDAEPHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
2cgtH           RNVVLDKSFGAPTITKDGVSVAREIELEDKFNMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKA
1e9dA           ------------------------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPE
2a30B           ------------------------------RIKKISIEGNIAAGKSTFVNILKWEVVPEPVARWCNVQST
1bg0A           -------SIKNKKTGMGATLLDVIQSGVENLDSGVGIYAPDAESYRTFGPLFDPIIDDYHGGFKLTDKHP
2a30D           ------------------------------RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWC
2bdtA           ---------------------------------LYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIGYRP
3bb1F           ------SGINTFAPATQTLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRP
1dg3A           --TGPMCLIENTNGRLMAPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKHTKGIWMWCVPHPK
3czpA           --------------------GLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPT
2d4hA           --TGPMCLIENTNGRLMAPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQKGIW
1e3aB           --------------EWTQQAAKQALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPDWKGLLPFEM
3d7wA           -------YVSSGSFSNN-IPLLRQSTVPVSEGQRFVLVELTNAGGDTITAAIDVTNLYVVAYEAGNQ---
2d4hB           MTGP-MCLIENTNGRLMALKILSAITQPMVVVAIVGL---YRTGKSYLMNWMWCVPHPKKPGHILVLLGQ
2dr3A           -------------VKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEE
2a2zA           ------------------------------RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWC
3cr7C           ------------------------------RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGD
2a2zB           ------------------------------RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWC
1e0jB           --REHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLE
2b8tC           -------------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVPKIDS
3bb1B           ------SGINTFAPATQTKLLLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSGPRPV
2d4uA           -----------------------------------GPLGSGGLFFNALKNCKENFTVLQTIRQQQSTLNL
2cjwB           ------------------------------TYYRVVLIGEQGVGKSTLANIFAGVEDTYERTLMVDGESA
1e9sF           ----SGGKLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
1e9sD           ----SGGKLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
1dhjA           ----------------------------------------------------------------------
3bo6B           ------HSLHNQMRQMPMSHFREALDAPDYSGMRQSGFFAMSQGFQLESHGGDVFMHAHRENPQCKGDFA
1e3mA           -----------------------------------------LVNLAERAYTLNYTCPTFIDKPGIRITEG
3bb1C           ------SGINTFAPATQTLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRP
3cmxA           ------------------SLSLDIALGAGGMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH
2axpA           ---------------------------------LIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAK
421pA           ------------------------------TEYKLVVVGARGVGKSALTIQLIQNHFVDEYDPTIEDSYR
3dtbB           --------------WLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWM
1e9sG           ----SGGKLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
2bkiA           SETIKSYQGKSLGTVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRI
1d6jB           ---------------ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRHAYRLDGDN
3cmtD           ------LGQIEKQFGKGSIMRLGEDRSMLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDADP
2bbtB           --EGFGELFEKAKQNNNNTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS----
2d3wA           ------LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTDLLALSPED
2cckB           ---------------------------------FITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPTG
2d0kA           ----------------------------------------------------------------------
2d2eA           ------LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGE
1b0uA           ------LHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNI
2a5jA           ------------------------------YLFKYIIIGDTGVGKSCLLLQFTDKRFQPIGVEFGARMVN
3cddD           -----------IVLKAGGKIYQGWTKIGITRS-----LEASGAFDLETY----KFNDAQYKAFIEPIKQG
3dt7A           GKKCFALRIASRLAKEAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWM
2b8wB           --TGPMCLIENTNGRLMNPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTK
2a30A           ------------------------------RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWQ
2bbsB           --------TEVVMENVTAFWVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS----
2b92B           --TGPMCLIENTNGRLMNPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTK
1e9rE           ----SGGKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
2akaA           ------------PHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGV
1e2fA           ------------------------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPE
2dr3B           ------------RVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEE
3cddF           --------WVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVQ
3bczC           ------------------------EASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTY
3cmvE           ------DRSMDVETISTGSLSLDIALGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH
1cr2A           ------SSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLA---
2bkhA           ------SLGTMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRI
3cddC           ----------------------EEIVLKA--------GGKIYQGWTKIGITRSLETYKFQYKAFIEPIKQ
1cr0A           ------SSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGL----
2awoC           ------------SVQLQNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKR-
2d2fA           ------LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGGENILEL
1e9sJ           -----GGKLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
3c8uA           ------------TLAALCQGVLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEVV----
2bx2L           ----------------------------------------------------------------------
2d3wD           ------LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGFKGKDLLA
1e3mB           ----------------------------------------------DVLVNLAERYTLNYTCPTFIGIRI
2ck3C           LKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLY
3dymA           ----------------------------------------------------------------------
3bgwD           --------------VPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHS---
3bgwA           -----------ITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHS---
3cr7A           ------------------------------RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLIRF
3d31A           ------IEIESLSRKWKNF-SLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDG---
1dhiA           ----------------------------------------------------------------------
2c9oC           -------------AREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEV
1e9rD           ----SGGKLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
1e9sB           -------KLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDLSK
2bv7A           --TGPFLEAVSHLPPF--FDCLGSPVFTPIKAKIKAVYDTNPTKFRTLQNILEVEKEMYGAEWPKVG---
1e2gA           ------------------------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPE
1ai4B           -------------------------TINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWKGL
1e6cA           ---------------------------------PIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHT
2bwjA           ------------------------FMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGLREELA
3bb1A           ------SGINTFAPATQTKLLLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRP
2c0bL           ----------------------------------------------------------------------
2dr3E           ------------RVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVAVQV
2dflA           KTALEVKKERMNVKKIGSQALDGLLAGGIETRTMTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSG---
3da4A           NADRNLVLHPGISVYDAYH---FAKPAPSQYDYRSMNMKQMSGNVTTPIVALAHYLWGNGAERSVNINQI
3dt4C           GKKCFALRIASRLAKEAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWM
3bk7A           ---------------------------EIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEWD----
3adkA           ---------------------------KLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRA-
3czjA           ----------------------------------------------------------------------
1cfrA           -----------------------------------DIISKSGEGNKYTINSAIAFVAYA-SHIDINGLRD
3ch4B           -----------------------MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPL
3cr7D           ------------------------------RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGF
5dfrA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2awnA           -----SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM
3dfoD           ----------------------------------------------------------------------
1cr1A           ----------SVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLA---
1drbA           ----------------------------------------------------------------------
2bhjA           ------------------------------------------------------IKNWGSGEILHDTLHH
3dfnC           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2d3wC           ------LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVLLALS
3dfnA           ----------------------------------------------------------------------
3bb1E           ------SGINTFAPATQTLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIRVVSISPFQSEGPRPVM
1aldA           ----------------------------------------------------------------------
2dr3F           -------------VKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEV
2eg5G           ----SAYNQLVLAKVKCVRELLRANLPNINKCIKVADLGCASGPNTLLTQSIDKVGQLERPTIQIFLNDL
3dftD           ----------------------------------------------------------------------
2dr3D           ------------RVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEE
6aldA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
2bjbA           ELMLDALQTLGLRVGVGSELTVSGRIEPGPGARV--DCGLAG----TVLRFVPPLAALGSVPVTFDG---
1e4yA           ----------------------------------IILLGALVAGKGTQAQFIMEKYGIPQISTGDML---
1draA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3cm0A           -------------------------------GQAVIFLGPPGAGKGTQASRLAQELGFKKLSTGDILRDH
3b55A           ----------------------------------------------------------------------
3d3qB           ------------------------------KPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQG
2dr3C           --------------------------------------RRVKTGIPGVDEILHGGIPERNVVLLSPGTGK
2boeX           ----------------------------------------------------------------------
1bmfC           LKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKYVA
3clvA           ---------------------------EKKSSYKTVLLGESSVGKSSIVLRLTKDTFHENTNTTIGASFC
3d1mA           ----------------------------------------------------------------------
2awoA           -----SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM
1cjaA           --------------------------------------------TTSAPEVLTKSTMQQLGSLMALDVIV
3bjdB           ---------------------------------------------NTRNFSLPQLQNLPIEEARIVADAL
3dfpC           ----------------------------------------------------------------------
2cvfA           -------------LSTGTKSLDSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGSP
3ecpA           ----------------------------------------------------SALHRAADWAKSVFSDPR
1e59A           ----------------------------VRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEDFA
3dftC           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
2c4rL           ---------------------GISRRIELKEALASLELPEGMGLIVRTAGVGKSAEALQWDLSFRLKHWE
2ahvA           --------VKPPRINGRVVLSAQEAVNYIPDECVLGAGGGILEATTLITALADKIISPTGLGDRADRGIS
2aumA           ----------------------------------------------------------------------
1e9sI           -------KLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
3d3qA           ------------------------------KPFLIVIVGPTASGKTELSIEVAKKFNGEIISQVYQGDIG
2a1fF           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3cueF           ---------------------------EYDYLFKLLLIGNSGVGKSCLLLRFSDDYISTIGVDFKIKTVE
1e9rG           -----GGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDGDM
3cr7B           ------------------------------RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGD
1d6jA           ---------------ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGD
2aunB           ----------------------------------------------------------------------
3cioD           ----------------------HFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADL
3dm9B           -----AVKEAVSEILETSRRIDLIEEIRKAEKPYVIFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDT
1accA           -------------IQETTARIIFNGKDLNLVERRIAAVNPSTTKPDMTLKEALKIFNEPNGNLQYQGKDI
4atjA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2d7vA           ----FVAALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQQL
3bb1G           -TVRGWSGINTFAPATQTLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRP
2an9A           -----------------------------AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTR
1adoA           ----------------------------------------------------------------------
2bofX           -------------------------------------------------------VNPNMSSAEWVRNNP
2c9gA           ----RVMVSRSLTKDKQVELKYEWVEFTLPEGNYSETMTIDLMNNAIVEHYLKVGRQNGVLE--------
1e9rF           -------KLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNS
2czvB           -----------VKFIEMDIRDKEAYELAKEWFDVVVSIKFNEEVDKEKLREARKEYGKVAILLSNPKPSL
1ak2A           ------------------------------KGVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAM
