[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ55880.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "1cjaA.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "2bhvA.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "1dw9A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "3ecpA.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "1e4vA.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "4atjA.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "2czvB.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "2d4uB.bssp"
#ERROR : Can't open dsspfile "2an9A.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "3c7kC.bssp"
#ERROR : Can't open dsspfile "2aunA.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "3d1mB.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "3c7kA.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "3bs4A.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "2ancB.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "3e8aC.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"
#ERROR : Can't open dsspfile "2e85A.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "3dfdA.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "2dftA.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "3cnnA.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "2dftC.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "2a5vA.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "3c85A.bssp"
#ERROR : Can't open dsspfile "2a5vB.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "3csuA.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "3bb1D.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "3b85B.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "1d2zD.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1d6aA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "3cbqA.bssp"
#ERROR : Can't open dsspfile "1chdA.bssp"
#ERROR : Can't open dsspfile "2bhvC.bssp"
#ERROR : Can't open dsspfile "2ax4B.bssp"
#ERROR : Can't open dsspfile "2ax4A.bssp"
#ERROR : Can't open dsspfile "2axnA.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "2c5mD.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "1agpA.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "2bwjB.bssp"
#ERROR : Can't open dsspfile "1e9sK.bssp"
#ERROR : Can't open dsspfile "2a78A.bssp"
#ERROR : Can't open dsspfile "1dapA.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"
#ERROR : Can't open dsspfile "2c95B.bssp"
#ERROR : Can't open dsspfile "2c9oA.bssp"
#ERROR : Can't open dsspfile "2bwjF.bssp"
#ERROR : Can't open dsspfile "3cddA.bssp"
#ERROR : Can't open dsspfile "3cr8B.bssp"
#ERROR : Can't open dsspfile "2dx7A.bssp"
#ERROR : Can't open dsspfile "3cddB.bssp"
#ERROR : Can't open dsspfile "2c9oB.bssp"
#ERROR : Can't open dsspfile "3ci2A.bssp"
#ERROR : Can't open dsspfile "3cddE.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "2ekbA.bssp"
#ERROR : Can't open dsspfile "3e70C.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "1e6vC.bssp"
#ERROR : Can't open dsspfile "2ck3A.bssp"
#ERROR : Can't open dsspfile "2bwjC.bssp"
#ERROR : Can't open dsspfile "2bsqE.bssp"
#ERROR : Can't open dsspfile "3dsrB.bssp"
#ERROR : Can't open dsspfile "1delB.bssp"

## Summary of PDB Search
:252
    6e-48  25%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-41  13%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    6e-41  19%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-39  14%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    3e-38   4%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    9e-38  11%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    1e-37  13%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    1e-37  14%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    1e-36  11%  3cmvG  [x.x.x] PROTEIN RECA
    2e-36  13%  3cmvH  [x.x.x] PROTEIN RECA
    2e-36  18%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    2e-36  11%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    2e-36  14%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    7e-36   8%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    8e-36  22%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
    8e-36   7%  2bifA  [c.37.1 - c.60.1] PROTEIN
    9e-36   8%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    1e-35  12%  1d1cA  [c.37.1 - b.34.3] MYOSIN
    2e-35  17%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    1e-34   9%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    3e-34   9%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    5e-34  11%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    5e-34  12%  1e98A  [c.37.1] THYMIDYLATE KINASE
    5e-34  12%  2akaB  [x.x.x] DYNAMIN-1
    2e-33   8%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    4e-33  12%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-32   9%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    2e-32  10%  2b8tA  [x.x.x] THYMIDINE KINASE
    6e-32   7%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    8e-32  11%  3cmvC  [x.x.x] PROTEIN RECA
    1e-31  11%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-31  12%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM
    2e-31  10%  2cgtH  [x.x.x] 60 KDA GROEL
    4e-31  14%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE
    4e-31  14%  3cmvA  [x.x.x] PROTEIN RECA
    5e-31  15%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    7e-31   9%  2cckA  [x.x.x] THYMIDYLATE KINASE
    9e-31  11%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    3e-30   8%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    4e-30   9%  2axzC  [x.x.x] PRGX
    5e-30  13%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    6e-30  13%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    8e-30  10%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    8e-30  14%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-30  20%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-29  15%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-29  12%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284
    3e-29  11%  1aroP  [e.8.1] T7 RNA POLYMERASE
    5e-29   9%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    1e-28   8%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    2e-28  17%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    2e-28   9%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    3e-28  10%  4dcgA  [x.x.x] VP39
    1e-27  36%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    2e-27  12%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    3e-27  12%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    4e-27  14%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    5e-27  12%  421pA  [x.x.x] H-RAS P21 PROTEIN
    6e-27  12%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    1e-26  11%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280
    2e-26  14%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    2e-26  10%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    4e-26   8%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    5e-26   9%  2ctsA  [x.x.x] CITRATE SYNTHASE
    8e-26   9%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    8e-26  11%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE
    1e-25   9%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-25  11%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-25   9%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-25   9%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    2e-25  12%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
    2e-25  16%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-25  13%  3cmxA  [x.x.x] PROTEIN RECA
    4e-25  16%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE
    6e-25  12%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B
    7e-25   8%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    7e-25   9%  2b8tB  [x.x.x] THYMIDINE KINASE
    1e-24  11%  1e0jB  [c.37.1] DNA HELICASE
    1e-24  16%  3cmwC  [x.x.x] PROTEIN RECA
    1e-24   9%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    1e-24  33%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-24   4%  2c4rL  [x.x.x] RIBONUCLEASE E
    2e-24  30%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-24  11%  3da4A  [x.x.x] COLICIN-M
    3e-24  10%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
    3e-24  14%  2bdtA  [x.x.x] BH3686
    4e-24  15%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    4e-24  13%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    8e-24   9%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    9e-24   9%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN
    9e-24  11%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    1e-23   9%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-23  11%  1e0jA  [c.37.1] DNA HELICASE
    2e-23  25%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    2e-23  12%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
    2e-23  13%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-23  10%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-23  13%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    2e-23  11%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
    2e-23  12%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    3e-23  10%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    3e-23   9%  3adkA  [x.x.x] ADENYLATE KINASE
    4e-23  17%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-23   9%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    5e-23  10%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    6e-23   9%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-22   8%  2c0bL  [x.x.x] RIBONUCLEASE E
    1e-22  10%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-22  13%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-22  10%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-22  32%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-22  11%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    3e-22  12%  2c7cH  [x.x.x] 60 KDA CHAPERONIN
    3e-22  10%  2cckB  [x.x.x] THYMIDYLATE KINASE
