[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ55822.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1e2xA.bssp"
#ERROR : Can't open dsspfile "3c7jA.bssp"
#ERROR : Can't open dsspfile "3c7jB.bssp"
#ERROR : Can't open dsspfile "2di3B.bssp"
#ERROR : Can't open dsspfile "2di3A.bssp"
#ERROR : Can't open dsspfile "2b7oA.bssp"
#ERROR : Can't open dsspfile "3edpB.bssp"
#ERROR : Can't open dsspfile "3edpA.bssp"
#ERROR : Can't open dsspfile "2b7oB.bssp"
#ERROR : Can't open dsspfile "3by6D.bssp"
#ERROR : Can't open dsspfile "3bwgA.bssp"
#ERROR : Can't open dsspfile "3by6E.bssp"
#ERROR : Can't open dsspfile "3by6B.bssp"
#ERROR : Can't open dsspfile "3by6C.bssp"
#ERROR : Can't open dsspfile "3d0sB.bssp"
#ERROR : Can't open dsspfile "3by6A.bssp"
#ERROR : Can't open dsspfile "1bibA.bssp"
#ERROR : Can't open dsspfile "3eetB.bssp"
#ERROR : Can't open dsspfile "3d0sA.bssp"
#ERROR : Can't open dsspfile "2ek5B.bssp"
#ERROR : Can't open dsspfile "2ek5C.bssp"
#ERROR : Can't open dsspfile "3bwgB.bssp"
#ERROR : Can't open dsspfile "3bwgC.bssp"
#ERROR : Can't open dsspfile "2du9A.bssp"
#ERROR : Can't open dsspfile "2dk8A.bssp"

## Summary of PDB Search
:239
    9e-16  13%  1e2xA  [a.4.5 - a.78.1] FATTY ACID METABOLISM REGULATOR PROTEIN
    3e-14  16%  3c7jA  [x.x.x] TRANSCRIPTIONAL REGULATOR, GNTR FAMILY
    1e-13  18%  3c7jB  [x.x.x] TRANSCRIPTIONAL REGULATOR, GNTR FAMILY
    1e-13  18%  2di3B  [x.x.x] BACTERIAL REGULATORY PROTEINS, GNTR FAMILY
    1e-11  17%  2di3A  [x.x.x] BACTERIAL REGULATORY PROTEINS, GNTR FAMILY
    1e-10   9%  2b7oA  [x.x.x] 3-DEOXY-D-ARABINO-HEPTULOSONATE 7-PHOSPHATE
    2e-10  11%  3edpB  [x.x.x] LIN2111 PROTEIN
    2e-09  12%  3edpA  [x.x.x] LIN2111 PROTEIN
    2e-09  11%  2b7oB  [x.x.x] 3-DEOXY-D-ARABINO-HEPTULOSONATE 7-PHOSPHATE
    4e-07  17%  3by6D  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    4e-07  16%  3bwgA  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    1e-06  18%  3by6E  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    1e-06  16%  3by6B  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    3e-06  19%  3by6C  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    6e-06  19%  3d0sB  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN
    2e-05  18%  3by6A  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    3e-05  10%  1bibA  [x.x.x] BIR A[MASQUE : MEMB(X) 45 / COIL(x) 0]
    3e-05  13%  3eetB  [x.x.x] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR
    5e-05  18%  3d0sA  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN
    1e-04  18%  2ek5B  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    2e-04  18%  2ek5C  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    2e-04  17%  3bwgB  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    2e-04  16%  3bwgC  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    9e-04  18%  2du9A  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    0.001  10%  2dk8A  [x.x.x] DNA-DIRECTED RNA POLYMERASE III 39 KDA
:239

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxQVVRGELAVDXXXXXXXXXXXXXDVSRLTVREAVKVLRTKNIVRVKRGRGTYVN
1e2xA           ----------------SIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKPTKVN
3c7jA           --------------------------------------------PVREALRQLEAQSLLRVETHKGAVVA
3c7jB           ---------------------------------------GVSR-PVREALRQLEAQSLLRVETHKGAVVA
2di3B           ---------------------------------------GVSRSSLREALRVLEALGTISTATGSGPRSG
2di3A           ----------------ELRSGRLKIGDHLPSERALSETLGVSRSSLREALRVLEALGTISTATGSGPRSG
2b7oA           ---------------------------------------DNTEPHIRGNVRALLQAVVLTYGASPVVKVA