3cbnA           -----------------------------------------------------------RYTLRARGHPN
1e9sL           -------KLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDLSK
2d7vB           ----FVAALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQQL
1e9sM           ----SGGKLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
3bwdD           ------------------------------RFIKCVTVGDGAVGKTCLLISYTSNTFPFSANVVLGLWDT
1afrA           -----------------PREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDMLN
3c15C           ----------------------------YRATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKN
2dpyB           ----NPLQRTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERG
1cs4C           -------------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIEAI
3bv4A           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1e9sH           -------KLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
1bglA           ----------------------------------------------------------------------
3a00A           -----------------------------------VISGPSGTGKSTLLKKLFAEYPDSFGFSVSST---
3cnlA           --------------HKGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAKGIQWFSLE----
3dfqC           ----------------------------------------------------------------------
3cmvB           IMRLGEDRSMDVETISTGSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH
1culC           -------------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIEAI
1e2iB           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPM--
2bkeA           KTALEVKKERNVKKISTGSQALDGLLAGGIETRTTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLS----
2aumB           ----------------------------------------------------------------------
1akeA           -----------------------------------ILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAA
1e2iA           ----------------------------MPTLLRVYIDGPHGMGKTDDIVYVPEPMTYWRVLGASIANIY
3bpbA           --------PARSLVDGLTSSHLGKPDYAKALEAYIRALQTCDVDITLLPPDERFPDVEDPVLCTSRCITR
3dffA           -------------------------------------------------RLLAISPHLDDAVLS-FGAGL
1e2kA           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLVADDIVYVPEPMTYW---
3dfoC           ----------------------------------------------------------------------
3dvlD           -------EHQAIAKMRTMIEGFDDISGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVF----
2anbA           -----------------------------AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTR
3be4A           --------------------------NSKKHNLI--LIGAPGSGKGTQCEFIKKEYGLAHLSTGDMLREA
1dw9A           ----QSQINRNIRLDLADAI----LLSKAKKDLSFAEIDGTGLAEAFVTAALLGQQALPADAARLVGADE
1dekA           ---------------------------------LIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDA
3ec1A           ---------------------------------------------------------GKGNVITTSYFPG
1dekB           ---------------------------------LIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDA
1c9kC           ---------------------------------MILVTGGARSGKSRHAEALIGDAPQVLYIATSQILHH
2bbtA           ----WEEGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS----
2ancF           -----------------------------AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIVDVFL
1e9sE           -------KLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVD---
2a1fC           ----------------------------------------------------------------------
1cjtC           -------------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNI
2ahwD           --------VKPPRINGRVVLSAQEAVNYIPDECVLGAGGGILEATTLITALADKIISPTGLGDRADRGIS
2a1fD           ----------------------------------------------------------------------
2awoD           -----SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM
2b8tD           -------------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKIQS
1ek0A           ----------------------------------LVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFL
3dlbB           --------------------------VWVEGLAVYRREHARGPGWRVLGGAVLDLWVSDSGAFLLEVDPA
1av6A           -------ESANEVAKKGELFFLSKLQRHGILDG--ATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDG
3d1mB           ----------------------------------------------------------------------
3bb1H           ------SGINTFAPATQTKLLLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRP
3a00B           ---------------------------------PIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRT
2dpyA           ----NPLQRTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERG
3do6A           --KDDILYPYGHYIAKIDHRFLKSLENHEDGKLILVTATPAGEGKTTTSIGLSSLNRIGKKSIVTLREPP
3c7kA           -----------------------------------LLLGAGESGKSTIVKQMKIIFSGEDVKQYKPVIQS
3dyoA           ----------------------------------------------------------------------
1e2kB           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALG--------------
3e8aC           -------------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQD--I
3cmuA           --------VETISTGSL---SLDIAAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH
2dftA           -----------------------------------VLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQR
3crmA           ------------------------------LPPAIFLMGPTAAGKTDLAMALADALPCELISVDSALIYR
2ccjA           ---------------------------------FITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPG-
2a1fE           ----------------------------------------------------------------------
1azsC           ----------------------------YRATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKN
1e4vA           -----------------------------------ILLGAPVAGKGTQAQFIMEKYGIPQISTGDMLRAA
3b9qA           ----EIKDALKESVLEMLAKSKTELQLGFRKPAVIMIVGVNGGGKTTSLGKLAHRLKNEGTKVLMAAGDT
3cmwC           --------VETISTGSLSLDIA-LGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAED
1dp0A           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
1e2nA           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTY
1e9rB           -------KLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVD---
2e85B           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
3di4A           ---PDLALYRRASARKVLVPPREGRCFEVKAGQFFRISSVEGPQVGDLNLHNLHDLTERFFSGKTRALHG
2dftC           ---------------------------------KAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQR
1e9sA           -------KLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVD---
2bhvA           ----------------------------------------------------------------------
3cphA           ----------------------------------ILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFV
3brwA           -TTKVKLECNPTARIYLGKEHFNYYSLDTALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHDVIPI----
2d4uB           ----------------------------------------------------------------------
2cbzA           -----SITVRNATFTWADPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVA
2ancD           ------------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVS----
4dfrA           ----------------------------------------------------------------------
3cnnA           ---------------KGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAGIQWFSLENGVKI
1e1qB           ---PGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKK---
1eamA           ----------------------------RHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDG
1ckvA           ------AGIMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNNGKIEVDC
3dm5B           ----KKEHIIKIVYEEKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDT
2ancB           -----------------------------AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTR
1dvrA           ------------------------------ESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQ
3c14C           -------------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQD---
1d8jA           ----------------------------------------------------------------------
3bb1D           ------SGINTFAPATQTLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRP
3b85B           ---------------------QKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPA
3ed8A           ------IELKGTDFKE-DGNILGHKLEYNFNSHNVYITATRGTQKNGIKANFTVRHNVEDGSVQLADHYQ
1e9sK           -------KLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV----
3cqcA           QRAEALKQGNAIMRKFKKHEAAKEVFVKIPQDSIAEIYLPAEDDNAIREHLCIRAYLEAHETFNEW----
1cjuC           -------------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKN
1e2hB           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIPMTYWRVLG
3dfdA           ------IDAEEVEVPISKEGNVVPFIFKAITTDRIDELEKENTTKELDSQRFYARIAVETT--VYPTFKA
2a5vA           -----MFVVRTAGHVISAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYVRDVVERV
3cddA           ------------------------------------ETYKFLGNDAQYKAFIEPIKQGQACTVDIGGERV
2aexA           ----------------------------------------------------------------------
2axnA           ----TQSRVQKIWVPVDHR-PSLPRSCGPNSPTVIVMVGLPARGKTYI----------------------
1cjvC           -------------------------------THRLLLLGAGESGKSTIVKQMRILHVEKATKVQDIKNNL
2b0lC           ----------------------------------------------------------------------
2ax4B           ------------------------------RGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDN
2bboA           ----TEVVMENVTAFWEETPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRIS
2a5vB           --------VRTAGHVIDSVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYVRDVVERV
3dmdA           ----AVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGK-------------------------
1d6aA           ----------------SNIGKISGVMSFTEKTEAEFLLVAIQMVSEAARFKYIEN-QVKTNFNRAFNPNP
1e2lA           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLDIVYVPEPMTYWRVLGAS
1e2mA           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLG
2e85A           ----------------------------------------------------------------------
1e2lB           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPM--
2cdnA           -----------------------------GSHMRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRN
2ax4A           ------------------------------RGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDN
3e70C           ----VKEAVSEILETSRRI-DLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDT
1e2jB           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEP---
2bwjB           ---------------------------DLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTG------
1e2hA           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLG
1e2mB           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMVL
2bwjD           ----------------------------LRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTG------
3bjqB           ----------------------------------------------------------------------
1e2nB           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMAS
2bhvC           ----------------------------------------------------------------------
1d2zD           AGCLNFPAEIKKGFKYTDVFQIDEAANRLPPDQSKSQMSGKLNERPTVGVLLQLLVQAEAADFVALDFLN
1bccF           ---------------------------------------------------------------------G
2aqwA           ----------------------------------------------------------------------
1e2jA           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLG
1dwmA           ----------------------------------------------------------------------
3cddE           -------------------------------QGWTKIGITRSLEASGAFDLETYKFLDAQYKAFIEPIKQ
2a78A           ----------------------------------VIMVGSGGVGKSALTLQFMYDEFVEDYEPTKAD---
3ci2A           ----------------------------------------------------------------------
1ckeA           -------------------------------APVITIDGPSGAGKGTLCKAMAEWHLLDSGAI-YRVLAL
3dkvA           ------------------------------------LMGLPGAGKGTQAERIVE--KYGIPHISTGDMFR
2bsqE           ----------------------------------------------------------------------
2bwjF           ---------------------------DLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGREELAS
3c85A           ------------------------------------------------------LINPGHAQVLILGGAY
1chdA           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
3c5vA           FSPVPWSQMEDVEVENETGKDTFRVYKSGSEGPVLLLLHGGGHSALSWAVFTAAIISRVQCRIRSHGETK
3e3xA           ----------------------------------------------------------------------
2c95B           -----------------------EEKLKKTNIIF--VVGGPGSGKGTQCEKIVQ--KYGYTHLSTGDLLR


                         .         .         *         .         .         .         .:140
query           AQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIG
2dwoA           ----------------VGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVF
3b5jA           ALADPNWLRRQVGVVLQDNVLLNRSIIDISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGA
3cmvH           ALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLA
3b60A           YTLASLRNQVALVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGV
3dmdC           -----------------SDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLI
2bifA           ----------------VGQYRRDMVKTYKSFEFFLPDNEEGLKIRKQCALAALNDVRKFLSEEGGHVAVF
2dwpA           -------------------YRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVF
1bifA           -------------------YRRDMVKTYKSFEFFLPDNEEGLKIRKQCALAALNDVRKFLSEEGGHVAVF
2d3wB           EDRAGEG-IFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKLKMPEDLLTRSVNV
2c03B           -----------------ADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILV
3cmvG           HALDPIYARKLGVDIDNLLCSQPDTGEQALEICD-----ALARSGAVDVIVVDSVAALTPKAEIEGLAAR
3c95A           ILRENPQVREKVVAIFAESDNVDAQLYNGFFSDKIVLETEPRNLPALDITFVDKRIEKLLFNYRARNFPG
3eiuA           AMEEAQYFMSDFEKTGALERALTAAEYLAYEHGMHVLVILTDITNYAEALRQMGPGYMYTDLATLYERAG
2c61B           TNEEAQYFMSDFEKTGALERAVVFLNLAYEHGMHVLVILTDITNYAEALRQMGYPGYMYTDLATLYERAG