    4e-22  10%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
    4e-22  13%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284
    5e-22   9%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN
    6e-22  11%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    7e-22   9%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    7e-22  12%  2c9oC  [x.x.x] RUVB-LIKE 1
    7e-22   9%  3be4A  [x.x.x] ADENYLATE KINASE
    1e-21  11%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    1e-21  17%  3c8uA  [x.x.x] FRUCTOKINASE
    2e-21  14%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    2e-21   8%  2b8tC  [x.x.x] THYMIDINE KINASE
    3e-21  10%  1e6cA  [c.37.1] SHIKIMATE KINASE
    3e-21   8%  3dymA  [x.x.x] BETA-GALACTOSIDASE
    3e-21   9%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN
    3e-21   9%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    3e-21   9%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-21  11%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    4e-21  12%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE
    4e-21  11%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE
    4e-21  10%  3cmvE  [x.x.x] PROTEIN RECA
    4e-21  19%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    5e-21  12%  1e2kA  [c.37.1] THYMIDINE KINASE
    6e-21   8%  1cjaA  [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)
    6e-21  12%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    6e-21  10%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    7e-21  30%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    7e-21  11%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    8e-21  11%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE
    9e-21  10%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    1e-20   9%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-20  11%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    2e-20  14%  3cmtD  [x.x.x] PROTEIN RECA
    2e-20   8%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE
    2e-20   8%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    2e-20  12%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    3e-20   7%  2bhvD  [x.x.x] COMB10
    4e-20   9%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    4e-20   9%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    4e-20   9%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    6e-20   8%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    7e-20  12%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    8e-20  12%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    1e-19  13%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-19  18%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-19  12%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
    1e-19  12%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    2e-19  14%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE
    2e-19  12%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-19  12%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    2e-19  14%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    2e-19  22%  2d2eA  [x.x.x] SUFC PROTEIN
    3e-19   8%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
    3e-19  15%  3cm0A  [x.x.x] ADENYLATE KINASE
    3e-19   9%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-19  10%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    4e-19  11%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE
    4e-19  11%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    6e-19  11%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE
    7e-19  14%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    7e-19   7%  2bx2L  [x.x.x] RIBONUCLEASE E
    9e-19  11%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    9e-19  12%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-18   6%  2bhvA  [x.x.x] COMB10
    1e-18  15%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-18  14%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE
    2e-18  15%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-18  12%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284
    3e-18  14%  1dw9A  [a.35.1 - d.72.1] CYANATE LYASE
    3e-18  33%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-18   9%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF
    3e-18  12%  1e2hB  [c.37.1] THYMIDINE KINASE
    3e-18  21%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-18  12%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    3e-18   4%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    3e-18  24%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-18  14%  3cmuA  [x.x.x] PROTEIN RECA
    4e-18  14%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    4e-18  11%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2
    4e-18  19%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-18  15%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-18  14%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    6e-18  15%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-18   7%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639
    6e-18  12%  2boeX  [x.x.x] ENDOGLUCANASE E-2
    6e-18   8%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    6e-18  12%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-18   8%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE
    9e-18  21%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-18  12%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    1e-17  15%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-17  15%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-17   9%  2b8tD  [x.x.x] THYMIDINE KINASE
    1e-17  15%  1adoA  [c.1.10] ALDOLASE
    1e-17  15%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-17  15%  1aldA  [c.1.10 (2aldA)] ALDOLASE A
    2e-17  15%  3ecpA  [x.x.x] TN5 TRANSPOSASE
    2e-17  20%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-17  14%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-17   8%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    3e-17   8%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
    3e-17  15%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
    3e-17  15%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-17  15%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-17  10%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    4e-17  15%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-17  12%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    4e-17  15%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    5e-17  14%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    5e-17   9%  1e4vA  [c.37.1 - g.41.2] ADENYLATE KINASE
    6e-17  15%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-17  21%  2d2fA  [x.x.x] SUFC PROTEIN
    8e-17   9%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE
    9e-17  15%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-16  13%  4atjA  [a.93.1] PROTEIN (PEROXIDASE C1A)
    2e-16  17%  1bccF  [f.27.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    2e-16   7%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    2e-16  12%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-16  12%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
    2e-16   7%  2czvB  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    3e-16  33%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    3e-16  16%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    4e-16  12%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    4e-16  13%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
    5e-16  12%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284
    6e-16  13%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-16  11%  3ec1A  [x.x.x] YQEH GTPASE
    7e-16  15%  3a00A  [x.x.x] GUANYLATE KINASE
    7e-16  13%  2d4uB  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    9e-16  12%  2an9A  [x.x.x] GUANYLATE KINASE
    9e-16  12%  2anbA  [x.x.x] GUANYLATE KINASE
    1e-15  14%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN
    1e-15   9%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-15  15%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-15  14%  1e2iA  [c.37.1] THYMIDINE KINASE
    2e-15  12%  2ancD  [x.x.x] GUANYLATE KINASE
    2e-15   7%  2bofX  [x.x.x] ENDOGLUCANASE E-2
    2e-15   9%  2a1fF  [x.x.x] URIDYLATE KINASE
    3e-15   5%  3czjA  [x.x.x] BETA-GALACTOSIDASE
    3e-15  13%  3c7kC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    3e-15  16%  2aunA  [x.x.x] HYPOTHETICAL PROTEIN
    4e-15  10%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
    4e-15  14%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE
    4e-15   4%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    5e-15  10%  2ancF  [x.x.x] GUANYLATE KINASE
    6e-15  13%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN
    7e-15   6%  3bczC  [x.x.x] PROTEIN MEMO1
    1e-14  11%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-14  15%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
    1e-14  14%  3d1mB  [x.x.x] SONIC HEDGEHOG PROTEIN
    2e-14  12%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    2e-14  14%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    2e-14  13%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-14  17%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN
    3e-14  13%  3c7kA  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    3e-14  12%  3dlbB  [x.x.x] ARGONAUTE
    3e-14  10%  3bs4A  [x.x.x] UNCHARACTERIZED PROTEIN PH0321
    3e-14  16%  1e2jA  [c.37.1] THYMIDINE KINASE
    3e-14  18%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    3e-14  11%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    3e-14  12%  1azsC  [c.37.1 - a.66.1] GS-ALPHA
    4e-14  14%  3cmvB  [x.x.x] PROTEIN RECA
    5e-14  12%  1e2mB  [c.37.1] THYMIDINE KINASE
    6e-14  11%  2ancB  [x.x.x] GUANYLATE KINASE
    6e-14  14%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN
    7e-14  10%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-14  11%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    2e-13  12%  3e8aC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    3e-13   9%  1e2nA  [c.37.1] THYMIDINE KINASE
    3e-13  11%  1eamA  [c.66.1] PROTEIN (VP39)
    3e-13  16%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN
    3e-13  12%  2c9gA  [x.x.x] PENTON PROTEIN
    4e-13  15%  2e85A  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    4e-13  14%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6
    4e-13   8%  3dfdA  [x.x.x] PROTEIN YQBN
    6e-13  13%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1
    8e-13  10%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    8e-13  12%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    1e-12   8%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    1e-12  13%  2dftA  [x.x.x] SHIKIMATE KINASE
    1e-12  14%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    2e-12  14%  3a00B  [x.x.x] GUANYLATE KINASE
    3e-12   9%  2a1fD  [x.x.x] URIDYLATE KINASE
    3e-12   9%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    4e-12  15%  3cnnA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    4e-12  16%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    4e-12  16%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    5e-12  33%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-12   5%  3dyoA  [x.x.x] BETA-GALACTOSIDASE
    6e-12  13%  2dftC  [x.x.x] SHIKIMATE KINASE
    8e-12   6%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)
    8e-12  10%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    9e-12   8%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    1e-11  14%  1e2iB  [c.37.1] THYMIDINE KINASE
    2e-11   7%  3bm2B  [x.x.x] PROTEIN YDJA
    2e-11  14%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    3e-11   8%  1e2mA  [c.37.1] THYMIDINE KINASE
    3e-11  19%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-11  16%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    6e-11  11%  2a5vA  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    6e-11  16%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    8e-11  13%  3c85A  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    8e-11  12%  2a5vB  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    1e-10  11%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4
    2e-10  13%  3csuA  [c.78.1 - c.78.1] PROTEIN (ASPARTATE CARBAMOYLTRANSFERASE)
    2e-10  18%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    2e-10   8%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    2e-10  16%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    2e-10  14%  3dkvA  [x.x.x] ADENYLATE KINASE
    6e-10   8%  3bb1D  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    6e-10  12%  1e2nB  [c.37.1] THYMIDINE KINASE
    8e-10  13%  1e2lA  [c.37.1] THYMIDINE KINASE
    8e-10   8%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    8e-10  15%  2cdnA  [x.x.x] ADENYLATE KINASE
    1e-09  20%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-09  20%  1ckeA  [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    2e-09  17%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-09  13%  1e2lB  [c.37.1] THYMIDINE KINASE
    3e-09   9%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
    4e-09  12%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-09  10%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107
    4e-09  11%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    5e-09  15%  1e2hA  [c.37.1] THYMIDINE KINASE
    9e-09  17%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    1e-08  11%  3b85B  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    1e-08   8%  2a1fE  [x.x.x] URIDYLATE KINASE
    1e-08  14%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    1e-08   8%  2a1fC  [x.x.x] URIDYLATE KINASE
    2e-08  11%  1e2kB  [c.37.1] THYMIDINE KINASE
    2e-08   8%  1d2zD  [a.77.1] DEATH DOMAIN OF TUBE
    2e-08  13%  1d8jA  [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    3e-08   7%  1d6aA  [d.165.1] POKEWEED ANTIVIRAL PROTEIN
    4e-08  26%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-08  13%  3cbqA  [x.x.x] GTP-BINDING PROTEIN REM 2
    5e-08  20%  1chdA  [x.x.x] CHEB METHYLESTERASE
    6e-08   6%  2bhvC  [x.x.x] COMB10
    8e-08  22%  2ax4B  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    1e-07  22%  2ax4A  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    2e-07  14%  2axnA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    2e-07  17%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN
    2e-07  11%  2c5mD  [x.x.x] CTP SYNTHASE
    3e-07  13%  1e2jB  [c.37.1] THYMIDINE KINASE
    3e-07  17%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    4e-07  10%  1agpA  [x.x.x] C-H-RAS P21 PROTEIN
    4e-07  14%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    4e-07  25%  2bwjB  [x.x.x] ADENYLATE KINASE 5
    5e-07  17%  1e9sK  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-07  11%  2a78A  [x.x.x] RAS-RELATED PROTEIN RAL-A
    9e-07  12%  1dapA  [c.2.1 - d.81.1] DIAMINOPIMELIC ACID DEHYDROGENASE
    2e-06  27%  2bwjD  [x.x.x] ADENYLATE KINASE 5
    3e-06  11%  2c95B  [x.x.x] ADENYLATE KINASE 1
    3e-06  18%  2c9oA  [x.x.x] RUVB-LIKE 1
    6e-06  25%  2bwjF  [x.x.x] ADENYLATE KINASE 5
    7e-06  13%  3cddA  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    8e-06   8%  3cr8B  [x.x.x] SULFATE ADENYLYLTRANFERASE, ADENYLYLSULFATE
    1e-05   7%  2dx7A  [x.x.x] ASPARTATE RACEMASE
    2e-05   9%  3cddB  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-05  22%  2c9oB  [x.x.x] RUVB-LIKE 1
    3e-05  23%  3ci2A  [x.x.x] CHYMOTRYPSIN INHIBITOR 2
    3e-05  11%  3cddE  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    7e-05  19%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-04  17%  2ekbA  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    1e-04  14%  3e70C  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-04  20%  1dwmA  [d.40.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    2e-04   4%  1e6vC  [d.58.31] METHYL-COENZYME M REDUCTASE I GAMMA SUBUNIT
    3e-04  27%  2ck3A  [b.49.1 - c.37.1 - a.69.1 (1bmfA)] ATP SYNTHASE ALPHA CHAIN
    5e-04  25%  2bwjC  [x.x.x] ADENYLATE KINASE 5
    6e-04  14%  2bsqE  [x.x.x] TRAFFICKING PROTEIN A
    7e-04  20%  3dsrB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    9e-04  28%  1delB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
:252

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPTPPAPSGTAEPHAVVVQGLTKVYPTGGEPVRALDGVDVSFARGAFTAIMGPSGSGKSTLMHCMAGLDT
3b5jA           --------------DITFRNIRFRYKPDSPVI--LDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYI
3dmdC           ---------------AVKEAVSEILETSRRID--LIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLK
2d3wB           ---------------LSIKDLHVSVED----KAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGRED
3c95A           ------------PLAWHPENRNAVIMVDLAGD--ISPLLELDSDTLRAVPVKLVHINKCPVLAQANTLRP
2dwpA           ---------------------------------RVQKIWVPVDHRTVIVMVGLPARGKTYISKKLTRYLN
2ccgA           ----------------------------------------------FITFEGPEGSGKTTVINEVYHRLV
2ccjB           ----------------------------------------------FITFEGPEGSGKTTVINEVYHRLV
2ccgB           --------------------------------------------SAFITFEGPEGSGKTTVINEVYHRLV
3cmvG           ----------MRLGEDRSMDVETIS--TGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQ
3cmvH           ---KQFGKGSIMRGEDRSMDVETIST----GSLSLDIALGAGPMGRIVEIYGPESSGKTTLTLQVIAAAQ
2c03B           -ALGKQVLESLTPAEVILATVYEALK----EALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYK
1e9cA           -------------------------------------------RGALIVLEGVDRAGKSTQSRKLVEALC
2a2zD           -------------------------------------------RIKKISIEGNIAAGKSTFVNILKQLCE
2c61B           ------------MNPYARLPPKDFIQTG----ISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQAS
3b60A           EKDEGKRVIDRATGDLEFRNVTFTYPGREVPA--LRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYD
2bifA           -----------------------------------------------IVMVGLPARGKTYISKKLTRYLN
2dwoA           -----------------VQKIWVPVDH-----RPSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLN
1d1cA           -----------------------VAPHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLA
1e69A           -------------------------------FKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFG
3eiuA           -PDQLLDINGAAMNPYARLPPKDFIQTG----ISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQAS
2czvA           --------------------------------GGVKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDK
1e9dA           -------------------------------------------RGALIVLEGVDRAGKSTQSRKLVEALC
1e98A           -------------------------------------------RGALIVLEGVDRAGKSTQSRKLVEALC
2akaB           --------------------LIPLVNRLQD---AFSAIGQNALDLPQIAVVGGQSAGKSSVLENFVGRDF
3eiuB           ----LLDINGAAMNPYARLPPKDFIQTG----ISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQAS
3dmdB           -KVRIGTDKGKIIEEAVKEAVSEILETSR--RIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLK
3dm5A           IQRRALEEKPPAGISEHIIKIVYEELTK--FLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQ
2b8tA           --------------------------------------------GWIEFITGPMFAGKTAELIRRLHRLE
1bifA           --------------------------------------------PTLIVMVGLPARGKTYISKKLTRYLN
3cmvC           ---KQFGKGSIMRLGEDSMDVETISTGSLSLD--IALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQ
2b8wA           --------------MCLIENTNGRLMAN---PEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKK
2cjwB           -------------------------------------------TYYRVVLIGEQGVGKSTLANIFAGVED
2cgtH           VKVTLGPKGRNVVL---DKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTAT
2a30D           -------------------------------------------RIKKISIEGNIAAGKSTFVNILKQLCE
3cmvA           -----------------VETISTGSL-------SLDIALGAGPMGRIVEIYGPESSGKTTLTLQVIAAAQ
2c03A           -ALGKQVLESLTPAEVILATVYEALK----EALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYK
2cckA           ----------------------------------------------FITFEGPEGSGKTTVINEVYHRLV