3edpB           ---------------------------------------SSSRTTIRRAVDLLVEEGLVVRKNGVGLYVQ
3edpA           ---------------------------------------SSSRTTIRRAVDLLVEEGLVVRKNGVGLYVQ
2b7oB           ---------------------------------------DNTEPHIRGNVRALLQAVVLTYGASPVVKVA
3by6D           ---------------------------------------KINPNTVAKAYKELEAQKVIRTIPGKGTFIT
3bwgA           ---------------------------------------EVSKSTITKSLELLEQKGAIFQVRGSGIFVR
3by6E           ---------------------------------------KINPNTVAKAYKELEAQKVIRTIPGKGTFIT
3by6B           ----------------EVATDVLSANDQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKGTFIT
3by6C           ---------------------------------------KINPNTVAKAYKELEAQKVIRTIPGKGTFIT
3d0sB           ---------------------------------------GASRETVNKALADFAHRGWIRLEGKSVLISD
3by6A           ---------------------------------------KINPNTVAKAYKELEAQKVIRTIPGKGTFIT
1bibA           ---------------------------------------GMSRAAINKHIQTLRDWGVDVFTVPGKGYSL
3eetB           ----------------KIVDGSLPPHTRLPSQARIREEYGVSDTVALEARKVLAEGLVETYVRERPVPRR
3d0sA           ---------------------------------------GASRETVNKALADFAHRGWIRLEGKSVLISD
2ek5B           ---------------------------------------RINPATARNGLTLLVEAGILYKKRGIGFVSA
2ek5C           ---------------------------------------RINPATARNGLTLLVEAGILYKKRGIGFVSA
3bwgB           ----------------------------------------VSKSTITKSLELLEQKGAIFQVRGSGIFVR
3bwgC           ---------------------------------------EVSKSTITKSLELLEQKGAIFQVRGSGIFVR
2du9A           ----------------SIVDGTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIGFVSA
2dk8A           ---------------------------------------HIEAQQRAVAINRLLSMGQLDLLRSNTGLL-


                         .         .         *         .         .         .         .:140
query           APEHWTDLELILRMAQRRSXXXXXXXXXXEVRRILEAGAAELCAQRRSDADLALLTTHVAEMDKAIAADD
1e2xA           NFWETSGLNILETLARLDHESVPQLI---DNLLSVRTNISTIFIRTAFRQHPDKAQEVLATANEVA--DH
3c7jA           PLITEDAVDAY------------------ALRILLESEALRLSIPLLDADDLAAAASYIEQLEVE----T
3c7jB           PLITEDAVDAY------------------ALRILLESEALRLSIPLLDADDLAAAASYIEQLEVE----T
2di3B           TIITAAPGQALSLSVTLQLVTNQVGHHDIYETRQL---LEGWAALHSSAERGDWDVAEALLEKMDDPSLP
2di3A           TIITAAPGQALSLSVTLQLVTNQVGHHDIYETRQL---LEGWAALHSSAERGDWDVAEALLEKMDDPSLP
2b7oA           RIAGQYAKPRSADIDALG---------LRSYRGDINGFAPDAAAREHDPSRLVRAYANASAA--NLVRAL
3edpB           PKLTAQNILETGVL-----------------KKDIKDFYIRKAGKFYAEIFGKENELVYSIKFVQKSEHG
3edpA           PKLTAQNILETGVKNLKK---------DIKDFYIRKAGKFYAEIFGKENELVYSIKFVQKSEH---GATL
2b7oB           RIAGQYAKPRSADIDALGL---------RSYRGDINGFAPDAAAREHDPSRLVRAYANASAANRALTSSG
3by6D           GNTASVKNSNQN-----------------RLLADLSQVIAELIKSGVKGERIKKIVNDILGG--------
3bwgA           KHKRKGYISLLSNQG--------------DFNVTSKVIELDVRKPTPEAAENLNIGDEDIYYVKRVRYIN
3by6E           GNTASVKNSNQN-----------------RLLADLSQVIAELIKSGVKGERIKKIVNDILGGKNA-----
3by6B           GNTASVKNSNQN-----------------RLLADLSQVIAELIKSGVKGERIKKIVNDI-----------
3by6C           GNTASVKNSNQN-----------------RLLADLSQVIAELIKSGVKGERIKKI---------------
3d0sB           ----------------------------------------------------------------------
3by6A           GNTASVKNSNQN-----------------RLLADLSQVIAELIKSGVKGERIKKIVNDI-----------
1bibA           PEPIQLLNAKQILGQLDG----------------------------------------------------
3eetB           VARSGYRSGATPFRQ------------EQADGAVRGTWESHSEQAEASGAIAERLDIRPGERVCTKYVFR
3d0sA           SE--------------------------------------------------------------------
2ek5B           QAPALIRERRDAA----------------FAATYVAPLIDESIHLGFTRARIHALLDQVAES--------
2ek5C           QAPALIRERRDAA----------------FAATYVAPLIDESIHLGFTRARIHALLDQVAESRGL-----