1d1cA           QILQANPILEAFGNAKTTRNNNSSRFGKFIEIQFNNAGFISGASIQSYLLEKSRVVFQSETERNYHI-FY
3dmdB           -----------------SDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLI
2b8wA           GPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSVS
1aroP           -------------------------DFSDIELAAI------PFNTLADHYGERLAREQLALHESYEMGEA
3cmvC           ALDPIYARKLGV-DIDNLLCSQPDTGEQALEICDALA-----RSGAVDVIVVDSVAALTPKAEIEGLAAR
1e69A           AYVELVF--EENGEEDFYSIVGQGQIDRIVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQKLS
2ccgA           VP-----------TGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLA
2ccgB           VPTGEEIR-----------KIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLA
2b8tA           DTRSIRNITGTSLPSVEVESAPEILNYDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKG
2akaB           VLQLVNSTAEFLHCKGKEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGD
3czpB           EEERAQPYLWRFWRHIPARRQFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYGIIVVKFWL
2czvA           AILLSNPKPSLVRDTVQKFKSYLIYVESEKGVDAIISPWVNRKDPGIDHVLAKLMVKKNVALGFSLRPLL
3cmvA           ALDPIYA---------RKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIGLA
2a2zD           NVQSTNVLQEKPERWSFTFQTYACLSRIRAQLASLNEKPVLFFERSVYSDRYIFASNLYESECMNETEWT
2bbsA           ---------------RISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLI
3dm5A           ---------------VCSDTWRPGAYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFKSKGVDIIIV
2bc9A           --------------HTKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYN
3b85A           VEAGEKLGFLPGDPYLRPLHDALRDVEPEVIPKLEAGIVEVAPLAYRGRTLNDAFVILDEAQNTTPAQKF
1e9cA           RSTEIGKLLSSYLQKKSDVEDHSVH------LLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGA
2c04A           -----------------ADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILV
2a5gA           NVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQD
2ccjB           VPTGEEIRKIVLEGNDM-DIRTEAMLFAASRRE----------HLVLKVIPALKEGKVVLCDRYIDSSLA
2c61A           AMGITNEE---AQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGMHVLVILTD
1e98A           RSTEIGKLLSSYLQKKSDVEDH------SVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGA
2c03A           -----------------ADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILV
3b2qA           AMGITNEEAQYFMSDFEKTGALERAVVFLNLA--DDPAVERIVTPRMALTAAEYLAYEHGMHVLVILTDI
2b8tB           LPSVEVESAPEILN-----YIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKG
3dt2A           KFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKT-IQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTIT
2awnD           NDTPPAERGVGMVEPSVFLLDEPLSNL--DAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIV
1cr4A           -------------AMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDS
3eiuB           AVVFLNLADDIVTPRMALTAAEYLAYEHGMHVLVILTDITNYAEALRQMGAAGYPGYMYTDLATLYERAG
2axzC           ----------------IYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPY
1e9fA           RSTEIGKLLSSYLQKKSDVEDHSVH------LLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGA
3dhwC           TTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPS
2cckA           --------------PGGVPTGEEIRKIVLEDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYID
4dcgA           ILNGLRDVTLVIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPAQWIKDF
2ctsA           FRGYSIPECQKMLPKAKGGEEPLPEGL--FWLLVTGQIPTEEQVSWLSKEWAKRAALPSHVVTMLDNFPT
2c9yA           VASGSELGKKLKATMDAGKLVSDEMVVEIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDS
3d3kA           SCGRHLANHDVQVIL----FLPNFVKMLESITNELSLFSKTQGQQVSSLKDLPTSPVDLVINCLDCPENV
2awnB           NDTPP-----AERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPK
1e0jA           ES--------VEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRL
3bh0A           -----LEMGKKENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNINIFDKAGQSVNYIW
3dt4A           KFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQK-NTIFTNVAETSDGGVYWEGIDEPLAPGVTIT
1e2dA           RSTEIGKLLSSYLQKKSDVEDHSV-----HLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAK
2d62A           DPEKGV---FVPPKERDVAVFQSYALYPHTVYDNIAFPLKLRKVPKQEIDKRVREVAELGLTELLNRKPR
1dkiA           SN------NPYFNHPKNLFAAISTRQYN--WNNILPTYSGRESNVQKMAISELMADVGISVDMDYGPSSG
3a1wA           EGVFTYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKV
3b2qB           NEEAQYF--MSDFEKTGALERAVVFAYEHGMHVLVILTDITNYAEALRQMGRGYPGYMYTDLATLYERAG
2awnC           ----------------SYALYPHLSVAENMSFGLKLA----GAKKEVINQRVNQVAEVLQLAHLLDRKPK
1e9rA           DMLSKFGRKDIILNPYDQRTKGWSFFNEIRNDYDWQ------RYALSVVPRGKTDEAEEWASYGRLLLRE
2cgtH           VAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRG
1e9dA           RSTEIGKLLSSYLQKKSDVEDH------SVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGA
2a30B           NVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWT
1bg0A           PKQWGDINTLVGLDPAGQFIISTRVRCGRSLQGYPFNPCLTAEQYKEMEEKVSSTLSSMEELKGTYYPLT
2a30D           NVQSTNVLQMMYEKPERWSFTFQTYACLRAQLASLNGKPVLFFERSVYSDRYIFASNLYESECMNETEWT
2bdtA           PWESDELLALTWKNITDLTVNFLLAQNDVVLDYIAFPDEAEALAQTVQAKVDDVEIRFIILWTNREELLR
3bb1F           VMVSRSRAGFTLNIIDTPGLIEGGYINDMAIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSF
1dg3A           KPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYTELTHRIRSKSDSA
3czpA           EEERAQPYLWRFWRHIPRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYGIIVVKWL
2d4hA           MWCVPHPKKPGHILVLLDTGDVENQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSK
1e3aB           NPKVYNPQSGYIANWNNSLWGGADRVTEIDRLLEQKPRLTADQAWDVIRQTSRQDLNLRLFLPTLQAATS
3d7wA           ---------------SYFLSDAPAGAETQDFSGTTSSSQPFNGSYPDLERYAGHRDQIPLGIDQLIQSVT
2d4hB           NDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSDSADFVSFFPDFVWTLRDFSLDL
2dr3A           HPVQVRQNMAQFGWDVKPYEEKGFAMVDAFTAGIGKEYEKYIVHDL------------------------
2a2zA           NVQSTNV--LQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKEKPVLFFERSVYSDRYIFASNLYE---
3cr7C           NIRFGLNKDGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPDPKGLYKK
2a2zB           NVQSTNVLQMMYEKPERWSFTFQTYAIRAQLASLNGEKPVLFFERSVYSDRYIFASNLYESECMNETEWT
1e0jB           ESVE--------ETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRL
2b8tC           RTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKG
3bb1B           MVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIVLLYVDRLDAYRVDNLDKLVAKAITDSF
2d4uA           LQTRNTLNIRYMMDQNNIGSGSTVAELMESASISLKQA---EKNWADYEALPRDPRQSTAAAAEIKRNYD
2cjwB           TIILLDMWENHDHMQVGDAYLIVYSITDRAS---FEKASELRIQLRRARQTEDIPIILVGNKSDLVRREV
1e9sF           DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR------------------------YALSVVPR
1e9sD           DM--------LSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYAL----------------SVVPR
1dhjA           ------------------------------------IAALAVDRVIGMENAMPWNLPASLAWFKRNTLDK
3bo6B           GDKFHIS-VQREQVPQAFQALSGLLFSVDSPIDKWKVTDMERVDQQSRVAVGAQFTLYVKPDQENSQYSA
1e3mA           RHPVVEQVLPFIANP---LNLSPQRR---LIITGPNGGKSTYRQTALIALAYIGSYVPAQKVEIGPIDRI
3bb1C           VMVSRSRAGFTLNIIDTPGLIEYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSF
3cmxA           ALDPIYAKLGVDIDNLLCSQPDTGEAVDVIVVDSVA-ALTPKAEARMMSQAMRKLAGNLKQSNTLLIFIN
2axpA           SGNEKLFEHNKLADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHALRVRGDE
421pA           KQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAISFEDIHQYREQIKRVKDSDDVPMVLVG
3dtbB           KFDAQGN-LRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTIT
1e9sG           DMFGRDKDIILNPY----DQRTKGWSFFNEIRND-------------------YDWQR----YALSVVPR
2bkiA           VEANPLLEAFGNAKTVRNNNSSRFG--KFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYR
1d6jB           IRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATPGEETGLPFV
3cmtD           IYARK---LGVDIDNLLCSQPDRSGAVDVIVVDSVAALTPKAEMGLAARQAMRKLAGNLKQSNTLLIFIN
2bbtB           -------------GRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGI
2d3wA           RAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNV
2cckB           EEIRKIVLEGDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRAL
2d0kA           ------------------------------------IAALAVDRVIGNENALPWNLPADLAWFKRNTLNK
2d2eA           NILELSPDERARKGLFLAFQYPVVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDESYLSR
1b0uA           NLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMVLGLSKHDARERALKYLAKVGIDERAQGKYPV
2a5jA           IDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGN
3cddD           QACTVDGERVITGYVDDWVPSYDESTITISVSGRDKTADLVDCSIQTLTQIADIVCKPFGIKVIVNTDVG
3dt7A           KFDAQGNLRAI-NPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTIT
2b8wB           GIWM-----WCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQ
2a30A           MMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWT
2bbsB           ------------GRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGGI
2b92B           GIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKS
1e9rE           DMLSKFGRDKDILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKT----------------------
2akaA           LEQQILQANPILEAFGNTTRNNNSSRFGKFIEIQFNSAGFISGASQSYLLEKSRVVFQSETERNYHIFYQ
1e2fA           RSTEIGKLLSSYLQKKSDVEDHS------VHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGA
2dr3B           HPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGEK---------------------------YIVHD
3cddF           RIQIEQGETPHELLARLAKQRGVLLTSDTFGNLVITRASKTKAGVSLILGDNVKAARGRFSWRQRFSKFT
3bczC           CGSCAAHAYKQVPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGFERSLQTD
3cmvE           AL-DPIYARKLGVDIDNLLCSQPDTGEQALEICDALA-----RSGAVDVIVVDSVAALTPKAEIEGLAAR
1cr2A           --------------MLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHYDSF
2bkhA           VEANPLLEAFGNA---KTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLEKSRICVQGKEERNYHIFYR
3cddC           GQACTGGERVITGYVDDWVPSYDESTITRDKTADLVDCSIDYPSGQTLTQIADIVCKPFGIKVIVNTDVG
1cr0A           -------------AMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDS
2awoC           --------MNDTPPAERGVGMVALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPK
2d2fA           SPDERARKGLFLAFQYPVEVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDESYLSRYLNE
1e9sJ           DMLS--------KFGRDKDIILNPYDQRTKGWSFFNEI-----RNDYDWQRY-----------ALSVVPR
3c8uA           ------------PDGFHLDNRLLEPRGLLPRKGAPETFDFEGFQRLCHALKHQER----VIYPLFDRARD
2bx2L           ------------PFLIHQESNVIVRAFRDYLRQDIGEI---LIDNPKVLELARQHIAALGRPDFSSKITG
2d3wD           LSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMLLKMPEDLLTRSVNV
1e3mB           TEGRHP-VVEQVLNEPFIANPLNLSPQRRLIITGPNGGKSTYRQTALIALAYIGSVPAQKVEIGPIDRIF
2ck3C           CIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASD---------------------------AAPLQ
3dymA           ------------------------------GNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDN
3bgwD           -----LEMGKKENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNINIFDKAGQSVNYIW
3bgwA           -----------LEMGKKENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNINIFDKAGQ
3cr7A           GLNKDLGFSEADRNENIRRIAEV---AKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPDPKGLYKK
3d31A           -----KDVTDLSPEKHDIAFVYQNYSLFPHMNVKKNLEFGMRMKKIKDPKRVLDTARDLKIEHLLDRNPL
1dhiA           ------------------------------------------------ENAMPWNLPASLAWFKRNTLDK
2c9oC           YSTEIKKTEVLMENFRRAIGLRIKETKKKEIIQDVTLHDLDVAGEINKVVNKYIDQGIAELVPGVLFVDE
1e9rD           DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKT---------------------
1e9sB           FGRDKD---IILNPYDQRTKGWSFFNEIRNDYDW-------QRYALSVVPRGKTDEAEEWASYGRLLLRE
2bv7A           ------------------ATLALMWLKRGLRFIQVFLQSICDGERDENHPNLIRVNATK-----AYEMAL
1e2gA           RSTEIGKLLSSYLQ--KKSDVEDHSVHLLFSANRWEQV----PLIKEKLSQGVTLVVDRYAFSGVAFTGA
1ai4B           LPFNSPQKDYPASDLFAFLWGGADRVTEIDRLLEQKPRLTADQAWDVIRQTSRQDLNLRLFLPTLQAATS
1e6cA           SGMTVADVPGFRRRESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPAEELLQASLQAHQ
2bwjA           SESERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGD----TRGFLIDGYPREVKQGEEFGRRIGDPQL
3bb1A           VMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFL----LDKTIDVLLYVDRLDAYRVDNLDITDSF
2c0bL           ---------PFLIHQ---ESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRPDFSSKIKLYTG
2dr3E           RQNMAQ--FGWDVKPYEEKGMFAMVDAFTAGIGKEYEK---------------------------YIVHD
2dflA           ---------KAVYIDTEGTFRWERIENMAKALGLDIDNVMNNIYYIRAINTD-------HQIAIVDDLQE
3da4A           KDIIKSGVVGTFPVSTKFTHITLKTEGTLTISANGSWTYNGVVRSYDDKYDFNASTHRGIIGESLTRLGA
3dt4C           KFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKT-IQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTIT
3bk7A           ----------------LTVAYKPQYIKAEYEGTVYELLSKIDSSKLNSNFYKTELLKPLGIIDLYDRNVE
3adkA           -EVSSGSARGKMLSEIMEKGQLVPLETVLDMLRDAMVAKVDTSKGFLIDGYPREVKQGEEFERKIGQPTL
3czjA           -----------------------------LGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRADNDI
1cfrA           FINDEAIRLGGKISDGSFEWLIGIRAIEVVKMPNATSFDVMSIYKSCLSEFIYDLRSKLSL-----NNVN
3ch4B           KEQYAQENFQYKEAFRKDMIRWGEEKRQADPGFFCRKQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVA
3cr7D           GLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVAEETGLRDPKGLYKK
5dfrA           ------------------------------------------AALAVDRVIGPWNLPADLAWFKRNTLDK
3dfqA           -----------------------------------------------------------------HSHPA
2awnA           NDTPPAERGVGMVFQSYALEVINQRVNQVAEVLAIGRTLVAEPSV-------------------------
3dfoD           -----------------------------------------------------------------HSHPA
1cr1A           --------------MLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDS
1drbA           ------------------------------------IAALAVDRVIGMENAMPWNLPACLAWFKRNTLDK