1e9fA           -------------------------------------------RGALIVLEGVDGAGKSTQSRKLVEALC
1e2dA           -------------------------------------------RGALIVLEGVDRAGKSTQSRKLVEALC
2axzC           ----------------------------------------------------------------------
2dr3E           ---------------------TRRVKTGIPGV--DEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGL
2a30B           -------------------------------------------RIKKISIEGNIAAGKSTFVNILKWEVV
2a2zA           -------------------------------------------RIKKISIEGNIAAGKSTFVNILKQLCE
1e9sG           -PFKRFLRGTRIVSGGKLKRMTREKAK----QVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGL
2bbsA           --------------EVVMENVTAFWEEGFGELFVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELE
1e9sF           -------RGTRIVSGGKLKRMTREKAKQ----VTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGL
2dr3A           ----------------------RRVKTGIPGV--DEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGL
1aroP           ----------------------------------------------------------------------
3d3kA           ----------SKEFCTDSGLVVPSISYELHKKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPQRPT
2a5gA           -------------------------------------------KEMRILMLGLDAAGKTTILYKLKLGQS
2c04A           -ALGKQVLESLTPAEVILATVYEALKE----ALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYK
1dkiA           ---KENKKLPVVKSLLDSKGIHYNQG-NPYNLLTPVIEKVKPGEQSFVGQHAATGSVATATAQIMKYHNY
4dcgA           ------IDNELDYEPESANEVAKKLPYQGQ-LKLLLGELFFLSKILDGATVVYIGSAPGTHIRYLRDHFY
3dhwC           ---------------IKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLER
3czpB           --------------------YKEQLAAEQARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALD
1cr4A           -----------REHLSSEESVGLLFSG----CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWG
2a30A           -------------------------------------------RIKKISIEGNIAAGKSTFVNILKQLCE
421pA           ------------------------------------------------VVVGARGVGKSALTIQLIQNHF
1e2fA           -------------------------------------------RGALIVLEGVDRAGKSTQSRKLVEALC
2axpA           ----------------------------------------------LIILEGPDCCFKSTVAAKLSKELK
2a2zB           -------------------------------------------RIKKISIEGNIAAGKSTFVNILKQLCE
3b85A           -------------------------------TLGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQ
3a1wA           ------------------------------------------------ALAGCPNVGKTSLFNALTGTKQ
2ctsA           ------------------------SSTNLKDI--LADLIPKEQIKTFRQQHGNTAVGQITVDMMYGGMRG
2bc9A           ---SEIHMTGP---MCLIENTNGRLMAN---PEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKK
1e4yA           ------------------------------------------------ILLGALVAGKGTQAQFIMEKYG
3b2qB           -----------------RLPPKDFIQTG----ISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQAS
1e9rA           --------GTRIVSGGKLKRMTREKAKQ----VTVAGVPMPRDAEPHLLVNGATGTGKSVLLRELAYTGL
3b2qA           --------------------PKDFIQTG----ISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQAS
2c9yA           --------------------------------------------GIRAVLLGPPGAGKGTQAPRLAENFC
1bg0A           -------------------------------------------LDSGVGIYAPDAESYRTFGPLFDPIID
3dm9B           ---------------AVKEAVSEILETS---RRIDLIEEIRKAEKPYVIFVGFNGSGKTTTIAKLANWLK
3cmxA           ------------------------------GSLSLDIALGAGGMGRIVEIYGPESSGKTTLTLQVIAAAQ
3cr7C           -------------------------------------------RGLTIWLTGLSASGKSTLAVELEHQLV
2a5jA           ----------------------------------SSGLVPRGSYLFKYIIIGDTGVGKSCLLLQFTDKRF
1e3mB           ----------------------------------------------------------------------
2b8tB           --------------------------------------------GWIEFITGPMFAGKTAELIRRLHRLE
1e0jB           -----------REHLSSEESVGLLFSG----CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWG
3cmwC           ----------------------ETISTG---SLSLDIALGAGPMGRIVEIYGPESSGKTTLTLQVIAAAQ
1e3mA           ------------------------------------------------------LVNLAERAYTLNYTCP
2awnB           --------------SVQLQNVTKAWGE----VVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLET
2c4rL           -------------------------------------------------------------IVRTAGVGK
2awnC           ---------------------------------------------------ASVQLQNVTVSKDINLDIH
3da4A           -STNIGYFCNADRNLVLHPGISVYDAYH-------FAKPAPSQYDYRSMNMKQMSGNVTTPIVALAHYLW
3bpbA           ---------------IIARTPARSLV-DGLTSSHLGKPDYAKALEQHNAYIRALQVDITLLPPDERFPDS
2bdtA           ----------------------------------------------LYIITGPAGVGKSTTCKRLAAQLD
2bwjA           ------------------------------------GFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYG
2d4uA           -------------------------------------------------PLGSGGLFFNALKNCKENFTV
1dhjA           ----------------------------------------------------------------------
2bkhA           ------------IKSYQGKSLGTMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLT
1dekB           ------------------------------------------------FLSGVKRSGKDTTADFIMSNYS
3dtbB           REIISFGSGYGGNSLLGKKCFALRIASRLAKHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPG
1e0jA           --------------EHLSSSVGLLFSG----CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWG
2d62A           --------------EVKLINIWKRFGD----VTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAGLEEP
1dg3A           MTGP----------MCLIENTNGRLMAN---PEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKH
1e9sJ           ------LRGTRIVSGGKLKRMTREKAKQ----VTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGL
3cddD           ----------------------------------AGGKIYQWTKIGITRSLEASGAFDLETY----KFND
1cr1A           ------------------ESVGLLF--SG--CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWG
3d7wA           ------QQTTGEEYFSFITLLSSGSFSNNIPL--LRQSTVPVSEGQRFVLVELTNAGGDTITAAIDVTNL
2cvfA           -----------------------MLSTGTKSL--DSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSG
2b92B           ---------------CLIENTNGRLMAN---PEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKK
3adkA           -------------------------------------------KSKIIFVVGGPGSGKGTQCEKIVQKYG
2awnD           --------------SVQLQNVTKAWGE----VVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLET
2d0kA           ----------------------------------------------------------------------
2c61A           VPDQLLDINGAAMNPYARLPPKDFIQTG----ISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQAS
3dt2A           -GYGGNSLLGKKCFALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPG
2c0bL           ------------------------------AGSYLVLMPNNPRAGGISRRIELKEALASLELPLIVRTAG
3cddC           ---------------------------------------------EIVKAGGKIYQGWTKIGITRSLE-A
1e9sD           --------------GGKLKRMTREKAKQ----VTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGL
1e9sB           --------GTRIVSGGKLKRMTREKAKQ----VTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGL
2awoC           ---------------------SVQL--QNVTV--SKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLET
3dt4C           -GYGGNSLLGKKCFALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPG
2c7cH           ---------TLGPKGVLDKSFGAPTITGVSVAREIELEDKFENMGA--QMVKEVASKANDAAGDGTTTAT
2cckB           ----------------------------------------------FITFEGPEGSGKTTVINEVYHRLV
2bjbA           -------------------------------ELTVSGRIEPGPGARV--DCGLAG----TVLRFVPPLAA
2dr3B           ---------------------TRRVKTGIPGV--DEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGL
2akaA           --------------------RNEVAPHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLA
2dr3F           ----------------------RRVKTGIPGV--DEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGL
3dauA           ----------------------------------------------------------------------
2c9oC           ---------------QAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELG
3be4A           -------------------------------------------KKHNLILIGAPGSGKGTQCEFIKKEYG
3cioD           -----------------------------ALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIA
3c8uA           -------------------------------QGVLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALS
3bh0A           ---DEALVTVYEEIESADGNITGVPSG----FTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMS
2b8tC           --------------------------------------------GWIEFITGPMFAGKTAELIRRLHRLE
1e6cA           ----------------------------------------------PIFMVGARGCGMTTVGRELARALG
3dymA           ----------------------------------------------------------------------
2bkiA           -----------------GKSLGTMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLT
3dt4A           -GYGGNSLLGKKCFALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPG
1dhiA           ----------------------------------------------------------------------
2b8wB           MTGP----------MCLIENTNGRLMAN---PEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKK
1cfrA           ------------------------------------------------DIISKSGEGNKYTINAYASHID
3cr7A           -------------------------------------------RGLTIWLTGLSASGKSTLAVELEHQLV
3cmvE           --------GSIMRLGEDRSMDVETISTGSLSLDIALG-AGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQ
1d6jB           -------------------------------LTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLV
1e2kA           -------------------------------------------TLLRVYIDGPHGMGKTTTTQLLVADDI
1cjaA           -------------------------------------------------GITLNKLTTTSAPEVLTKSTM
2d4hB           MTGP----------MCLIENTNGRLMANPEALKILSAITQ---PMVVVAIVGLYRTGKSYLMIWMWCVPH
3d3qA           -------------------------------------------KPFLIVIVGPTASGKTELSIEVAKKFN
3d31A           ---------------IEIESLSRKWKN-----FSLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHV
3czpA           ---------------------------------GLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALD
1cr2A           -----------REHLSSEESVGLLF--SGCT--GINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWG
1e3aB           -------------------------WQEWTQQAAKQALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRL
1draA           ----------------------------------------------------------------------