3bwgB           KHKRKGYISLLSNQDLEDF---------NVTSKVIELDVR---KPTPEAAENLNIGDEDIYYVKRVRYIN
3bwgC           KHKRKGYISLLSLE---------------DFNVTSKVIELDVRKPTPEAAENLNIGDEDIYYVKRVRYIN
2du9A           QAPALIRERRDAA----------------FAATYVAPLIDESIHLGFTRARIHALLDQVAES--------
2dk8A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ASTFARAETAFHETIVRSCGNVFIPAICAPVDRLLLHLHARTATIAHIRVRAQSHHRRILSGIAAGSPAA
1e2xA           ADAFAELDYNIFRGLAFASGNPIYGLILNGMKGLYTRIGRHYFANPEARSLALGFYHKLSALCSEGAHDQ
3c7jA           DFGQIGRLNRFHLSLYAKTHNKRLRLVEEGLNEEERFLRF--NLSSGLGKLSQDDHWQLLRLAEQKAVEP
3c7jB           DFGQIGRLNRFHLSLYAKTHNKRL-------RLVEEGLNEEERFLRFNLSSSQDDHWQLLRLAEQKAVEP
2di3B           LEDFLRFDAEFHVVISKGAENPLISTLMESVADHTVARARALPDWRATSARLQKEHRAILAALRAGESTV
2di3A           LEDFLRFDAEFHVVISKGAENPLISTLMESVADHTVARARALPDWRATSARLQKEHRAILAALRAGESTV
2b7oA           TSSGLASLHLVHDWNREFVRTSPAGARYEALATEIDRGADRNLQTAEIYASHEALVLDYERALRLSDGDD
3edpB           ARLILPLGLYPDLQAKDFQII--------NIIELVNSGKYKLFELEQELQLILAGNEQIKNHLNENDPVF
3edpA           DRLILPLGLYPDLQAKDFQII--------NIIELVNSGKYKLFELEQELQLILAGNEQIKNHLNENDPVF
2b7oB           LASLHLVHDWNREFVRTSPAGARYEALATEIDRGLRFSACGVADRNLQTAEIYASHEALVLDYERALRLS
3by6D           ----------------------------------------------------------------------
3bwgA           GQTLCYEESYYTKSIVTYLNNEIVSHSIFHYIREGLGLKIGFSDL-FLHVGQLNEEEAEYLGLEAGLPK-
3by6E           ----------------------------------------------------------------------
3by6B           ----------------------------------------------------------------------
3by6C           ----------------------------------------------------------------------
3d0sB           ----------------------------------------------------------------------
3by6A           ----------------------------------------------------------------------
1bibA           ----------------------------------------------------------------------
3eetB           DAGEVLSTSWEPLAVTGRTPVLEGPVGGGVVERAAIDVIVDNVT-EEVGARPGLAEELLTLGGVPGHV--
3d0sA           ----------------------------------------------------------------------
2ek5B           ----------------------------------------------------------------------
2ek5C           ----------------------------------------------------------------------
3bwgB           GQTLCYEESYYTKSIVTYLNNEIVSHSIFHYIREGLGLKIGFSDL-FLHVGQLNEEEAEYLGLEAGLP--
3bwgC           GQTLCYEESYYTKSIVTYLNNEIVSHSIFHYIREGLGLKIGFSDL-FLHVGQLNEEEAEYLGLEAGLP--
2du9A           ----------------------------------------------------------------------
2dk8A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ARDAMRAHFDQLAEDLLRHVVDRxxxxxx
1e2xA           VYETVRRYGHESGEIWHR-----------
3c7jA           CVEALQYHLNRGVQAVTQYLQSQ------
3c7jB           CVEALQYHLNRGVQAVTQYLQSQ------
2di3B           AATLIKEH---------------------
2di3A           AATLIKEH---------------------
2b7oA           GEPQLF-----------------------
3edpB           KLSSVFYAENDPIA---------------
3edpA           KLSSVFYAENDPIA---------------
2b7oB           DGDDGE-----------------------
3by6D           -----------------------------
3bwgA           -----------------------------
3by6E           -----------------------------
3by6B           -----------------------------
3by6C           -----------------------------
3d0sB           -----------------------------
3by6A           -----------------------------
1bibA           -----------------------------
3eetB           -----------------------------
3d0sA           -----------------------------
2ek5B           -----------------------------
2ek5C           -----------------------------
3bwgB           -----------------------------
3bwgC           -----------------------------
2du9A           -----------------------------
2dk8A           -----------------------------