2bhjA           KATSCLGSLTRGPRDKPTPLEELLP--HAIEFINQYYGSFKEAKIEEHLARLEAVTKEIETTGTYQLTLD
3dfnC           -----------------------------------------------------------------HSHPA
1eilA           ---------------------------------------------ERLGYLGFAVKDVPAWDHFLTKSVG
2d3wC           PEDRAGEGIFMAFQYPVEIPGVSNQFFALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNV
3dfnA           -----------------------------------------------------------------HSHPA
3bb1E           VSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSF
1aldA           -----------------------------------------------------------------YQYPA
2dr3F           QVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKSKEYEKYIVHDL------------------------
2eg5G           FPNDFNSVFKLPSFYRKLEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCLPSGLVTEIGTNKG
3dftD           -----------------------------------------------------------------HSHPA
2dr3D           HPVQVRQNMAQFGWDVK-PYEEKGMFAMVDAFTAGIGKSKEYEK---------------------YIVHD
6aldA           -----------------------------------------------------------------HSHPA
3dfqD           -----------------------------------------------------------------HSHPA
2bjbA           ---------DQARGRPIAPLLDALRELGVAVDGTGLPFRVRGNGSAGGTVAIDASASSQFVSGLLLS--A
1e4yA           ---------------------RAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLD
1draA           ------------------------------------------------ENAMPWNLPAELAWFKRNTLDK
2drcA           -----------------------------------------------MENAMPFNLPADLAWFKRNTLDK
3cm0A           VARGTPLGVRPIMER---GDLVPDDLILELIREELAERVIFDGRTLAQAEALDRLLSETGT-----RLLG
3b55A           ---------------------------------------------------NTNQIAKWLEAHAKPLKTT
3d3qB           DIGTAKVTTEEEGIPHYIDILPPDASFSAYEFKKR-AEKYIKDITRRGKVPIIAGGTGLYIQSLLYNEDK
2dr3C           TIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGEYEKYIVHD
2boeX           ------------------------------------------------RDRIASVPQGTWFAHHNPGQ--
1bmfC           IGQKR---STVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAP-------------------------
3clvA           TLCNIKFDIWDTAGQERYASIVP-----LYYRGATCAIVVFDISNSNTLDRAKTWVNQLKISSNYIIILV
3d1mA           --------------------------------------------------PLAYKQFIPNVAEKTLGASG
2awoA           NDTPPAER-----GVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPK
1cjaA           NNSDRLPWTNEGNLDNIMLSERGATVVPIDSKIIPLDASHPHGERVRELLRLIAHPGHESSQFHSIRDII
3bjdB           AVHATSRQIDSAA-SKLAALAEAGLKGDRQAYAAYQQLLYVLSLSDDVATATRRWLARAIYRVEERFPAA
3dfpC           -----------------------------------------------------------------HSHPA
2cvfA           ERLVQMAETRGLNPEEALSRFILFTPSDFKEQRRVIGSLKKTVDSNFALVVVDSITAHYRAEENRSGLIA
3ecpA           RTARLV--------------------NVAAQLAKYSGKSI-TISSEGSKAAQEGAYRFIRNPN--VSAEA
1e59A           YTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPE
3dftC           -----------------------------------------------------------------HSHPA
3dfpD           -----------------------------------------------------------------HSHPA
3dfnD           -----------------------------------------------------------------HSHPA
2c4rL           AIKKAARPAPFLIH--QESNVIVRAFRDYLRQDIG-EILIDNPKVLELARQHIAALGRPDFSSKIKLYTG
2ahvA           PLAQEGLVKWALCGHWGQSPRISDLAEQNKIIAYNYPQGVLTQTLRAAAAHQPGIISDIGIGTFVDPRQQ
2aumA           ---------------------QPIDRVALIAPASA--------IATEVLEATLRQLEVHGVDRHVEARYR
1e9sI           DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR------------------------YALSVVPR
3d3qA           TAKVTTEEEGIPHYIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGIQSLLYNYAFEISEDKKQV
2a1fF           ----------------------------------------------------------------------
3dauA           ------------------------------------------------ENAMPWNLPADLAWFKRNTLNK
3cueF           LDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGN
1e9rG           LSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLAL
3cr7B           NIRFGLNKDGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVETGLPFVEVYVD
1d6jA           NIRFGL------------NKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHE
2aunB           -------------------------------------------IATEVLEATLRQLEVHGVGRHVEARYR
3cioD           RRGYSHNLFTVSNEHGLSEKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLV
3dm9B           FR------AGAIEQLEEHAKRIGVKVI---------KHSYGADPAAVAYDAIQHAKAR-------GIDVV
1accA           ---------------TEFDFNFDQQTSQNIKNQL----------AELNATNIYTVLDKIKLNAKMNILIR
4atjA           -------------------------AFGNANSAR--GFPVIDRMKAAVESACPRTVSCADLLTIAAQQSV
2ausC           ------------------------------------KAETNPKWGFPPDKRPIELHIQYGVINL-DKPPG
2d7vA           EKHHLAHENCFIANSVETEVVTEI----------------------------------------------
3bb1G           VMVSRSRAGFTLNIIDTPGLIEGGYINDMALNISFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSF
2an9A           QPRP------GEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQ
1adoA           -----------------------------------------------------------------HSHPA
2bofX           NDPRTPVIRDRIASVPQGTWFAHHN---------PGQITGQVDALMSAAQAAGKIPILVVSNAPGRDCGA
2c9gA           ----------------------------------------------------------------------
1e9rF           KFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLL-----LRETAKK
2czvB           VRDTVQKFKSYLIYVESNDRVIRYSIEKGVDAIISPWVN--RKDPGIDHVLAKLMVKKNVALGFSLRPLL
1ak2A           VASGSELGKKLKATMDAGKLVSEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDS
3cbnA           VTAGHRTT-FEVTV----DPEIGET--ADCIIGVSSSDSISTLPDEKRAIARESLVRVNGYDEIRGYGHP
1e9sL           FGRDKDII--LNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALI
2d7vB           EKHHLAHENCFIANSVETEVVTEI----------------------------------------------
1e9sM           DMSKFGRDKDIILN--PYDQRTKGWSFFNEIRNDYDW----QRYALSVVPRGKTDEAEEWASYGRLLLRE
3bwdD           AGEDYN----RLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQF
1afrA           TLDGVRDETGASPTSWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSG-MDPRTENSP
3c15C           NLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVM--------------------------------
2dpyB           KDFIENILGPDGRARSVVIAAPA--DVSPLLRMQGAAYATRIAEDFRDRGQHV-LLIMDSLTRYAQREIA
1cs4C           ETIVAAM--SNLVPPVELANPENQF--RVDYILSVMNV--------------------------------
3bv4A           ----------------------------------------------------------------------
2c7cH           -----------------------------VGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRG
1e9sH           DMSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPR-------------------------
1bglA           ----------------------------------------------------------------------
3a00A           ---------TRTPRAGEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNY---YGSTVASVKQVSKSGKT
3cnlA           ----NGVKILDTPGILYKNIFSEDLAAKLLLVGSLPVERIERAFEIFARSIGIESSFSEFFEDFARKRGL
3dfqC           -----------------------------------------------------------------HSHPA
3cmvB           AL--------DPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIGLAA
1culC           ETIVAA--MSNLVP--PVELANPENQFRVDYILSVMNV--------------------------------
1e2iB           ---------------TYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLA
2bkeA           -----------------GKAVYIDTEGTFRWERIENAKALGLDIDNVNNIYYIRAINTDHQIAIVDDLQE
2aumB           ---------------------QPIDRVALIAPAS--------AIATEVLEATLRQLEVHGVDRHVEARYR
1akeA           VKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIP---QADAMKEAGINVDY
1e2iA           TTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGPPPALTLIFDRHPIAALLCYPAA
3bpbA           PGAESRRGETEIIEETVQRFYPGKVERIEAPGTV-----------EAGDIMMVGDHFYIGESARTNAEGA
3dffA           AQAAQDGAVLVYTVFAGAAQPPYSPAAQRHTIW---GLAPDDDAVLYRRKEDIAALDHLRVAHRHGRFDS
1e2kA           -----------------RVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAP
3dfoC           -----------------------------------------------------------------HSHPA
3dvlD           -----------VTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPEGQEVVGGFDLSALIERINY
2anbA           QPRP------GEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQ
3be4A           IKNGIGLEAKSIIEGNFVGDEIVLGLVKEKFDLGVCVNGFVLDGFPRTIPQAEGLAKILSEIGDSLTSVI
1dw9A           DSILLLQIPLRGCIDDRIPTDPTYRFYELQVYGTTLKALEKFGDGIISAINFKLDVKKVADPEGGERAVI
1dekA           LAYAWGVFAANTDYPLTRKEFEGIDYDRETNLNLIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNK
3ec1A           TTLDMIEIPLESGATLYDTPGIINHHQMAHFVDARDLKI--ITPKREIHPRVYQLNEGQTLFFGGLARLD
1dekB           --------LAYAWGVFAANTDYPLTRKE--------------FEGIDYDRETNLNLTKLEVITIMEQAFC
1c9kC           KDGRPA---HWRTARHLDTLITADLAPDDAILLECITTMVTNLLFALGDPE-------------QWDYAA
2bbtA           ------------GRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGGI
2ancF           DIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDD
1e9sE           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
1cjtC           VAAMSN--LVPPVE--------------------------------------------------------
2ahwD           PLAQEGLVKWALCGHWGQSPRISDLAEQNKIIAYNYPQGVLTQTLRAAAAHQPGIISDIGIGTFVDPRQQ
2a1fD           ----------------------------------------------------------------------
2awoD           NDTPPAERGVGMVEPSVFLLLRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGK
2b8tD           RTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKG
1ek0A           TQRVTINEIWDTAGQERFASLAPYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDIIIALVGNKI
3dlbB           YRILCEMSLEAWLAQGHPLPKRVRNAYDRRTWELLRLGEEDPKEL------------PLPGGLSLLDYHA
1av6A           RHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKII----LISDVRSPSTADLLSNYALQNVMISILN
3d1mB           -------------------------------------------------TPLAYKQFIPNVAEKTLGASG
3bb1H           VMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFL--------------------------------
3a00B           PRAGEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQV---------------SKSGKT
2dpyA           KDFIENILGPDGRARSVVIAAPADV--SPLLRMQGAAYATRIAEDFRDRGQ-HVLLIMDSLTRYAQREIA
3do6A           TLGLKGGATG------------------------------------------------------------
3c7kA           LAAIVRAMLGVEYGDKERKTDSKMVCDVVSRMEDTEPF--------------------------------
3dyoA           -------------------SEMDFCIELGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDI
1e2kB           --SRDDIVYVPEPMTYWRV-LGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLA
3e8aC           KNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILS--------------------------------
3cmuA           ALDPYARKLGVDIDNLLCSQPDTGE---------------------------------------------
2dftA           TGRSIADIGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGN
3crmA           GMDIGTAKPSRELLARYPHRLIDIRDPASYSAAE-------FRADALAAMAKATARGRIPLLVGGTMLYY
2ccjA           ----------GVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLA
2a1fE           ----------------------------------------------------------------------
1azsC           NLKEA--IETIVAAMSNLVPPVELANPENQFRVDYILSV-------------------------------
1e4vA           VKSGSELGKQAKDIMDAGKLVT----DELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVD
3b9qA           FRAAASDQLEIWAERTGCEIVVAEKAKAATVLSKAVKRGKEEGYDV----------VLCDTSGRLHTNYS
3cmwC           PIYARK--LGVDIDNLLCSQPDTGE---------------------------------------------
1dp0A           ------------------------------KRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDI
1dyhA           -----------------------------------------------MENAMPWNLPADLAWFKRNTLDK
1e2nA           WR-VLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLI
1e9rB           ----------------------------------------------------------------------
2e85B           ------------------------------------------------------------CAAAPKGNWV
2bhvD           --------LLRTITADKMIP--AFLITPISSQI---AGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSN
3di4A           THVTTGERLYLRPATIIEDTLGWYGIDQYGGSVHDVIGTRCDPYTGNLLAGGHYHHCCHSNLTRALADHT
2dftC           TGRSIADIFATDGEQEIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGG
1e9sA           ----------------------------------------------------------------------
2bhvA           --------LLRTITADKMI--PAFLITPISSQI---AGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSN
3cphA           DINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVG
3brwA           ------------------SCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRLIVTFDEHVISNNFKFG
2d4uB           -------------------------VAELMESASI-SLKQAEKNWADYEALPRDPRQSTAAAAEIKRNYD
2cbzA           YVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRT------------EIGEKGVN
2ancD           --HTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQ
4dfrA           -----------------------------------------------MENAMPWNLPADLAWFKRNTLDK
3cnnA           LDTPGILYKNIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIFARSIGI---ESSFSEFFEDFARKRGL
1e1qB           ----------------------------------------------------------------------
1eamA           RH----------HDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTDLLSNYALQNVM
1ckvA           DEISEL--LGRQFNV---YDFLVDVSSTIGRAYT------------------------------------
3dm5B           WRPGAYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFKSKG---------------------VDIII
2ancB           QPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQV------LATGVDVFLDIDWQ
1dvrA           IAKGTQLGKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILVGFPRTIPQAEKL-DQMLKEQGTPLEK
3c14C           ----------------------------------------------------------------------
1d8jA           -------------------------------------LSGSSGYKFGVLAKIVNYMKTRHQRGDTLDETQ
3bb1D           VMVSRSRALNIIDTPGLIEGGYINDMALNIIKVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIV
3b85B           VEAGE-----KLGFLPDPYLRPLHDALRDVEPEVIPKL----EAGIVEVAPLAYRGRTLNDAFVILDEAQ
3ed8A           QNTPIGDGPVLLPD--------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