2dflA           -----------------ERMNVKKISTGSQAL--DGLLAGGIETRTMTEFFGEFGSGKTQLCHQLSVNVQ
3cmtD           -----------------SLSLDIALGAGG------------LPMGRIVEIYGPESSGKTTLTLQVIAAAQ
2bhjA           -------------------------------------------------------------------IKN
1e59A           -------------------------------------------HGESQWNKENRFTGWYDVDLSEKGVSE
1e2gA           -------------------------------------------RGALIVLEGVDRAGKSTQSRKLVEALC
2bhvD           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dt7A           SGYGGNSLLGKKCFALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPG
3cddF           -GQACTVDIGGERVITGYVDDWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCK
3bgwA           ------------------------GVPSGFTE--LDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMS
1cjtC           --------------------------------------------THRLLLLGAGESGKSTIVKQMRILHV
1e9sM           --------------------LKRMTREKAKQV-TVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGL
2bbsB           -----------------TEVVMENVT----AFWVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELE
3dffA           ----------------------------------------------------------------LAISPH
3d3qB           -------------------------------------------KPFLIVIVGPTASGKTELSIEVAKKFN
3cr7D           -------------------------------------------RGLTIWLTGLSASGKSTLAVELEHQLV
3bb1B           ---------------SGINTFAPATQTKLLEL--LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERV
5dfrA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------LPQLQN
2d2eA           -----------------IRDLWASIDG----ETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPE
3bo6B           ---------------HSLHNQMRQMP----MSHFREALDAPDYSGMRQSGFFAMSQGFQLESHGGDVFMH
3cm0A           --------------------------------------------GQAVIFLGPPGAGKGTQASRLAQELG
4dfrA           ----------------------------------------------------------------------
2d4hA           --------------MCLIENTNGRLMAN---PEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKK
3ch4B           ------------------------------------GSMAPLAPRLVLLFSGKRKSGKDFVTEALQSRLG
1ai4B           ---------------------------------------INWYYADVNGNIGYVHTGAYPDRQSGHDPRL
3clvA           ----------------------------------------EKKSSYKTVLLGESSVGKSSIVLRLTKDTF
1eilA           ----------------------------------------------------------------------
2bx2L           -----------------------------------------------------------MGLIVRTAGVG
2eg5G           ------DTSYAKNSAYNQLVLAKVKPVLEQCVRLLRANLPNINKCIKVADLGCASGPNTLLTVRDIVQSI
3bb1C           -------------GWSGINTFAPATQTKLLEL--LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERV
2bhvA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1cr0A           -----------------EESVGLLF--SGCTG--INDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWG
3dfnC           ----------------------------------------------------------------------
2dr3C           ---------------------TRRVKTGIPGV--DEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGL
1dw9A           ----------------------------------------------FAEIADGTGLAEAFVTAALLGQQA
2awoA           --------------SVQLQNVTKAWGE----VVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLET
2ahwD           ---------------------------GRVPVLSAQEAVNYIPDEATLCVLGAILEATTLITALADSIIS
1e2hB           -------------------------------------------TLLRVYIDGPHGMGKTTTTQLLVALGS
2d3wC           -----------------IKDLHVSVED----KAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGRED
3bb1E           -------------GWSGINTFAPATQTKLLEL--LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERV
1bglA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------EIRKGEVIGIVGPNGIGKTTFVKMLAGVEE
3cmuA           -----------------VETISTGSL-------SLDIALGAGPMGRIVEIYGPESSGKTTLTLQVIAAAQ
3bgwD           ------------------------GVPSGFTE--LDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMS
1ak2A           -------------------------------------------KGVRAVLLGPPGAGKGTQAPKLAKNFC
2d3wA           -----------------IKDLHVSVED----KAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGRED
3dfqA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------FITFEGPEGSGKTTVINEVYHRLV
3dfnD           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
1dekA           ------------------------------------------------FLSGVKRSGKDTTADFIMSNYS
1e9rE           ------LRGTRIVSGGKLKRMTREKAKQ----VTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGL
1akeA           ------------------------------------------------ILLGAPGAGKGTQAQFIMEKYG
2bbtB           ---------------VVMENVTAFWEEGFGNTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELE
1cs4C           --------------------------------------------THRLLLLGAGESGKSTIVKQMRILHV
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2b8tD           --------------------------------------------GWIEFITGPMFAGKTAELIRRLHRLE
1adoA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
3ecpA           -----------------------------------------------------------------SALHR
2d3wD           -----------------IKDLHVSVED----KAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGRED
1e9rF           --------------GGKLKRMTREKAKQ----VTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGL
3crmA           ------------------------------------------SLPPAIFLMGPTAAGKTDLAMALADALP
2ahvA           -----------------------------VPVLSAQEAVNYIPDEATLCVLGAILEATTLITALADKYKS
6aldA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3bb1F           -------------GWSGINTFAPAT--QTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERV
3dfqC           ----------------------------------------------------------------------
1culC           --------------------------------------------THRLLLLGAGESGKSTIVKQMRILHV
3bb1A           -------------GWSGINTFAPATQTKLLEL--LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERV
1ek0A           ------------------------------------------------VLLGEAAVGKSSIVLRFVSNDF
1e4vA           ------------------------------------------------ILLGAPVAGKGTQAQFIMEKYG
3dfoC           ----------------------------------------------------------------------
2d2fA           -----------------IRDLWASIDG----ETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPE
1drbA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
1e9sH           --------------GGKLKRMTREKAKQ----VTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGL
1accA           -------------------------------ARIIFNGKDLNLVERRIAAVNPSTTKPDMTLKEALKIAF
2czvB           --------------------------------RDKEAYELAKEWFEVVVSIKFNEEVDKEKLREARKEYG
1b0uA           -------------NKLHVIDLHKRYGG----HEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEK
3cnlA           ---------------------------------KVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRA
1d6jA           ------------------------------ALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLV
3di4A           VICYPNDSLPRPDLALYRAARASARKTGEVLVPPREGRCFEVKAGQFFRISSVEGPQVGDLNLHN-----
2dr3D           ---------------------TRRVKTGIPGV--DEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGL
1e9sL           --------------------LKRMTREKAKQV-TVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGL
3ec1A           -------------------------------------------------------------INRIIEEAT
3a00A           -----------------------------------------------IVISGPSGTGKSTLLKKLFAEYP
2d4uB           ----------------------------------------------------------------------
2an9A           ------------------------------------------AQGTLYIVSAPSGAGKSSLIQALLKTQP
2anbA           ------------------------------------------AQGTLYIVSAPSGAGKSSLIQALLKTQP
2aunB           ----------------------------------------------------------------------
1e9sE           --------------GGKLKRMTREKAKQ----VTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGL
3bv4A           ----------------------------------------------------------------------
1e2iA           -------------------------------------------TLLRVYIDGPHGMGKTDDIVYVPEPMT
2ancD           -------------------------------------------QGTLYIVSAPSGAGKSSLIQALLKTQP
2bofX           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
3c7kC           ------------------------------------------------LLLGAGESGKSTIVKQMKIIHE
2aunA           ----------------------------------------------------------------------
3brwA           -----------------CNPTARIYRKHFLGKEHFNYYSLDTALGHLVFSLKYDVIGDQEHLRLLLRTKC
3cr7B           -------------------------------------------RGLTIWLTGLSASGKSTLAVELEHQLV
1dp0A           ----------------------------------------------------------------------
2ancF           ------------------------------------------AQGTLYIVSAPSGAGKSSLIQALLKTQP
2bv7A           --------------------------------------DISGNITKIKAVYDTNPTKFRTLQNILEVEKE
3bczC           -------------------------------------EASHAGSWYTASGPQLNAQLEGWLSQVQSTKRP
1e9rD           -------RGTRIVSGGKLKRMTREKAKQ----VTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGL
3b55A           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
3c15C           -------------------------------------------ATHRLLLLGAGESGKSTIVKQMRILHV
1c9kC           ------------------------------------------------LVTGGARSGKSRHAEALIGDAP
1e9sI           --------------GGKLKRMTREKAKQ----VTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGL
2aumB           ----------------------------------------------------------------------
3c7kA           ------------------------------------------------LLLGAGESGKSTIVKQMKIIFS
3dlbB           -----------------------------ERLRRLEGVWV--EGLAVYRREHARGPGWRVLGGAVL----
3bs4A           -------------------------SWE---IEELDREGKIKKHSLILIHEEDASSRGKDILFYILSRKL
1e2jA           ------------------------------------------PTLLRVYIDGPHGMGKTTTTQLLRDDIV
3dvlD           ------------------QAIAKM-RTM---IEGFDDIHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGI
3bb1G           -------------GWSGINTFAPATQTKLLEL--LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERV
1azsC           -----------------------------------------YRATHRLLLLGAGESGKSTIVKQMRILHV
3cmvB           -----------------VETISTGSL-------SLDIALGAGPMGRIVEIYGPESSGKTTLTLQVIAAAQ