3cqcA           -------------------FKHMNSVPQKPALIPQPTFTEKVAHEHKEKKYEMDFGIWKGHLDALTADVK
1cjuC           NLKEAITIVAAMSNLVPPVELANPENQFRVDYILSVMN--------------------------------
1e2hB           ASETIANIYTTQHRLDAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALL
3dfdA           KELREA--YKTEDPVEVAKRVLSVG---------------------------------------------
2a5vA           APSV-----LLGRRDGL---SRVDEEQRHVH---ETVAILMARSSAISERIAGGSLAIVGV---------
3cddA           ----------ITGYVDDWVPSYDESTITISVSGRLVDCSIDYPSGQTLTQIADIVCKPFGIKVIVNTDVG
2aexA           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
1cjvC           KEAIET-IVAAMSNLVPPVELANPENQFRVDYILSVMN--------------------------------
2b0lC           ----------------------------------------------------------------------
2ax4B           VRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIHESAGL---------
2bboA           FCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKD-------------NIVLGEGGI
2a5vB           APSV-----LLGRRDG---LSRVDEEQRHVH---ETVAILMARSSAISERIAGGSLAIVGV---------
3dmdA           ----------------------------------------------------------------------
1d6aA           KVLNLQETWGKISTADAKNGVLPKP-----------LELVDASGAKWIVLRVDEIKPDVALLNYVGGSC-
1e2lA           ETIANIFTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLI--FDRHP
1e2mA           ASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGM-----PYAVTDAVLAPHIGGE-----------
2e85A           -----------------------------------------GNSMMGDDGAGPLLAEK--CAAAPKGNWV
1e2lB           ---TYWRVLGASETIANIFTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPA
2cdnA           IEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDID
2ax4A           VRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIHESAGL---------
3e70C           FRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARG--------------------IDVVLI
1e2jB           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
1e2hA           ASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGM--------------------------------
1e2mB           GASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAIFDRHPIAALLCYPAARYLMG
2bwjD           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
1e2nB           ETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAA
2bhvC           --------------------------------------------ESDIFAHMGKAVLIPKGSKVIGYYSN
1d2zD           ES--------------------------------------------------------------------
1bccF           IRKWYYNAA--GFNKYGLMRDDTIY--ENDDVKEAIR----RLPENLYDDRMFRIKRALDLNMRQQILP-
2aqwA           ----------------------------ATELKIEQNNEFIGFVVGSNAFEEKIIRNKFPDSYILSPGIG
1e2jA           ASETIANIYTTQHRLDQGEISAGDAAVVMTSANITMGMPYVTDAVLAPHIGGEAGSPPPALTLIFDRHPI
1dwmA           ----------------------------------------------------------------------
3cddE           GQACTVDIGGERVITGYVDDWVPESTITISVSGRDKTADLVDCSIDYPNNQTLTQIADIVCKPFGIKVIV
2a78A           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
1ckeA           AALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLR
3dkvA           AAMKEETPLGLESYIDKGELVPDEVTIGIVRERKSDCERGFLLDGFPRTVAQAEALE-------------
2bsqE           ----------------------IRNLSEATHNAIKFRARAAGRSTEAERLILDNIAKAQQTVRLGSMLGQ
2bwjF           ESERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIG---------
3c85A           DELRARY--GKISLGIEIREEAAQQHRSEGRNVISGDATDPDFWERILDTGHVKLVLLAPHHQGNQTALE
1chdA           ----------------------------------------------------------------------
3bm2B           -----------------------------------------RAGRAPDWHFFVIEGEGRERFSAVLEQGA
3c5vA           VKNP----EDLSAETMAKDVGNVVEAMYGDLPPPIMLIG-------------------------------
3e3xA           ----------------------------------------------------------------------
2c95B           SEVSSGSARGKKLSEIMEKGQLVPLET----VLDMLRDAMVAKVNTSKGFLIDEVQQGEEFERRIGQPTL


                         +         .         .         .         .         *         .:210
query           ALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDE
2dwoA           DATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCY
3b5jA           GLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKIC-KGRTVIIIAHRLSTV-KNADR
3cmvH           ARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAA
3b60A           LLSGGQRQRIAIARALLRDSPILILDEATSA-LDTESERAIQAALDELQKNRTSLVIAHRLSTI-EQADE
3dmdC           DTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFEAVKIDGIILTKLDADARGGAAL
2bifA           DATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECY
2dwpA           DATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCY
1bifA           DATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECY
2d3wB           GFSGGEKKRNDILQMAVLEPELCILDESDSLDI-DALKVVADGVNSLRDGKRSFIIVTHYRILDYIKPDY
2c03B           DTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKGVTGLVLTKLDGDARGGAAL
3cmvG           MMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAKEGENVVGSETRVKVVKNKIAAPFK
3c95A           TLDYAEQQRWLEHRRQVFTP--EFLQGYADELQMLVQQYKVALLKALWQYADEIV---------------
3eiuA           IVKGAKGSVTQIPILSMPGDDITHPIPDLSGYIT---EGQIVVARELH--RKGIYPPINVLPSLSRLMNS
2c61B           IVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELHRKG----IYPPINVLPSLS-RLMNS
1d1cA           QLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKIT--RQAMDIVGFSQEEQMSIFKIIAG
3dmdB           DTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAKIDGIILTKLDADARGGAAL
2b8wA           FFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRCIRKFFPKKKCFVFDRPVHR
1aroP           RFRKMFERQLLITTLLPKMIARINDWFEEVKAKRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNT
3cmvC           MMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGESETRVKVVKNKIAAPFKQAE
1e69A           LLSGGEKALVGLALLFAKPSPFYVLDEVDSPLDDYNAERFKRLLKENS-KHTQFIVITHNKIVM-EAADL
2ccgA           YQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQE
2ccgB           YQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNLDQEDLKFHEKVIEQEIIHNESQR
2b8tA           EPFGPIAKLFTYADKITKLTAICNECGAEAT------HSLRKIDGKHADYNDDIVKIGCQEF-YSAVCRH
2akaB           QPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDAR
3czpB           AIDKQTQER-FKEREKTPYKRYKITEEDWRNRDKWDQ--YVDAVGDV-DRTSTEIAPWTLVEANDKRFAR
2czvA           YSNPYERANLLWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVVI---GMEIPQAKASIS---MYPEI
3cmvA           ARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAA
2a2zD           IYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHREQGIPLEYLEKLHYKESWLLHRTLKTNFDYLQEVP
2bbsA           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKI
3dm5A           DTAGRHKEDKALIEEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEAPIGSIIVTKLDGSAKGGGAL
2bc9A           SIGTINQQAMDQLYYVTELTHRIRSKSDFVSFFPDFVWTLRDFSLDLEADPDEYLTYSLKLKKGTSQKDE
3b85A           LTRLGFGSKVVTGDGLRL-VRHILRGVDDVHFSELTSSDVVRLVGHIVDA--------------------
1e9cA           KENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAK---RGAFGHERYENGAFQERAL-RCFHQLMKDTTLN
2c04A           DTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKGVTGLVLTKLDGDARGGAAL
2a5gA           LPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTS------------------------
2ccjB           YQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNNRLDQEDLKFHEKVIEGYQEIIQR
2c61A           ITNYAEALRMGAARNEVPGRRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSG
1e98A           KENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAF----QERALRCFHQLMKDTTLN
2c03A           DTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARADEKVGVTGLVLTKLDGDARGGAAL
3b2qA           TNYAEALRQMGAARNEVP---GRRGYPGYMYTDLATLYERAGIVKGAK-GSVTQIPILSMPGDDITHPIP
2b8tB           EPFGPIAKLFTYADKITKLTAICNECGAEATHS-------LRKIDGKHADYNDDIVKIGCQEFYSAVCRH
3dt2A           SWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIRPAGVPLVYEALSWQHGVFVGTA
2awnD           VLDAGRVAQVGKPLELYHYPADRFVAPKMNFLPVKVTATAIDQVQVELPMPRQQVWLPVESRDVQVGANM
1cr4A           FAEAETLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLK--GFAKSTGVVLVVICHLKDLLRQLSDT
3eiuB           IVKGAKGSVTQIPILSMPGDDITHPIPDLSGYIT----EGQIVVARELHRKGIYPP-INVLPSLSRLMNS
2axzC           EEVSSIIKPYPIVDSFGKDYDLTIQTVLKNALTISINRNLKEAQYYINQFKNISINGYYDL-EINYLKQI
1e9fA           KENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRYAFQERALRCFHQLLNWKMVDASKSIEAVHEDIRV
3dhwC           NLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDNRRLGLTILLITHEMDVVKRICDC
2cckA           SSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSEDLKFHEKVIEGYQEIIRF
4dcgA           YIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKNKIVRNKVVVNFDY----PNQEY
2ctsA           NLHPMSQLSAAITALNSESNFARAYAEGIH----------------------------------------
2c9yA           VIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRR-SDDNEKALKIRLQAYHTQ
3d3kA           FLRDQPWYKAAVAWANQNRAPVLSIDPPV-HIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVGI
2awnB           ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHDQVEAMTLADK
1e0jA           LAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGAKSTGVVLVVICHLKNPDKGKAHE
3bh0A           SKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDLMARELDVVVIALSQLSRQVEQRQDK
3dt4A           SWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIRPAGVPLVYEALSWQHGVFVGTA
1e2dA           ENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQER-----ALRCFHQLMKDTTLN
2d62A           ELSGGQRQRVALGRAIIRRPKVF-LDEPLSNLDAKLRVKRAELKKLQRQLGVTTIYVTHD---QVEATGD
1dkiA           SAGSSRVQRALKENFGYNQSVHQINRGDFSKQDWE------AQIDKELSQNQPVYYQGVGKVG-----GH
3a1wA           ILAMTAIDEAKKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEY-----------------------
3b2qB           IVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELHRK-----GIYPPINVLPSLSRLMNS
2awnC           ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLKRLGRTMIYVTHDQVEAMTLADK
1e9rA           TAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEAS----------------------
2cgtH           YLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGPLLIIAEDVEGEALATLVVNTMRG
1e9dA           KENFSLDWCKQPDVGLPKPDLVLFLQLQLADAA---KRGAFGHERYENGAFQERAL-RCFHQLMKDTTLN
2a30B           IYQDWHDWMNNQFGQSLELDGIIYLQATYLRGRNEEQGIPLEYLEKLHYKESWLLHRTLKTNFDYLQEVP
1bg0A           GMSKATQQQLIDDHFLFKEGDRFLQTANACRYWPTGRGIFHNDAKTFNEEDHLSMQKGGDLKTVYKRLVT
2a30D           IYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHREQGIPLEYLEKLHYKESWLLHRTLKTNFDYLQEVP
2bdtA           RDALRKKGERCLEL--VEEFESKGIDERYFYNTSHLQPTNLNDIVKNLKTNPRFI---------------
3bb1F           GKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASL-KKDIPVVLIENSGRCNKNDSDE-
1dg3A           DFVSFFPDFVWTLRDFSLDLQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLIRKFFPKKKCF--------
3czpA           AIDKQTQER-FKEREKTPYKRYKITEEDWRNRDKWDQDAVGDVDRTSTEIAPWTLVEANDKRFARVKVLR
2d4hA           SSPDESADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTCIRKFFPKKKCFVFDRPVHR
1e3aB           GLTQSDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAAVPMPFDKWYSASGYET
3d7wA           ALRFPGGQTKTQARSILI--LIQMISEAARFNPINSGASFLPDLELETSWGQQSTQVQHSTDGVFNNPIA
2d4hB           EADGQPLTPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYSNSKTKTLSGG
2dr3A           -TDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMIILQLKRVLAGTGCTSIFVSQVSGGVEHGVDG
2a2zA           -SECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGNEEQGIPLEYLEKLHYKHE
3cr7C           AREGVIKEFTGISA-PYEAPANPEVHVKNYELP--VQDAVKQIIDYLDTKG-------------------
2a2zB           IYQDWHDWMNNQFGQSLELDGIIYLQATYLRGRNEEQGIPLEYLEKLHYKESWLLHRTLKTNFDYLQEVP
1e0jB           LAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGAKSTGVVLVVICHLKNPDKGKAHE
2b8tC           EPFGPIAKLFTYADKITKLTAICNECGAEATHS-------LRKIDGKHADYNDDIVKIGCQEFYSAVCRH
3bb1B           GKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLASDIPVVLIENSGRCNSDEKVLPN
2d4uA           IYHNALAELIQLLGAGKINE---FFDQPTQGYQDGFEKQYVAYMEQNDRLHDIAVSDNN-----------
2cjwB           SVSEGRAAVVFDCKFIETSAAVQHNVKE-------------------LFEGIVRQVRLRRDSKE-KNERR
1e9sF           GKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGSLFAGSNEASKALTSAR
1e9sD           GKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFTLAESLFAGSNEASKALTSA
1dhjA           PVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAGDVPEIMVIGGGRVYEQFLPKAQK
3bo6B           SSLHNTRQFIECLESRLSESGLMPGQYPESDVHPENWKYVSYRNELRSGRDGGEMQSLREE----PFYR-
1e3mA           FTRVGFVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACAEANKIKALTLFATHYFELTQLPEKE
3bb1C           GKGIWNKAIVALTHAQFSPPDGLPYDEFFSK-RSEALLQVVRSGASLKSDIPVVLIENSGRCNK-NDSDE
3cmxA           QIRNPETTTGGNALKF-YASVRLDIRRIGAVKEGENVVGSETRVKVVKNK-----IAAPFKQAEFQILYG
2axpA           YIEGKDIDSILELYREVSNAGLHTYSWDTGQWS---SDEIAKDIIFL-----------------------
421pA           NKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVRE-----------------------
3dtbB           SWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIFGGVPLVYEALSWQHGVFVGAA
1e9sG           GKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFL----EGTLAESLFAGSNEA
2bkiA           LCAGASEDIRERLHLSSPDNFRYLNRGCTRYFANKETDKQILQNR-------------------------
1d6jB           EVYVDVPVEVAEQRAPYEAPANPEVHVKNYELP--VQDAVKQIIDYLDTKG-------------------
3cmtD           QIRMKNPETTTGGNALKFYASVRLDIRRIGAVK----EGENVVGSETRVKVVKNKIAAPFKQAEFQILYG
2bbtB           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSK-MEHLKKADK
2d3wA           GFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYKPDY
2cckB           NEFAINGLYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQEIRFKSVNADQPLENVVEDTYQ
2d0kA           PVIYGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAGDVPEIFVIGGGRVYEQFLPKAQK
2d2eA           YLNEGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNARGPNFGALVITHYQRILNYIQPDK
1b0uA           HLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSH
2a5jA           KSDLESRRDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINTKEIYRKIQQGL---------------
3cddD           EIEQGETPHELLAR-LAKQRGVLLTSDTFGNLVITRASKTKAGVS--LILGDNVKAARGRF---------
3dt7A           SWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIRPAGVPLVYEALSWQHGVFVGTA
2b8wB           LYYVTELTHRIRSKSSVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSKLKKGTSQKDETFNLPRLCI
2a30A           IYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHREQGIPLEYLEKLHYKESWLLHRTLKTNFDYLQEVP
2bbsB           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKME-HLKKADK
2b92B           SFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFF----PKKKC
1e9rE           ---DEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLLFAGSNEASKALTSA
2akaA           LLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITRQAMD---IVGFSQEEQMSIFKIIAG
1e2fA           KENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAF---GHERYENGAFQERALRCFHQLMKDTTLNW
2dr3B           LTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQVLAGTGCTSIFVSQVSVGERGFGGP
3cddF           IKAAGIKADVTDSEIGRYRPLIIVNEEVTTAEGAAKRGQWERQRSIGK-SNAEYTVTGWRIPQT-GKLWN
3bczC           EDEHSIEHLPYTAKAESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFC---HWGQR
3cmvE           MMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGVKEGENVVGSETRVKVVKNKIAAPFK
1cr2A           EAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGF--AKSTGVVLVVICHLKSGALRLSDT
2bkhA           LCAGASEDIRERLHSSPDNFRYLNRGCTRYFANKETDKQILQ----------------------------
3cddC           EIEQGETPHELLARLAKQ-RGVLLTSDTFGNLVITRASKTKAGVSLIL--GDNVKAARGRFS-WRQRFSK
1cr0A           FAEAETDRLLAKLAYMRLGCDVIILDHISI--RKMIDNLMTKLKGFAKSTGVVLVVICHDLRALRQLSDT
2awoC           ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHDQVEAMTLADK
2d2fA           GFSGGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVAMRGPNFGALVITHYQRILNYIQPDK
1e9sJ           GKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGGTLAESLFAGSNEASKALTSA
3c8uA           IAIAGAAEVGPECRVAIIEGNYLLFDAPGWRDLTAIVSIRLEVPADLEARLQRWLDHGLNHDAAVARAQG
2bx2L           EIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSARGDIEETAFNTNLEAA--DEIARQ
2d3wD           GFSGGEKKRNDILQMAVLEPELCILDESDGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDY
1e3mB           TRVGTFVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACNLANKIKALTLFATHYFELTQLPEKE
2ck3C           YLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGR-EAYPGDVFYLHSRLLERAAKN
3dymA           DIGVSEATRIDPNAWVWKAAGHYQAEAALLQCTADTLADAVLITTAHWQHQGKTLFISRKTYRIDGSGQM
3bgwD           SKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDLKKRELDVVVIALSQLSRQVEQRQDK
3bgwA           SVNYIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQIRELDVVVIALSQLSRQVEQRQDK
3cr7A           AREGVIKEFGISAPYEAPANPEVHVKNYELPVQDAVK----QIIDYLDTKGYL--PA-------------
3d31A           TLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKKLTVLHITHDQTEARIMADR
1dhiA           PVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPIMVIGGGRVYEQFLPKAQK
2c9oC           VHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQ
1e9rD           ---DEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFTLAESLFAGSNEASKALTSA
1e9sB           TAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKATSARFVLSDKLPEHVTMPDG
2bv7A           KKYHGWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKVRLFLVNYTATIDVIYEMYTRMNAEL-
1e2gA           KENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGERYENGAF--------QERALRCFHQLMKDTTLN
1ai4B           GLTQSDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAAVPMPFDKWYSASGYET
1e6cA           RPTLTGRPIAEEMEAVLREREALYQDVAHYVVDQPPAAIVCELMQTMR----------------------
2bwjA           VICMDCSADTMTNRLLQMSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKINFLQLCTAIDS
3bb1A           GKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQ-VVRSGASLKSDIPVVLIENSGRCNKNDS-DE
2c0bL           EIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDITNLEAADEIARQLRLRDLGGVIDFIDM
2dr3E           LTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSQLKRVLAGTGCTFVSQVSVGPGVEHGVDG
2dflA           LVSKDPSIKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLTRLAEVDIAVIITNQVMHTLYHVPGI
3da4A           MFSGKEYQILLPGEIHIK----------------------------------------------------
3dt4C           SWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPEGVPIEGIIFGGRRPAGVPLVYEALSW---------
3bk7A           DLSGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKEKTALVVEHDVLMIDYVSDR
3adkA           LLYVDAGPETMTKRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGVDDVFSQ
3czjA           GVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAAWQHQGKTLFISRKTYRIDGSGQM
1cfrA           LITSNPDFSIIDIRGRREELKSMLKDISFSNISLSTISEIDNLYKNFIDYELEHIKSFLSVKTTFRPDRR
3ch4B           LEQSRQQRGWVFTPGVDDAESECGLDNFG--------------------DFDWVIENHGVEQRLEEQLEN
3cr7D           AREGVIKEFTGISA-PYEAPANPEVHVKNYELP--VQDAVKQIIDYLDTKGYL--PA-------------
5dfrA           PVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVEAIAACGDVPEIMVIGGGRVYEQFLPKAQK
3dfqA           LTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
2awnA           ----------------------FLLDEPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHDQVEAMTLADK
3dfoD           LTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
1cr1A           FAEAETDRLLAKLAYMRSGCDVIILDHISI--RKMIDNLMTKLKGFAKSTGVVLVVICHLKGALRQLSDT
1drbA           PVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAGDVPEIMVIGGGRVYEQFLPKAQK
2bhjA           ELIFATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYANNGNIRSAITVFPQRSDGKH
3dfnC           LTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
1eilA           LMAAGSAGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDDALERMADKLRQAGVAFTRGD--EALMQQR
2d3wC           GFSGGEKKRNDILQMAVLEPELCILDESDDIDALKVVADGVNSLRDGKRSFIIVTH-YQRIL-DYIKPDY
3dfnA           LTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
3bb1E           GKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKASDIPVVLIENSGRCNKNDSDE
1aldA           LTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
2dr3F           -TDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPASIILQLKRVLAGTGCTSIFVSQVSGFVEHGVDG
2eg5G           SIYSSKASRLPVQKAYLDQFTKDFTTFLRIHSEELFSHGRMLLTCICK----------------------
3dftD           LTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
2dr3D           LTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPASIILQLKRVLAGTGCTSIFVSQVSVGERGFGGP
6aldA           LTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
3dfqD           LTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
2bjbA           ASFTDGLTVQHTGSSLPSAPHIAMTAAMLRQAGVDIDDSTPNRWQVRPGPAARRWDIEPDLTNAVAFLSA
1e4yA           GFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVY--HVKFNPPKVEGKDDVTGEE
1draA           PVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVEIMVIGGGRVYEQFLPKAQK
2drcA           PVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAGDVPEIMVIGGGRVYEQFLPKAQK
3cm0A           VVLVEVPEEELVRRILRRAGRSDDNEETVRRRLEVYREKTEPLVGYYEARVLKRVDGLGTPDEVYARIRA
3b55A           NPTASLNDL--KPLKNVGSASIVGLGEATHGAH-EVFTKHRIVKYLVSEKGFTNLVLEEGWDRALELDR-
3d3qB           KQVKLKLKEEHLNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYENYDTLLIGIESRETLYLRINKR
2dr3C           LTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILRVLAGTGCTSIFVSQVSGVEHGVDGI
2boeX           -ITGQVDALMSAAQAAGKIPILVVSNAPGRDCGSAYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQH
1bmfC           ----YSGCSMGEYFRDNGKHALIIYDDLSKQAV-AYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM
3clvA           ANKIDKNFQVDILEVQKYAQDNNLLFIQTSAKTGTNIKNIFYMLAEEIYKN-------------------
3d1mA           RYEGKITRNSERFKELNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISGVKLRVTEGWDEDGHHSEES
2awoA           ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHDQVEAMTLADK
1cjaA           TLYTGYDVG--TEGSISMQEGFLATVRECASFDLDAFERELQKCHNLSISPQAIPFILRMLR--------
3bjdB           DLSRALEQEIAAQSRERHPSQYFSGSASRAQLQVFLRHQWFRTFRLYRDAA-DLLVNLTDVDEAAALARY
3dfpC           LTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
2cvfA           ELSRQKHNIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILRLDKLPKPGRVAVLERHRFRPEGLMAYF
3ecpA           IRKAGAMQTVKLAQEFPE----LLAIEDTTS-LSYRHQVAEELGKLGSIQDKSRGWWVHSVLLLEATTFR
1e59A           LTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNSLR-ALVKY
3dftC           LTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
3dfpD           LTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
3dfnD           LTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
2c4rL           EIPLFSHYQIESQIESAFQSGGSIVIDSTEALTAIDINSARGDIEETFNTNLEAADEIARQLRLRDLGGL
2ahvA           GGKLNEVTKEDLIKLVEFDNKEYLYYKAIAPDIAFIRATTCDSEGYATFEDEVMYLDALVIAQAVHNNGG
2aumA           YLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADISV-----LLS
1e9sI           GKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGF----LEGTLAESLFAGSNEA
3d3qA           KLKLKEEYLASFDKESAKDIHPNNRKRVLRAIEKKLLSSRKKVQQFTENYDTLLIGIESRETLYLRINKR
2a1fF           --SQPIYKRILLKL-----SGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLA
3dauA           PVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVEIMVIGGGRVYEQFLPKAQK
3cueF           KCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMS-----------------
1e9rG           IGTPSMRELFHW----------------------------------------------------------
3cr7B           AEQRDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQDVKQIIDYLDTKG-----------
1d6jA           VATPGEETGLPFVEVYVDVPVEAPYEAPANPNYELPVQDAVQIIDYLDTKG-------------------
2aunB           YLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDI-----SVLLS
3cioD           IVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIK---------
3dm9B           LIDTAGRSETNRNLDEKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAKIDGIILTKLDADARGGAAL
1accA           FHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEV------INDR
4atjA           TLAGGPSWRVPLGRRDSLDLANANLPAPFFTLPQLKDSFRNVGLNRSSDLVALSGGHTFGKNQCRFIMDR
2ausC           PTSHEVVAWIKRILNLEKAGHGGTLDPKVSGVLPVALERATRVVQALLPAGKEYVALMHLHGDVPEDKIR
2d7vA           ----------------------------------------------------------------------
3bb1G           GKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRS---EALLQVVRSGASLSDIPVVLIENSGRCN-KNDSD
2an9A           GAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQSHYAEYDYLIVNDDFDTALTDLKT
1adoA           LTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
2bofX           PSHSAYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQEVLETMAYAGKALKAGSSQARIYFDAGH
2c9gA           ----------------------------------------------------------------------
1e9rF           LALIGTPSMRELFHWTTIATFDDLRGFL--------EGTLAESLFAGSNEAS------------------
2czvB           YSNPYERANLLWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVVI---GMEIPQAKASI---------
1ak2A           VIEFSIPDSLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEPRRSDDNKKALKIRLEAYHTQTTP
3cbnA           ELTLDHPTDIVCRKSDYICSRTLIRADKAAFDLD---ENLVRDLR-----KGRELKVEIIV---------
1e9sL           GTPSMRELFHWTTIATFDDLRGFL----------------------------------------------
2d7vB           ----------------------------------------------------------------------
1e9sM           TAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSD----------
3bwdD           FIDHAVPITTVQGEELKKLIGAPAYIECSSKSQENVKGVFDAAIRVVL----------------------
1afrA           YLGFIYTSFQERATFISHGNTARQAKEHGDIKLAQICGTI------AADEKRHETAYTKIVEKLFEIDPD
3c15C           ----------------------------------------------------------------------
2dpyB           LAIGEPPATKGYPPSVFAKLPA-LVERAGNGIHGGGSITAFTVLTEGDD---------------------
1cs4C           ----------------------------------------------------------------------
3bv4A           -TPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
2c7cH           YLSPYFINKPETGAVELESPFILLADKKISNIRMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRG
1e9sH           ----------------------------------------------------------------------
1bglA           -VSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQQGKTLFISRKTYRIDGSGQM
3a00A           CILDIDMQGVKSVKAIPELNARFLFIAPPSVTGAHDKVIVNDDLDKAY-KELKDFIFAE-----------
3cnlA           LKKGGVPDIERALMLFFTEVGRVSFERP------------------------------------------
3dfqC           LTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
3cmvB           RMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGE-NVVGSETRVKVVKNKIAA
1culC           ----------------------------------------------------------------------
1e2iB           PHIGGEAHAPPPALTLIFDRHPILLCYPAARYLMGSMTAVLAFVALIPPTLPGTNIVLGAL---------
2bkeA           LVSKDPSIKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLTRLAEVDIAVIITNQVVP---GIRIQ
2aumB           YLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADISV-----LLS
1akeA           VLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKTAPLIGYYSKEAEAGNTK
1e2iA           RYLMGSMTPQAVLAFVALIPPTLPGTNIVAKRQRPGERLDLAMLAAIRRVYGLLANTVRYLQCGGSWRED
3bpbA           RQMIAILEKHGLSGSVVRLEKVLGLKTGLAYLEHNNLLAAGEFVSKPEFQDFNIIEIPEEE----SYAAN
3dffA           IYRKLPDGRWLTAHVEGRQKLAVNDHSPDSDHDLVGEV-ADDIRSIIDEFDPTLVVTCAAIG---EHPDH
1e2kA           HIGGEAGPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLG---------
3dfoC           LTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
3dvlD           AIQKYRARRVSIDS--------VTSVFQQYDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIAR-
2anbA           GAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAMSHYAEYDYLIVNDDFDTALTDLKT
3be4A           YFESGRCTHPASGRIYHVKYNPPKQPGIDDVTGEPLVWRDDDNAEAVKVRDVFHKQTAPLVKFYEDLGI-
1dw9A           TLDGK-----------------------------------------------------------------
1dekA           ITDVINNIEDQWSVRRLMQALGTDLIVNN-----------------------------------------
3ec1A           YIKGGRRSFVCYMANELTVHRTKL-EKADSLYANQLGELLSPPSKRYAAE--FPPLVPRSLSVKERKTDI
1dekB           YLNGKSPIKGVFVF-DDEGKESVNFVAFNKITDVINNIEDQWSVRRMQALGTDLIVNNFDRMYWVKLFAL
1c9kC           MERAIDDEIQILIAACQRCPAKVVLVTNEVGMGIVPENRLARHFRDIAGRVNQRLA---------AAADE
2bbtA           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKME-HLKKADK
2ancF           FDTALTDLKTIRAERLRMSRQKQRHDALISKLL-------------------------------------
1e9sE           ----------------------------------------------------------------------
2a1fC           --SQPIYKRILLKL-----SGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLA
1cjtC           ----------------------------------------------------------------------
2ahwD           GGKLNEVTKEDLIKLVEFDNKEYLYYKAIAPDIAFIRATTCDSEGYATFEDEVMYLDALV----------
2a1fD           --SQPIYKRILLKLS-----GEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLA
2awoD           PLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQ------VELPMPNRQQVWLPVESRDVQVGANM
2b8tD           EPFGPIAKLFTYADKITKLTAICNECGAEATHSLRKIDGK------HADYNDDIVKIGCQEF-YSAVCRH
1ek0A           DLQEGGERKVAREEG-------------------------------------------------------
3dlbB           SKGRLQGREGGRVAWVAD---PKDPRKPIPHLTGLLVPVGSLALSLPWEERRRTREIASWIGRRLGLGTP
1av6A           PVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMLTRVTKSDAVNYEKKMYYL
3d1mB           RYEGKITRNSERFKTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALMNQWPGVKLRVTEGWDEDGHHSE
3bb1H           ----------------------------------------------------------------------
3a00B           CILDIDMQGVKSVKAIPELNARFLFIAPPSGAH--DKVIVNDDLDKAYKELKDFIF-AE-----------
2dpyA           LAIGEPPA--------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
3dyoA           GVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQQGKTLFISRKTYRIDGSGQM
1e2kB           PHIGGEAHAPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAF-----------------------
3e8aC           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
2dftA           DRAEKYRALMAKRAPLYRRVATMRVDTNRRNPG-AVVRHILSRL--------------------------
3crmA           KALLEGLPYTVAQLAIAPEQRQVLHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLPSI----RAVGYR
2ccjA           YQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIKNSNRLDQEDLKFHEKVIEGYQEIIHR
2a1fE           --SQPIYKRILLKLS-----GEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLA
1azsC           ----------------------------------------------------------------------
1e4vA           YVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVRLVEYHQMTAPLIGYYSKEAEAGNTK
3b9qA           LMEELIACKKAVGKIVSGAPNEILLVLDG----NTGLNMLPQAREFNEVVGITGLILTKLDGSARGGCVV
3cmwC           ----------------------------------------------------------------------
1dp0A           GVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQQGKTLFISRKTYRIDGSGQM
1dyhA           PVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAGDVPEIMVIGGGRVYEQFLPKAQK
1e2nA           FDRHPIAALLCYPAARYLMGSMTPQAVL------------------------------------------
1e9rB           ----------------------------------------------------------------------
2e85B           VIDGGSAPENDIVARELRPTRLLIVDATDMGLNPGEIRII-----DPDDIAEMFMMTTHNM-PLNYLIDQ
2bhvD           NNKMGYRLDIVWSRIITPHGINIMLTNGYNGLVGELIERNFQRYGVPFGDYLLMQLMRQSGMGINQVV--
3di4A           GLPLHEAELVHDVLNVFCTGFQYFKASPVRPGDYLEFFAEIDLLGNLSACPGGDCSSEA----SCHPLLV
2dftC           DRAEKYRALMAKRAPLYRRVATMRVDTNRRNPG-AVVRHILSRL--------------------------
1e9sA           ----------------------------------------------------------------------
2bhvA           NNKGEYRLDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYG------VPLLLSTLTLIGITSAFGD
3cphA           NKSDMETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSNKLVGVG---------
3brwA           VIYQKLGATSEEELFSTNEE-SPAFVEFLEFLGQKVKLQDFKGFRGGGQTGTESVYCNFRN-------KE
2d4uB           IYHNALAELIQLLGAGKINE---FFDQPTQGYQ-DGFVAYMEQNDRLHDIA-------------------
2cbzA           LSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDV
2ancD           GAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQSHYAEYDYLIVNDDFDTALTDLKT
4dfrA           PVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAGDVPEIMVIGGGRVYEQFLPKAQK
3cnnA           LKKGGVPDIERALMLFFTEVARVSFERP------------------------------------------
1e1qB           ----------------------------------------------------------------------
1eamA           ISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSMRLLSIYTGENMRLTRVTKSDAVNYAKK
1ckvA           ----------------------------------------------------------------------
3dm5B           VDTAGRHKEDKALIEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEATPIGIIVTKLDGSAKGGGAL
2ancB           GAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAMSHYAEYDYLIVNDDFDTALTDLKT
1dvrA           AIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQISKRLAAYHAQTEVDFYKKT
3c14C           ----------------------------------------------------------------------
1d8jA           HLDIGLKQKWLMTEALVNNPKIEVIDGKYAFKPKYNVR--------------------------------
3bb1D           ALLQVVRSGASLKKDAASDIPVVLIENSGRCNDEKVLPNGIAWIPHLV-QTITEVALNKSE---------
3b85B           NTTPAQKFL----TRLGFGSKVVTGDSGLRLVRHILRGVDDVHFSELTSSVVRHQLVGHIV---------
3ed8A           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
3cqcA           EKMYNVLLFVDGGWMVDVREDAKEDHERTHQMVLLRKLCLPMLCFLLHTI----LHSTGQYQECLQLADM
1cjuC           ----------------------------------------------------------------------
1e2hB           CYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRDLAMLAAIRRV---------
3dfdA           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3cddA           EIEQGETPHELLAR-LAKQRGVLLTSDTFGNLKAGVSLILGDNVKAARGRSWRQRFSKFTIAAKADVTDS
2aexA           -----------------EEDELAHRCSSFMAPPVTDLGELRRRPGDMAQVCQALAQVDGGANFSVDRWER
2axnA           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2b0lC           -------------------AVVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIADRVIVNALRKLES
2ax4B           ----------------------------------------------------------------------
2bboA           TLSEGQQAKISLARAVYKDADLYLLDSPF-GYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADK
2a5vB           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
1e2lA           IAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALIDRLAKRQRPGERLDLAMLAAIRRVYG
1e2mA           -AGSPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALP----------
2e85A           VIDGGSAPENDIVARELRPTRLLIVDATDMGLNPGEIRI-----IDPDDIAEMFMMTTHNMPLNYLIDQL
1e2lB           LTLIFDRHP--IAALLCYPAARYLMG----SMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKR
2cdnA           AVLEFRVSEEVLLERLKGRGRADDTDDVILNRMK-VYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALR
2ax4A           ----------------------------------------------------------------------
3e70C           DTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQNEAVKIDGIILTKLDADARGGAAL
1e2jB           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1e2mB           SMTPQAVLAALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLAMLAAIRRVYGLLANTVRYLQCG--GSWR
2bwjD           ----------------------------------------------------------------------
3bjqB           -------------------VDPILSTHARGYRQSTLIGKKLFPVAPVAQYGGKILTFGKEAFRLYNTKRN
1e2nB           LLCYAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKLDLAMLAAIRRVYGLLANTVRYLQCGGSWRED
2bhvC           NNKMEYRLDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRY------GVPLLLST------------
1d2zD           ----------------------------------------------------------------------
1bccF           --KEQWTKYEEDVPYLEPYLKEVI----------------------------------------------
2aqwA           AQNGDLYKTLKNGYNKDYEKLLINVGRAITKSPDPKKESYYNQIIQIFKD--------------------
1e2jA           AALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDR--------------------
1dwmA           -----------------------------------SGNMAAATVERENRNVHAIVLKEGSAMTKDFRCDR
3cddE           NTDVGEPFQELLARLAKQ-RGVLLTSDT----FGNLVITRASKTKAGVSLILGDNVKAARGRFSWRQRFS
2a78A           ----------------------------------------------------------------------
3ci2A           -----------------------------------SVEEAKKVILQDKPEAQIIVLPVGTIVTMEYRIDR
1ckeA           RQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQVKGVNFERLLAEI---------
3dkvA           ----------------------------------------------------------------------
2bsqE           EIGGVELED-------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3c85A           QLQRRNYKGQIAAIAEYDQLEGLLESGVDAAFN-IYSEAGSGFARHVCKQLE------------------
1chdA           ---------------------LIAIGASTGGTE-----AIRHVLQPLPLSSPAIITQHMPPGFTRSFAER
3bm2B           IAAGSDDKAIDKARNAPFRAPLIITVVAKVPRWEQESAGCA-VAQAAVAQGFGGIWRSGALTESPVVREA
3c5vA           ----------------------------------------------------------------------
3e3xA           -------------------------TSPFAGEGFVTSRNILERLEKELVHNVALRVEQFRVSGRGELHLS
2c95B           LLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLEYKATEPVIAFYEKRGIVRKAEGSVDSVFSQVCT


                         .         .         .         +         .         .         .:280
query           AILLHRRVLAHGSPDRVLVPELMLRAFGLEEPA
2dwoA           EASYQPLD-------------------------
3b5jA           IIVMEKKIVEQGKHKELL---------------
3cmvH           PFKQAEQILYGEGINFYGELVDLGVKEK-----
3b60A           IVVVEDGIIVRGTHSELLVYAQLHKMFG-----
3dmdC           SISYVIAPILFVGVGQGYEKEWFLERI------
2bifA           EN-------------------------------
2dwpA           -EASYQPLDPDKCDR------------------
1bifA           ENSYES---------------------------
2d3wB           VHVLYQRIVKSGDFTLVK---------------
2c03B           SARHTGKPIYFAGVSEKP---------------
3cmvG           QAEFQIYGEGINFYGELV---------------
3c95A           ---------------------------------
3eiuA           GIGAGKTREDHKAV-------------------
2c61B           GIGAGKREDHKAVSDQMY---------------
1d1cA           ILHLGNKFEKGAGEGAVL---------------
3dmdB           SISYVIAPILFVGVGQGY---------------
2b8wA           RKLAQLKLQDEELDPEFVQQVADFCSYIFSNS-
1aroP           TVQAVA---------------------------
3cmvC           FQILYGGINFYGELVDLG---------------
1e69A           LHGV---TMVNG---------------------
2ccgA           IIHNESSVNADQPLENVV---------------
2ccgB           FKSVNAQPLEVEDTYQTI---------------
2b8tA           HHKVPNRPYLNSNSEEFI---------------
2akaB           DVLENKLLPLRRGYIGVV---------------
3czpB           VKVLRTIN-------------------------
2czvA           IL-------------------------------
3cmvA           PFKQAEFQILYGEGINFY---------------
2a2zD           ILTLDV---------------------------
2bbsA           LILHEGSSYFYGTFSELQNLRPDFSSKLMSFD-
3dm5A           SAVAATAPIKFIGTGEK----------------
2bc9A           TFNLPRLCIRK----------------------
3b85A           ---------------------------------
1e9cA           WKMVDAKSIEAVHED------------------
2c04A           SARHGKPIYFAGVSEKPEGLE------------
2a5gA           ---------------------------------
2ccjB           FKSVNAQPLENVVED------------------
2c61A           YITEGQIVVARELHRKG----------------
1e98A           WKMVDAKRIEAVHEEIRVLSEDAIRTATEKPLG
2c03A           SARHGKPIYFAGVSEKPEGLERLAGRI------
3b2qA           DLSGY----------------------------
2b8tB           HHKVPNRPYLNSNSEEF----------------
3dt2A           AAEHKGKVIMHDPFAMRPNFGKYLAHW------
2awnD           SLGIRPHLLPSDIADVILEGEVQVVEQLGNET-
1cr4A           IIALERQLVLVRILKCRFTGDT-----------
3eiuB           GIGAGKTREDH----------------------
2axzC           YQFLLNAVNIINIFKIIG---------------
1e9fA           LSEDAIATATEKPLGELW---------------
3dhwC           VAVISNELIEQDTVSEV----------------
2cckA           KSVNAPLENVVEDTYQTI---------------
4dcgA           DYFHMYFMLRTVYCNKTFAKVLFLQQSIFRF--
2ctsA           ---------------------------------
2c9yA           TTPLIEYYRKRGIHSAIDASQTPDVVF------
3d3kA           NYHSPFGCKFVI---------------------
2awnB           IVVLDARVAQVGKPLELY---------------
1e0jA           EGRPVSITDLRGSGDTIIA--------------
3bh0A           RPMLSDGQLEQDADIIEFLYRDDYYDKESESK-
3dt4A           AAEHKGKVIMHDPFAMRP---------------
1e2dA           WKMVDAKSIEAVHEDIRV---------------
2d62A           RIAVNKELQQVGTPDEVY---------------
1dkiA           AFVIDGADGRNFYHV------------------
3a1wA           ---------------------------------
3b2qB           GIGAGK---------------------------
2awnC           IVVLDARVAQVGKPLELY---------------
1e9rA           ---------------------------------
2cgtH           IVKVAAKAPGFGDRRKAMLQDIATLTGG-----
1e9dA           WKMVDAKSIEAVHED------------------
2a30B           IL-----TLDVNEYESL----------------
1bg0A           AVDNIEKLPFSHDDRFGFLTF------------
2a30D           IL-----TLDVNEYESL----------------
2bdtA           ---------------------------------
3bb1F           KVLPNGIAWIPHLVQTITEVALKSESIFVDKN-
1dg3A           ---------------------------------
3czpA           TIN------------------------------
2d4hA           RKLAQLEKLQDEELD------------------
1e3aB           TQDGPTSLNISVGAKIL----------------
3d7wA           LAIAPGVIVTLTNIRDVI---------------
2d4hB           IQVNGPLESLVLTYVNAI---------------
2dr3A           IIRLDLEIDGELKRSLIV---------------
2a2zA           SWLLLKTNFDYLQEVPILT--------------
3cr7C           ---------------------------------
2a2zB           ILTLD----------------------------
1e0jB           EGRPVSITDLRGSGDTIIALE------------
2b8tC           HHKVPNRPYLNSNSEEFIK--------------
3bb1B           GI-----AWIPHLVQTITEVALNKSE-------
2d4uA           ---------------------------------
2cjwB           LAYQKR---------------------------
1e9sF           FVLSDKLPEHVTMPDGD----------------
1e9sD           FVLSDKLPEHVT---------------------
1dhjA           LYLTHIAEVEGDTHFPDYEPDDWESVSSEF---
3bo6B           ---------------------------------
1e3mA           GVANVHDALEHGDTIAF----------------
3bb1C           KVLPNGIAWIPHLVQTITVALNKSESIFVDKN-