1e2mB           ------------------------------------------PTLLRVYIDGPHGMGKTTTTQLLVALGS
2ancB           ------------------------------------------AQGTLYIVSAPSGAGKSSLIQALLKTQP
3d1mA           ----------------------------------------------------------------------
1e9rG           -------RGTRIVSGGKLKRMTREKAKQ----VTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGL
1bmfC           -SKARRRVGLKAPGIIPRISVREPMQTG----IKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQK
3e8aC           --------------------------------------------THRLLLLGAGESGKSTIVKQMRILHV
1e2nA           ------------------------------------------PTLLRVYIDGPHGMGKTTTTQLLVALGS
1eamA           --------------------------------------------ILDGATVVYIGSAPGTHIRYLRDHFY
2aumA           ----------------------------------------------------------------------
2c9gA           --NEFMFTNKFKARVMVSRSLTKDKQV----ELKYEWVEFTLPEGNYSETMTIDLMNNAIVEHYLKVGRQ
2e85A           ----------------------------------------------------------------------
3bwdD           -------------------------------------------RFIKCVTVGDGAVGKTCLLISYTSNTF
3dfdA           ---SFFPGQT-----IDAEEVEVPISKR-FVDKEGNVVPFIFITTDRIDELEKENTTKELDSQRF-----
3cueF           -----------------------------------------YDYLFKLLLIGNSGVGKSCLLLRFSDDYI
3bb1H           ---------------SGINTFAPATQTKLLEL--LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERV
2bkeA           -RDALDIRFKTALEVKKERNVKKISTG----SQALDGLLAGGIETRTTEFFGEFGSGKTQLCHQLSVNVQ
2ck3C           ------------------ISVREPMQTG----IKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQK
2dftA           ------------------------------------------------VLVGLPGSGKSTIGRRLAKALG
3c14C           --------------------------------------------THRLLLLGAGESGKSTIVKQMRILHV
3a00B           -----------------------------------------------IVISGPSGTGKSTLLKKLFAEYP
2a1fD           ----------------------------------------------------------------------
1e1qB           ------------PGIIPRISVREPMQTG----IKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQK
3cnnA           ---------------------------------KVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRA
2d7vA           -PVPLSVEANVDPEEAFVAALSSCHLVFLS-IAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQV
2d7vB           -PVPLSVEANVDPEEAFVAALSSCHLVFLS-IAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQV
2awnA           --------------SVQLQNVTKAWGE----VVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLET
3dyoA           ----------------------------------------------------------------------
2dftC           ------------------------------------------------VLVGLPGSGKSTIGRRLAKALG
1ckvA           ---------------------------------FFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDY
1dvrA           ------------------------------------------SESIRMVLIGPPGAGKGTQAPNLQERFH
1av6A           ---------------PESANEVAKKLPYQGQLKLLLGSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFY
1e2iB           ------------------------------------------PTLLRVYIDGPHGMGKTTTTQLLVALGS
3bm2B           ----------------------------------------------------------------------
1cjuC           --------------------------------------------THRLLLLGAGESGKSTIVKQMRILHV
1e2mA           ------------------------------------------PTLLRVYIDGPHGMGKTTTTQLLRDDIV
2bbtA           ---------------VVMENVTAFWEEGFGELFVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELE
1cjvC           --------------------------------------------THRLLLLGAGESGKSTIVKQMRILHV
2a5vA           ----------------VVRTAGHVIDSA---VLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGT
2e85B           ----------------------------------------------------------------------
3c85A           -------------------------------------------------------------------LIN
2a5vB           ----------------VVRTAGHVIDSA---VLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGT
3cphA           ------------------------------------------------LLIGDSGVGKSCLLVRFVEDKF
3csuA           ---------------------------------------------------------------HIISIND
2cbzA           -------------NSITVRNATFTW--ARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMD
1afrA           ------------------------------PREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEK
2dpyB           --------------------IEHVLDTG----VRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTR
3dkvA           ------------------------------------------------VLMGLPGAGKGTQAERIVE--K
3bb1D           -------------GWSGINTFAPATQTKLLEL--LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERV
1e2nB           -------------------------------------------TLLRVYIDGPHGMGKTTTTQLLVALGS
1e2lA           ------------------------------------------PTLLRVYIDGPHGMGKTTTTQLLDIVYV
2b0lC           ----------------------------------------------------------------------
2cdnA           ------------------------------------------GSHMRVLLLGPPGAGKGTQAVKLAEKLG
1e9rB           --------------------LKRMTREKAKQV-TVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGL
1ckeA           ------------------------------------------AIAPVITIDGPSGAGKGTLMAEALQWHL
2awoD           --------------SVQLQNVTKAWGE----VVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLET
1e2lB           ------------------------------------------PTLLRVYIDGPHGMGKTTTTQLLVA---
2aexA           ----------------------------------------------------------------------
1e9sA           ---------------GKLKRMTREKAKQ----VTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGL
3cqcA           IDWLVFDPAQRAEALKQGNAIMRKFLASKK-HEAAKEVFVKIPQDSIAEIYLPAEDDNAIREHLC-----
3dm5B           IQRRALEEKPPAGISEHIIKIVYEELTKF--LGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQ
1e2hA           ------------------------------------------PTLLRVYIDGPHGMGKTTTTQLLRDDIV
2dpyA           ------------------TPIEHVLDTG----VRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTR
3b85B           -------------------------------------------TNTIVFGLGPAGSGKTYLAAKAVQALQ
2a1fE           ----------------------------------------------------------------------
3ed8A           ------------------------------DGNILGHKLEYNFNSHNVYITATRGTQKNGIKANFTVRHN
2a1fC           ----------------------------------------------------------------------
1e2kB           -------------------------------------------TLLRVYIDGPHGMGKTTTTQLLVALGS
1d2zD           ---VQACSGAGCLNFPAEIKKGFKYTAQDVFQ--IDEAANRLPMMIDEWKTSGKLNERPTVGVLLQLLEL
1d8jA           ----------------------------------------------------------------------
1d6aA           ------------------------IQILDSNIGKISGVMSFTEKTEAEFLLVAIQMVSEAARFKYIENQV
2bboA           --------------EVVMENVTAFWEEGLG-TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI-----
3cbqA           ------------------------------------------------MLVGESGVGKSTLAGTFGGLQG
1chdA           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
2ax4B           -------------------------------------------RGCTVWLTGLSGAGKTTISFALEELVS
2ax4A           -------------------------------------------RGCTVWLTGLSGAGKTTISFALEELVS
2axnA           -----------------VQKIWVPVD-----HRPSLPRSCGPNSPTVIVMVGLPARGKTYISKKL-----
3bjqB           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
1e2jB           ------------------------------------------PTLLRVYIDGPHGMGKTTTTQLLVALGS
3do6A           ------------DDILYPYGHYIAKID----HRFLKSLENHEDGKLILVTATPAGEGKTTTSIGLSSLNR
1agpA           ------------------------------------------------VVVGADGVGKSALTIQLIQNHF
3b9qA           ---IMSGKLKSGSEIKDALKESVLEMLA----KSKTELQLGFRKPAVIMIVGVNGGGKTTSLGKL-----
2bwjB           ----------------------------------------DLRKCKIIFIIGGPGSGKGTQCEKLVEKYG
1e9sK           --------------------LKRMTREKAKQV-TVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGL
2a78A           ------------------------------------------------IMVGSGGVGKSALTLQFMYDEF
1dapA           ADAADHERIENDIRTMPDYFVGYEVEVNFIDEATFDSEHTGMPHGGHVITTGDTGGFNHTVEYILKLDRN
2bwjD           -------------------------------------------KCKIIFIIGGPGSGKGTQCEKLVEKYG
2c95B           -------------------------------------------KTNIIFVVGGPGSGKGTQCEKI----V
2c9oA           ---------------QAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAI-----
2bwjF           -------------------------------------------KCKIIFIIGGPGSGKGTQCEKLVEKYG
3cddA           -------------------------------WTKIGITRSLEASGAFDLETYKFLGNDAQYKAFIEPIKQ
3cr8B           ----------------------------------------------------------------------
2dx7A           ------------------------------------------------KTPAKRDQEHPKVIIFNNPQIP
3cddB           -------------------------------LKAGGKIYQGWTKIGITRSLEASGAFDLETYKFLGNDAQ
2c9oB           --------------------------------VIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQE--
3ci2A           ----------------------------------------------------------------------
3cddE           ----------------------------------AGGKIY----QGWTKIGITRSLEASGAFDLETYK--
3dmdA           ---------------AVKEAVSEILETSRRID--LIEEIRKAEKPYVIMFVGFNGSGKTTTIAKL-----
2ekbA           ----------------------------------------------------------------------
3e70C           -VRIGGKIIEEAV-KEAVSEILETSRR-----IDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLK
1dwmA           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2ck3A           ---------------------REPMQTG---IKAVDSL-VPIGRGQRELIIGDRQTGKTSIAIDTI----
2bwjC           -------------------------------------------KCKIIFIIGGPGSGKGTQCEKLVEKYG
2bsqE           ----------------------------------------------------------------------
3dsrB           -------------------------QTG---ISTIDGT-NTLVRGQKLPIFSASGLPHNEIALQIARQAS
1delB           ------------------------------------------------FLSGVKRSGKDTTADFIM----


                         .         .         *         .         .         .         .:140
query           PTSGSVRLGATELTALSDKQLTLLRRDRIGFVFQSFNLLPMLTARQNILLPSQISKRKVDPERFRHIVEV
3b5jA           PENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSKVIYAAKLAGAHDFISELR
3dmdC           NHGFSVV---------------------IAASDTFRAGAIEQLEEHAKRIGVKVIKYGADPAAVAYDAIQ
2d3wB           YEVTGGTVEFKGKDLLALSPEDRAGE-GIFMAFQYPVEIPGVSNQFFLQTATLDRFDFQDLMEEKIALLK
3c95A           EDADRLGINRQHCLDNLKILRENPQDNVDAQLYNGFFSDADRAAMKIVLETEPRNLPALDITFVDKRIEK