3cmxA           EGINFYELVDLGVKEKLIEKAGAWYSYKGE---
2axpA           ---------------------------------
421pA           ---------------------------------
3dtbB           MRSEAKVIMHDPFAMRPF---------------
1e9sG           SKALTSARFVLS---------------------
2bkiA           ---------------------------------
1d6jB           ---------------------------------
3cmtD           GINFYGELVDLGVKEKL----------------
2bbtB           ILIHEGSSYFYGTFSELQNLSKLMDSFDQFSA-
2d3wA           VHVLYQRIVKSGDFTLVK---------------
2cckB           TI-------------------------------
2d0kA           LYLTHIAEVEGDTHFPDYEPDDWESVFSEFHDA
2d2eA           VHVMMDRVVATGGPELAL---------------
1b0uA           VIFLHQKIEEEGDPEQVF---------------
2a5jA           ---------------------------------
3cddD           ---------------------------------
3dt7A           AAEHKGKVIMHDPFAMRPNFGKYLAHW------
2b8wB           RKFFPKKCFVFDRPVHRR---------------
2a30A           IL-----TLDVNEYESL----------------
2bbsB           ILILHESSYFYGTFSELQNLRDSFDQFSAER--
2b92B           FVFDR----------------------------
1e9rE           FVLSDKLPEHVTMPDG-----------------
2akaA           ILHLGNKFEKGAGEGAVL---------------
1e2fA           KMVDASKSIE-----------------------
2dr3B           GVEHDGIIRLDLDEIDGELKRSLIVWKMR----
3cddF           INTLVPVIDEIGLDEELIASILFSEDDA-----
3bczC           FRYSYYDESQGEIYRSIEH--------------
3cmvE           QAEFQIYGEGINFYGELVDLGVKEKLIEK----
1cr2A           IIALERNLVLVRILDTGIAGYMYNKETGWLEPS
2bkhA           ---------------------------------
3cddC           FTIKADAGLPTVGGIKAD---------------
1cr0A           IIALERQLVLVRILKCRFTGDTYNKETGWLEPS
2awoC           IVVLDARVAQVGKPLELY---------------
2d2fA           VHVMMDRVVATGGPELAL---------------
1e9sJ           RFVLSD---------------------------
3c8uA           NDLANAAIEAARLPADLTWP-------------
2bx2L           LRLRDLGLIVIDFIDMTP---------------
2d3wD           VHVLYQRIVKSGDFTLVK---------------
1e3mB           GVANVHDALEHGDTIAFVQDGAASKSYGLA---
2ck3C           DAFGGGSLTALPVIETQA---------------
3dymA           AITVDVEVASDTPH-------------------
3bgwD           RPMLESGQLEQDADIIEFLYRDDYYDKESE---
3bgwA           RPMLSSGQLEQDADIIEFLYRDDYYDKESES--
3cr7A           ---------------------------------
3d31A           IAVVMD---------------------------
1dhiA           LYLTHIAEVEGDTHFPDYEPDDWESVFSEFHDA
2c9oC           IIKIRAQTEGINISEEAL---------------
1e9rD           RFVLSDLPEHVTMPDGDF---------------
1e9sB           ---------------------------------
2bv7A           ---------------------------------
1e2gA           WKMVDAKSIEAVHED------------------
1ai4B           TQDGPTSLNISVGAK------------------
1e6cA           ---------------------------------
2bwjA           IFL------------------------------
3bb1A           KVLPNGIAWIPHLVQTITVALNKSESIFVDKN-
2c0bL           TPVRHQRAVENRLREAVRQD-------------
2dr3E           IIRLDLEIDGELKRSLIV---------------
2dflA           RIQLKK---------------------------
3da4A           ---------------------------------
3dt4C           ---------------------------------
3bk7A           LIVFEGEPGRHGRALPPMGMREGMNRF------
3adkA           VC-------------------------------
3czjA           AITVDVEVASDTPHPARIGLNCQLAQV------
1cfrA           LQLAHEGSLMK----------------------
3ch4B           LIEFIR---------------------------
3cr7D           ---------------------------------
5dfrA           LYLTHIAEVEGDTHFPDYEPDDWESVFSEF---
3dfqA           ILFHETQKADDGRP-------------------
2awnA           IVVLDARVAQVGKPLELY---------------
3dfoD           ILFHETQKADDGRP-------------------
1cr1A           IIALERQLVLVRILKCRFTGDTYNKETGWLEPS
1drbA           LYLTHIAEVEGDTHFPDYEPDDWESVFSEF---
2bhjA           DFRLWNSQLIRYAGYQMPDGTIRGDAATLEF--
3dfnC           ILFHETQKADDGRP-------------------
1eilA           KVMGLLLQDPFGLPLEIY---------------
2d3wC           VHVLYQRIVKSGDFTLVK---------------
3dfnA           ILFHETQKADDGRP-------------------
3bb1E           KVLPNGIAWIPHLVQTIT---------------
1aldA           ILFHETQKADDGRP-------------------
2dr3F           IIRLDLDEIDGELKRSLIVWK------------
2eg5G           ---------------------------------
3dftD           ILFHETQKADDGRP-------------------
2dr3D           GVEHDGIIRLDLDEIDGELKRSLIVWKMRGTS-
6aldA           ILFHETQKADDGRP-------------------
3dfqD           ILFHETQKADDGRP-------------------
2bjbA           AVVSGGTVRITGWPRVSVQPA------------
1e4yA           LTTRKDQEETVRKRLVEY---------------
1draA           LYLTHIAEVEGDTHFPDYEPDDWESVFSEFHDA
2drcA           LYLTHIAEVEGDTHFPDYEPDDWESVFSEFHDA
3cm0A           AL-------------------------------
3b55A           -YVLTGKGNPSQHLTPVFKTKELDLLDWIRQ--
3d3qB           DILGHGLFNEVQHLVEQGFEASQSQAIGYKE--
2dr3C           IRLDLDEIDGELKRSLIV---------------
2boeX           VQQEVLETMAY----------------------
1bmfC           NDAGGGSLTALPVIETQA---------------
3clvA           ---------------------------------
3d1mA           -LHYEGRAVDITTSDRDRSKYGMLARLAVEAGF
2awoA           IVVLDARVAQVGKPLELY---------------
1cjaA           ---------------------------------
3bjdB           LYGELGEEDEKGSHPRL----------------
3dfpC           ILFHET---------------------------
2cvfA           RIT------------------------------
3ecpA           TVGLLHEWWMRPDDPADADEKESGKWLAAA---
1e59A           LDNMSEEILELNIPTGVPVYEFDLKRYYLGNA-
3dftC           ILFHETQKADDGRP-------------------
3dfpD           ILFHETQKADDGRP-------------------
3dfnD           ILFHET---------------------------
2c4rL           IVIDFIDMTPVRHQRAV----------------
2ahvA           IVMQKMVKKATLHPKSVRIPGYLVDIVV-----
2aumA           AFHRHGLPAIHGPVATGLGLQ------------
1e9sI           SKALTSAR-------------------------
3d3qA           VDILGHLFNEVQHLVEQGFEASQSQAIGYKE--
2a1fF           KAGMNRVGDHMGMLATVMNGLAMRDSLFR----
3dauA           LYLTHIAEVEGDTHFPDYEPDDWESVFS-----
3cueF           ---------------------------------
1e9rG           ---------------------------------
3cr7B           ---------------------------------
1d6jA           ---------------------------------
2aunB           AFHRHGLPAIHGPATGLGLEQ------------
3cioD           ---------------------------------
3dm9B           SISYVIDA-------------------------
1accA           YDMLNISLRQDGKTFIDF---------------
4atjA           LYNFSNTGLPDPTLNTTY---------------
2ausC           AVMKEFEGEIIQRTRKVYYIEILEIDGRD----
2d7vA           ---------------------------------
3bb1G           EKVLPNIAWIPHLVQTITEVAL-----------
2an9A           IIRAERRMSRQKQRHDALISKLL----------
1adoA           ILFHET---------------------------
2bofX           SAWHSPAQMASDISNSA----------------
2c9gA           ---------------------------------
1e9rF           ---------------------------------
2czvB           ---------------------------------
1ak2A           LVEYYSAIDASQTPDVV----------------
3cbnA           ---------------------------------
1e9sL           ---------------------------------
2d7vB           ---------------------------------
1e9sM           ---------------------------------
3bwdD           ---------------------------------
1afrA           GTVLAFDMMRKKISM------------------
3c15C           ---------------------------------
2dpyB           ---------------------------------
1cs4C           ---------------------------------
3bv4A           ILFHET---------------------------
2c7cH           IVKVAAKAPGFGDRRKA----------------
1e9sH           ---------------------------------
1bglA           AITVDVEVASDT---------------------
3a00A           ---------------------------------
3cnlA           ---------------------------------
3dfqC           ILFHETQKADDGRP-------------------
3cmvB           PFKQAEFQILYGEGI------------------
1culC           ---------------------------------
1e2iB           ---------------------------------
2bkeA           LKKSRGRRIARVVDAPHLEGEVVFALTGIRDA-
2aumB           AFHRHGLPAIHGPVATGLGLE------------
1akeA           YAKVDGKPVAEVRAD------------------
1e2iA           WGQL-----------------------------
3bpbA           CIWVNEVIMPAGYPR------------------
3dffA           EATRDALFATHEKNVPVR---------------
1e2kA           ---------------------------------
3dfoC           ILFHET---------------------------
3dvlD           ---------------------------------
2anbA           IIRAERRMSRQKQRHDALISKLL----------
3be4A           ----LKRVNAKLPPKEV----------------
1dw9A           ---------------------------------
1dekA           ---------------------------------
3ec1A           VFSGLGWVTCNDPGAQLVVHAPKGVDVFIRQS-
1dekB           ---------------------------------
1c9kC           VWLVSGIGVK-----------------------
2bbtA           ILILHESSYFYGTFSELQ---------------
2ancF           ---------------------------------
1e9sE           ---------------------------------
2a1fC           KAGMNRVGDHMGMLATVM---------------
1cjtC           ---------------------------------
2ahwD           ---------------------------------
2a1fD           KAGMNRVGDHMGMLATVMNGLAMRDSLFR----
2awoD           SLGIRPHLLPSDIADVILEGEVQVVEQLGNET-
2b8tD           HHKVPNPYLNSNSEEFIKFFK------------
1ek0A           ---------------------------------
3dlbB           EAVRAQ---------------------------
1av6A           NKIVRNKVVVNFDYPNQEYDYFHMY--------
3d1mB           ESLHYERAVDITTSDRDRSKYGMLARLAVEAG-
3bb1H           ---------------------------------
3a00B           ---------------------------------
2dpyA           ---------------------------------
3do6A           ---------------------------------
3c7kA           ---------------------------------
3dyoA           AITVDVEVASD----------------------
1e2kB           ---------------------------------
3e8aC           ---------------------------------
3cmuA           ---------------------------------
2dftA           ---------------------------------
3crmA           QVWDYLDGKLSYAEMTERGIIATRQL-------
2ccjA           FKSVNAQPLENVVED------------------
2a1fE           AGMNRVVGDHMGMLATVMNGLAMRDSLFR----
1azsC           ---------------------------------
1e4vA           YAKVDGKPVAEVRAD------------------
3b9qA           SVVEELIPVKFIGVGEAV---------------
3cmwC           ---------------------------------
1dp0A           AITVD----------------------------
1dyhA           LYLTHIAEVEGDTHFPDYEPD------------
1e2nA           ---------------------------------
1e9rB           ---------------------------------
2e85B           LKEDIGEVIFLGIQPDIVGFYYPMT--------
2bhvD           ----NQILRDKSKIAPIVV--------------
3di4A           EIFAPAEGLGDWPSPSVN---------------
2dftC           ---------------------------------
1e9sA           ---------------------------------
2bhvA           YLMRQSGMGINQVVNQIL---------------
3cphA           ---------------------------------
3brwA           IMFHVSTKLPYTEGDAQQL--------------
2d4uB           ---------------------------------
2cbzA           IIVMSGKISEMGSYQELLARDGAFAEFLRTYAS
2ancD           IIRAERRMSRQKQRHDALISKLL----------
4dfrA           LYLTHIAEVEGDTHFPDYEPD------------
3cnnA           ---------------------------------
1e1qB           ---------------------------------
1eamA           MYYLNIVRNKVVVNFDYPNQ-------------
1ckvA           ---------------------------------
3dm5B           SAVAATAPIKFIGTGEKI---------------
2ancB           IIRAERRMSRQKQRHDALISKLL----------
1dvrA           GI--WAGVDASQPPATV----------------
3c14C           ---------------------------------
1d8jA           ---------------------------------
3bb1D           ---------------------------------
3b85B           ---------------------------------
3ed8A           ---------------------------------
1e9sK           ---------------------------------
3cqcA           VSSERHKLYLVFSKERKLLQKLMLLDQGLDP--
1cjuC           ---------------------------------
1e2hB           ---------------------------------
3dfdA           ---------------------------------
2a5vA           ---------------------------------
3cddA           EIGRYRPLIIVN---------------------
2aexA           KEGGGG---------------------------
2axnA           ---------------------------------
1cjvC           ---------------------------------
2b0lC           AGVIESSLGMKGTYIKVLNNKFLIELE------
2ax4B           ---------------------------------
2bboA           ILILHESSYFYGTFSELQNLQPDFSSKLMSFD-
2a5vB           ---------------------------------
3dmdA           ---------------------------------
1d6aA           ---------------------------------
1e2lA           LLANTVRYLQCGGSWRE----------------
1e2mA           ---------------------------------
2e85A           EVIFLGIQPDIVGFYYPMTQPIKDAVETVYQ--
1e2lB           LDLAMLAAIRR----------------------
2cdnA           AL-------------------------------
2ax4A           ---------------------------------
3e70C           SISYVIAPILFVGVGQGY---------------
1e2jB           ---------------------------------
2bwjB           ---------------------------------
1e2hA           ---------------------------------
1e2mB           EDWGQLSGPQSNAGPRPHIGDTLFTLFRAPE--
2bwjD           ---------------------------------
3bjqB           T--------------------------------
1e2nB           WGQLSGPQ--SNAGPRPHIGDTLFTLFRAPELL
2bhvC           ---------------------------------
1d2zD           ---------------------------------
1bccF           ---------------------------------
2aqwA           ---------------------------------
1e2jA           ---------------------------------
1dwmA           VWVIVNHGVVTSVP-------------------
3cddE           KFTIKDVTDSEIGRYRPLI--------------
2a78A           ---------------------------------
3ci2A           VRLFVDLDNIAQVP-------------------
1ckeA           ---------------------------------
3dkvA           ---------------------------------
2bsqE           ---------------------------------
2bwjF           ---------------------------------
3c85A           ---------------------------------
1chdA           NKLCQISVKEAEDGERVL---------------
3bm2B           FGCREQDKLYLGTPQLVPDPTPFVTYF------
3c5vA           ---------------------------------
3e3xA           -ILIENR--------------------------
2c95B           HL-------------------------------