2dwpA           WIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDV------------------KS
2ccgA           KDYDVIMTREPGGVPTGEEIR------KIVLEGNDMDIRTE----AMLFAASRREHLVLKVIPALKEGKV
2ccjB           KDYDVIMTREPGGVPTGEEIR------KIVLEGNDMDIRTEAMLFAASRREHLVLKV----IPALKEGKV
2ccgB           KDYDVIMTR--------EPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREH--LVLKVIPALKEGKV
3cmvG           REGKTCAFIDAEHALDPI------YARKLGVDIDNLLCSQPDTGEQALEICDALARSGVDVIVVDSVAAL
3cmvH           REGKTCAFIDA------EHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGVDSAALTPKAEI
2c03B           GKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVM-------------------DGESPESIRRRVEE
1e9cA           AAGHRAELLRFPERSTE-------IGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVIKEKLSQGVTLVVD
2a2zD           DWEVVPEPVARWCNVQSTNVLQMMKPERWSFTFQTYACLSRIRAQLASLNEKPVLFFERSVDRYIFASNL
2c61B           VPGSESAFAVVFAAMGITNE---EAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPALRQMGYPGYM
3b60A           IDEGHILMDGHDLREYTLASLRNQVALVSQNVHLFNDTVAAYARTEEYSREQIEEAARMAYAMDFINKMD
2bifA           FIGVPTREFNVGQYRRDMVKTYKSFEFFLPDNEEGLK------------------IRKQCALAALNDVRK
2dwoA           WIGVPTKVFNVGEYRREAVK-----QYSSYNFFRPDNEEAMKVRKQCA-------------LAALRDVKS
1d1cA           SVAGRNQAGVLEQQILQANPI-LEAFGNAKTTRNNNSSRFGKFIEIQFNNAGFISGASIQSYLLEKSRVV
1e69A           EKFDMIFAGSENLPPAGSAYVELVFEENGEEITVARELKRTGENTYYLNGSPVRLISLLFFGGEGRLEIS
3eiuA           VPGSESAFAVVFAAMGITNEE---AQYFMSDFEKTGALERAVVFLNLADVILTDITNYAEALRQMGPGYM
2czvA           EKLREARKEYGKVAILLSNPKPSLVRDTLIYVESNDLRVIRYSIEKGVDAIISPWVNRKDPGIDHVLAKK
1e9dA           AAGHRAELLRFPERSTE-------IGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVIKEKLSQGVTLVVD
1e98A           AAGHRAELLRFPERSTE-------IGKLLSSYLQKKSDVEDHSVHLLFSANEQVPLIKEKLSQGVTLVVD
2akaB           LPRGSGIVTRRPLVLQLVNST---TEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLV
3eiuB           VPGSESAFAVVFAAMGITNE---EAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAYPGYM
3dmdB           NHGFSVV---------------------IAASDTFRAGAIEQLEEHAKRIGVKVIKYGADPAAVAYDAIQ
3dm5A           KRGYKVGVVCSDTWRPGAYH----QLRQLLDRYHIEVFGNPQ---------------EKDAIKLAKEGVD
2b8tA           YADVKYLVFKPKIDTRSIRNI----QSRTGTSLPSVEVESAPEILNYIMSNSFNDEICEVANILAENGFV
1bifA           FIGVPTREFNVGQYRRDMVKTYKSFEFFLPDNEEGLK------------------IRKQCALAALNDVRK
3cmvC           REGKTCAFIDAEHALDPI------YARKLGVDIDNLLCSQPDTGEQALEICDALARSGVDVIVVDSVAAL
2b8wA           GFSLGSTVQSHTKGIWMWCVPHPKKP-GHILVLLDTEGLGDVEKGDNQNDSWIFAGTINQQAMDQLYYVT
2cjwB           TYERTLMVDGESATIILLDM----WENHDHMQVGDAYLIVYSITDRASFEKASELRLRRARQTEDIPIIL
2cgtH           VLAQAIITEGLKAVAAGMNPMDLKRDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVVEDGTGLQDE
2a30D           DWEVVPEPVARWCNVQSTNVLQMMYEKRWSFTFQTYACLSRIRAQLASLNGKPVLFFSVYSDRYIFASNL
3cmvA           REGKTCAFIDAEHALDPI------YARKLGVDIDNLLCSQPDTGEQAL----------------------
2c03A           GKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKA-----------------
2cckA           KDYDVIMTREPGGVPTGEEIRKIVLEDMDIRTEAMLFAASR----------------REHLVLKVIPALK
1e9fA           AAGHRAELLRFPERSTEIGK-------LLSSYLQKKSDVEDHSVHLLFSANRWEQVIKEKLSQGVTLVVD
1e2dA           AAGHRAELLRFPERSTEIGKL------LSSYLQKKSDVEDHSVHLLFSANRWEQVPKEKLSQGVTLVVDR
2axzC           -----------------------------------------------------DLKHLYDKRTTFFGIDY
2dr3E           KMGEPGIYVALEEHPVQVRQ----NMAQFGWDVKPYEEKGMFAMVDAFTAGIGKEYEKYIVHDLTD----
2a30B           PEPVARWCNVQSTNVLQMMY---EKPERWSFTFQTYACLSRIRAQLASLNDAEKPVLFFERSVYSDRYIL
2a2zA           DWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKEKPVLF-----FERSV
1e9sG           LRGDRMVIVDPNGDMLS------KFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR-------------
2bbsA           PSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVI-----------------KACQLEEDI
1e9sF           LRGDRMVIVDPNGDMLSKFGR------DKDIILNPYDQRTKGWSFFNEIRNDYDWQR-------------
2dr3A           KMGEPGIYVALEEHPVQVRQ----NMAQFGWDVKPYEEKGM-------------------FAMVDAFTAG
1aroP           ------------------------------------------NDFSDIELAAIPFNTLADHYGERLAREQ
3d3kA           VLCGPHVKGAQG---ISCGRHLANHDVQVILFLPNFVKMLESITNELSLFSKTQGQQVSSLKDLPTSPVD
2a5gA           VTTIPTVGFNVETVTYKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDRIDEARQELHRIINDREMR
2c04A           GKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVM-------------------DGESPESIRRRVEE
1dkiA           PNKGLKDYTYTLSSNNP-------YFNHPKNLFAAISTRQYNWNNILPTYSGRESNVQKMAISELMADVG
4dcgA           NLGVIIKWMLIDGRHHDPILNGLRDLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYSLKW
3dhwC           PTEGSVLVDGQELTT-LSESELTKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTDEVKRRVTELLSL
3czpB           PRQYHIVPIAAPTEEERAQPYLWRFWRHIPARRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEIEQL
1cr4A           TAMGKKVGL----------------AMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDE
2a30A           DWEVVPEPVARWCNVQSTNVLQMMKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSD
421pA           VDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEAMRDQYMRTGEGFLCVFAINNTFEDIHQYREQIKRV
1e2fA           AAGHRAELLRFPERSTEIGK-----LLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVD
2axpA           YPIIKGSSFELAKSGNEKLFEHFNKLADEDNVIIDRFVYSNLVYAKKFKDYSILTQLRFIEDKIKAKAKV
2a2zB           DWEVVPEPVARWCNVQSTNVLQMEKPERWSFTFQTYACLSRIRAQLASLNGEKPVLFSVYSDRYIFASNL
3b85A           SKQVSRIILTRPAVEAGEKLGFLPGDPYLRPLHDALRDVEPEVIPKLEAIVEVAPLAYRGRTLNDAFVIL
3a1wA           YVANWPGVTVEKKEGVFTYKGYTINL-IDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVEQSLY
2ctsA           MKGLVYETSVLDPDEGIRFRGYSIP--ECQKMLPKAKGGEEPLPEGLFWLLVTGQIPTEEQVSWLSKEWA
2bc9A           GFSLGSTVQSHTKGIWMWCV----PHPKKPGHILVLLDTEG------------LGDVEKGDNQNDSWIFA
1e4yA           IPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTD-----------------------ELVIALVKERI
3b2qB           VPGSESAFAVVFAAMGITNE----EAQYFMSDFEKTGALERAVVFLNLADDPAVERIALRQMGRGYPGYM
1e9rA           LRGDRMVIVDPNGDMLSKFGR------DKDIILNPYDQRTKGWSFFNEIRNDWQRYALSVVPRGKTDEAE
3b2qA           VPGSESAFAVVFAAMGITNE----EAQYFMSDFEKTGALERAVVFLNLAAVERIVTPRMALTAAEYLAYE
2c9yA           VCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVIEKNLETPLCKNGFLLDGFPRTVRQAEMLD
1bg0A           DYHG--------GFKLTDKHPPKQWGDINTLVGLDPAGQFIISTRVRCGRSLQAEQYKEMEEKVSSTLSS
3dm9B           NHGFSVVIAASDTFRAGAIEQEHAKRIGVKVIKHSYGADPAAVAYDAI----------------------
3cmxA           REGKTCAFIDAEHALDPI------YARKLGVDIDNLLCSQPDTGEQALEICDALARSGVDSQAMRKLAGN
3cr7C           RDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIASFISPYRKDRDTARQLVEV
2a5jA           QPIGVEFGARMVNIDGKQIKLQI-WDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHSWLEDARQH
1e3mB           --AYTLNYTCPTFIDKPGIRITEGRHPVVEQVLNEPFIANPLSPQRRLIITGPNGGKSTYRQTALIALAY
2b8tB           YADVKYLVFKPKILPSVEVE----SAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFV
1e0jB           TAMGKKVGLAMLEESVEE------TAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWF-DELFGNDTFHL
3cmwC           REGKTCAFIDAEHALD------PIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGVD------VIVV
1e3mA           TFIDKPGIRITEGRHPVVEQ-----VLNEPFIANPLNLSPQRRLIITGPNGGKSTYRQTALIALAYSYVP
2awnB           ITSGDLFIGEKRMNDTPPAE----RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEV
2c4rL           SAEALQWDLSFRLK-HWEAIKKAAESRPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKRQHIAALGR
2awnC           EGEFVVFVG--PSGCGKSTLLRMIAGLGVGMVFQSYALYPHLSVAENMSFGLKLAGKEVINQRVNQVAEV
3da4A           GNGAERSVNIANIGLKKINQIKDIIKSGVVGTFPVSTKFTHATGDYNVITGAYLGNITLKTEGTLASTHR
3bpbA           VFVEDPVLCTSRCAIITRPGAESRRGETEIIEETVQRFYPGKVERIEAPGT-----VEAGDIMMVGDHFY
2bdtA           NSAYIEGDIINHVVGGYRPPWESDELLAITDLTVNFLLAQNDVVLDYIAFPDEAEALTVQAKVDDVEIRF
2bwjA           FTHLSTGLLREELASESE------RSKLIRDIMERGDLVPSGIVLELLKASLGDTRGFLIDGYPREVKQG
2d4uA           LQTIRQQQSTLNGSWVALLQTRNLNRAGIRYMMDQNNIGSGSTVAELMSLKQAEKNWADYEALPRDPRQS
1dhjA           ----------------------------------------------SLIAALAVDRVIGMENAMPWNLPA
2bkhA           ESYGTGQ--------DIDDRIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGLEKSRICVQ
1dekB           AVKYQL---------------AGPIKDALAYAWGVFAANTDYPLTRKEFEGIDYDR------ETNLNLTK
3dtbB           WKVECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEG
1e0jA           TAMGKKVGLAMLEESVEE------TAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWF-DELFGNDTFHL
2d62A           TRGQIYIEDNLVADPEKGVF---VPPKERDVAVFQSYALYPHTVYDNIAFPLKLRKVPKQIDKRVREVAE
1dg3A           TKGIWMWCVPHPKKPGHILV----LLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQATE
1e9sJ           LRGDRMVIVDPNGDMLS------KFGRDKDIILNPYDQRTKGWSFFNEI---------RNDYDWQRYAL-
3cddD           AQYKAFIEPI-----KQGQACTVDIGGERVITGYVDDWVPSYDESTITIYPSGQFNNQTLTQIADIVCKP
1cr1A           TAMGKKVGLA------MLEESVEETAEDLIGLHNRVRLRQSDSLK----------REIIENGKFDQWFDE
3d7wA           YVVAYEAGNQ--------------SYFLSDAPAGAETQDFSGTTSSSQP---FNGSYPDLERYAGHRDQI
2cvfA           KKVAYVDT------EGGFSPERLVQMAETRGLNPEEALSRFILFTPSDFK-EQRRVIGSLKKTVDSNFAL
2b92B           GFSLGSTVQSHTKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFYNSIGTINQQAMDQLYY
3adkA           YTHLSTGDLLRAEVSSGSARG---KMLSEIMEKGQLVPLETVLDMLRDAMVAKVDTSFLIDGYPREVKQG
2awnD           ITSGDLFIGEKRMNDTPPAE---RGVGMVEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGMIYVTHD
2d0kA           -------------------------------------ISLIAALAVDR--------VIGNENALPWNLPA
2c61A           VPGSESAFAVVFAAMGITNEE---AQYFMSDFEKTGALERAVVFLNLADPAVERIVTPRMALTAAEYLAY
3dt2A           WKVECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEG
2c0bL           VGKSAEALQWDLSFRLKHWEAIKKAAESAPFLIHQESNVIVRAFRDYLRQDIGEILVLELARQHIAALGR
3cddC           SGAFDLETYKFQYKAFIEPIKTVDIGGERVITGYVDDWVPSYDESTITIYPSGQFNNQTLTQIADIVCKP
1e9sD           LRGDRMVIVDPNGDMLSK------FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKT--
1e9sB           LRGDRMVIVDPNGDMLSKFGRKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWA--
2awoC           ITSGDLFIGEKRMNDTPPAERGVGMVALYPHLSVAENMSFGLKLAGA--------KKEVINQRVNQVAEV
3dt4C           WKVECVGDDIAWMKFDAQG-----NLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNVAETSDGGVYWEG
2c7cH           VLAQAIITEGLKAVAAGMNPMDLKRGIDKAVTAAVEEANSDETVGKLIAEAMDKVGKEGVITVEDGLQDE
2cckB           KDYDVIMTREPGGVPTGEEIRKIVLEGDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSL
2bjbA           LGSVPVTFDGDQARGRPIAPLLDALR-ELGVAVDGTGLPFRVRGNGSL---------AGGTVAIDASASS
2dr3B           KMGEP--------------------GIYVALEEHPVQ------VRQNMAQFGWDVKPYEEKGMFAMVDAF
2akaA           SVAGRNQANGSGVLEQQILQ---ANPILEAFGNAKTTRNNNSSRFGKFIEIQFNSAGQSYLLEKSRVVFQ
2dr3F           KMGEPGIYVALEEHPVQVRQ----NMAQFGWDVKPYE-----------------EKGMFAMVDAFTAGIG
3dauA           -------------------------------------ISLIAALAVDRVIG--------MENAMPWNLPA
2c9oC           SKVPFCPMVGSEVYSTEIKKT----EVLMENFRRAIGLRIKETKKKEIIQDVTLHDLDVAGEINKVVNGI
3be4A           LAHLST--GDMLREA-IKNGIGLEAKSIIESGNFVGDEIVLGLVKEKFDLGVCVNGFVLDGFPRTGLAKI
3cioD           QSDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPLLMRDRMRQ
3c8uA           AQGLPAEVVPD-------------GFHLDNRLLEPRGLLPRKGAPETFDFEGFQRLCHALKHQERVIYP-
3bh0A           DNDDVVNLHSLEMGKKE-------NIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNINI
2b8tC           YADVKYLVFKPKIDSRTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAEN
1e6cA           YEFVDTDIFMQHTSGMTVADVVAAEGW-PGFRRRESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGT
3dymA           -----------------------------------------------------------WIGDKKQLLTP
2bkiA           ESYGTGQDI--------DDRIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGEKSRICVQ
3dt4A           WKVECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEG
1dhiA           -------------------------------------ISLIAALAVDRVIG--------MENAMPWNLPA
2b8wB           GFSLGSTVQSHTKGIWMWCV----PHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYN
1cfrA           INTTEFSKVLSGLRDFINDEAIRLGGKISDGSFNKCNWYEWLIGIRAITNFIVVKMPNATSFDVMSIYKS
3cr7A           RDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARVEV
3cmvE           REGKTCAFIDAEHALDPIYA------RKLGVDIDNLLCSQPDTGEQALEICDALARSGVDVIVVDSVAAL
1d6jB           RDRRAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEV
1e2kA           VYVPEPMTYWRVLGASETIAN------IYTTQHRLDQGEISAGDAAVVMTSAQITMGM------------
1cjaA           QQLGSLMALDVIVNNSDRLPIAWTEGNLDNIMLSERGATVVPIDSKIIPLDASHPHGERVRELLRTLIAH
2d4hB           PKKPGHILVLLDTEGLGQNDSWIFAVLLSSTFVYNSIGTINQQAMDQLYYVTELRSKSSDSADFVSFFPD
3d3qA           GEIISGDSQVYQGDIGTAKVTT--EEEGIPHYIDILPPDASFSAYEFKDITRRGKVPIIAGGTGLYIQSL
3d31A           PDSGRILLDGKDVTD------LSPEKHDIAFVYQNYSLFPHMNVKKNLEFGMRMKKIK-DPKRVLDTARD
3czpA           PRQYHIVPIAAPTEEERAQPYLWRFWRHIPARRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEINDF
1cr2A           TAMGKKVGL------AMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFH--
1e3aB           PVPGTGKWDWKGLLPFEMNPKVNSPQKDYPASDLFAFLWGGADRVTEILEQKPRLTADQAWDVIRQTSRQ
1draA           -------------------------------------ISLIAALAVDRVIG--------MENAMPWNLPA
2dflA           LPPEKGG-----------------LSGKAVYIDTEGTFRWERIENMAKALGLDIDNVM-NNIYYIRAINT
3cmtD           REGKTCAFIDAEHALDPI------YARKLGVDIDNLLCSQPDTGEQALEICDALARKAEMGLAARMMSQA
2bhjA           WGSGEILHDTLHHKAT-SCLGSIMNPKSLTRGPRDKPTPLEELLPHAIEFINQYAKIEEHLARLEAVTKE
1e59A           AKAAGKLLKEEGYSFDFAYTSVLKRLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKDEQVK
1e2gA           AAGHRAELLRFPERSTEIG-----KLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVD
2bhvD           ---------------------------KLLRTITADKMIPAFLITPISSQIAGKVIAQVESDHMGKAVLI
2drcA           -------------------------------------ISLIAALAVDRVIG--------MENAMPFNLPA
1dyhA           -------------------------------------ISLIAALAVDRVIG--------MENAMPWNLPA
3dt7A           WKVECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEG
3cddF           PFGIKVIVNTDVGEPFQRIQIEQGETPHELLARQRGVLLTSDTFGNLVITRASKTKVSLILGDNVKAARG
3bgwA           DNDDVVNLHS------LEMGKKENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNI---
1cjtC           GEKATKVQDIKNNLKEAIETIVAAMS-NLVPPVELANPENQFRVDYILSVM-------------------
1e9sM           LRGDRMVIVDPNGDMLS------KFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSPRGKTDEAE
2bbsB           PSEGKIKHS---------------GRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISK
3dffA           LDDAVLSFGAGLAQAAQDGA-------NVLVYTVFAGAAYSPAAQRHTIWGLAPDDVLYRRKEDIAALDH
3d3qB           GEIISGDSQVYQGDIGTAKVTT--EEEGIPHYIDILPPDASFSAYEFKYIKDITRRGKVPIIAGGTGLYI
3cr7D           RDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVVEV
3bb1B           VSISPFQSGPRPVMVSRSRAGFTLNIIDTPGLGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNL
5dfrA           -----------------------------------------------------IAALAVDRVIGPWNLPA
3bjdB           LPIEEARIVADALAVHATSRLAALAEAGLKGDRQAYAAY------QQLLYVLSLSDDVAT-AQTRRWLAR
2d2eA           YTVERGEILLDGENILELSPDE--RARKGLFLAFQYPVVPGVTIANFLRLALQAKLGREVGVAEFWTKVK
3bo6B           AHRENPQCKGDFAGDKFHIS---VQREQVPQAFQALSGLLFSVDSPIDKWKVTDMERVDQQSRGAQFTLY
3cm0A           FKKLSTGDILRDHVARGTP-----LGERVRPIMERGDLVPDDLILELIIFDGFPRTLAQA-EALDRLLSE
4dfrA           -------------------------------------ISLIAALAVDRVIG--------MENAMPWNLPA
2d4hA           GFSLGSTVQKGIWMWCVPHPK---KPGHILVLLDTEGLGDVENQNDSWIFALAVLLSSTFVYNQAMDQLY
3ch4B           ADVCAVLRLSGPLKEQYAQE----HGLNFQYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPITRRV
1ai4B           PVPGTGKWDWKGLLPFEWNNSPQKDYPASDLFAFLWGGADRVTEIDRLLEQKPRLTADQAWDVIRQTSRL
3clvA           HENTNTTIGASFCTNLNDNYNENLIKFDIWDTAGQERYASIVPLYYRGATCAIVVFNSNTLDRAKTWVNQ
1eilA           -------------------------------------------------------------YLGFAVKDV
2bx2L           KSAEALQWDLSFRLKHWEAIK-KAAESRPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQH
2eg5G           DKVGQLERPTIQIFLNDLFPNDNSVFKLLPSFYRKLEKENGRKIGSCLIGAMPGSFYRLFPEESMHFLHS
3bb1C           VSISPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKLDKTIDVLLYVDRLDAYRVDNL
2bhvA           ---------------------------KLLRTITADKMIPFLITPISSQIAGKVIAQVESDIFAHMAVLI
3dfpC           ----------------------------------------------------------------------
1cr0A           TAMGKK----------------VGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDE
3dfnC           ----------------------------------------------------------------------
2dr3C           KMGEPGIYVALEEHPVQVRQ----NMAQFGWDVKPYEEKGMFAMVDAFTAGIGEYEKYIVHDLTDI----
1dw9A           LPADAARLVGAKLDLDEDSILLLQIPLRRIPTDPTYRFYELQVYGTTLKALVHEKFGDGIISAINFKLDV
2awoA           ITSGDLFIGEKRMNDTPPAE----RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEV
2ahwD           PTGLGDRADRGISPLAQEGL----VKWALCGHWG-QSPRISDLAEQNKIIAYNYPQGVLTQAHQPGIISD
1e2hB           RDDIVYVPEPMTYWRVLGASYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHISPPPALT
2d3wC           YEVTGGTVEFKGKDL-LALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRALLK
3bb1E           VSISPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSDKTIDVLLYVDRLDAYRVDNL
1bglA           ----------------------------------------------------------------------
3bk7A           PTEGKVE-----------------WDLTVAYKPQYIKAEYEGTVYELLSKIDSSKLNSNFY--KTELLKP
3cmuA           REGKTCAFIDAEHALDP------IYARKLGVDIDNLLCSQPDTGEQALICDALARSGAVD---VIVVDSV
3bgwD           DNDDVVNLHSLEMGKKE-------NIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNINI
1ak2A           VCHLATGDMLRAMVASGSELGKKLTMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLD
2d3wA           YEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQD
3dfqA           ----------------------------------------------------------------------
2ccjA           KDYD------------VIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPKEGKV
3dfnD           ----------------------------------------------------------------------
3cbnA           -LRYTLRARGHPNVTA--------GHRTTFEVTVD----PEIGETADCIIGVSSSDSISTLPDEKRAIAR
2boeX           ---------------------------------------PNMSSAEWVRNNPNDPRTPVIRDRIASVPQG
1dekA           AVKYQLAGPIKDALAYAWGVFAANTKEFEGIDYDRETNLNLTKLEVITIMEQAFCNGKSPIKGVFVFDDE
1e9rE           LRGDRMVIVDP------NGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGK---
1akeA           IPQISTGDMLRA-----AVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTI
2bbtB           PSEGKIKH----------------SGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDIS
1cs4C           GEKATKVQDIKNNLKEAIETIVAAMS-NLVPPVELANPENQFRVDYIL----------------------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2b8tD           YADVKYLVFKKSIRNIQSRTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDANILAENGFV
1adoA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
3ecpA           AADWAKSVFSSA--ALGDPRRT----ARLVNVAAQLAKYSGKSITIS---------SEGSKAAQEGAYRF
2d3wD           YEVTGGTVEFKGKDLLALSPEDR-AGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFLLK
1e9rF           LRGDRMVIVDPNGDMLSKFGRILNPYDQRTKGWSFFNEIRNDYDWQRY--------ALSVVPRGKTDEAE
3crmA           CELISVDSALIYRGMDIGTA----KPSRELLARYPHRLIDIRDPAESYSAAEFRADALAAMAKATARGRI
2ahvA           PTGLGDRADRGISPLAQEGLV----KWALCGHWG-QSPRISDLAEQNKIIAYNYPQGVLT-QTLRAAAAD
6aldA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3bb1F           VSISPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRV
3dfqC           ----------------------------------------------------------------------
1culC           GEKATKVQDIKNNLKEAIET----IVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFY----
3bb1A           VSISPFQSEGPRPVMVSRAGFTLNIIDTPGLIEGGYINDMALNIIKSLLDKTIDVLLYVDRLDAYRVDNL
1ek0A           AENKEPTIGAAFLTQRVTINEHTVKFEIWDTAGQERFASLAPYYRNAQAALPQSFIKARHWVKELHEQAS
1e4vA           IPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADA
3dfoC           ----------------------------------------------------------------------
2d2fA           YTVERGEILLDGENI-LELSPDERARKGLFLAFQYPVEVPGVTIANFLRLAEVGVAEFWTKVKKALELLD
1drbA           -------------------------------------ISLIAALAVDRVIG--------MENAMPWNLPA
3dftC           ----------------------------------------------------------------------
4atjA           ---------AASILRLHFEDCFVNGCDASILLDNTTSFRTEKDAFGNANSARGFPVIDRMKAAVESACSC
1bccF           ------------------RWLEGIRKWYYNAAFNKYGLMRDDTIYENDDVKEAIRRENLYDDRMFRIKRA
2ausC           ---------------------------------------------EVIVKDDKAETNPKWGFPPDKRPIE
1e9sH           LRGDRMVIVDPNGDMLSKFGR------DKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSPRGKTDEAE
1accA           GPNGNLQYQGKD----------------ITEFDFNFDQ----QTSQNIKNQ----LAELNATNIYTVLDK
2czvB           KVAILLSNPKPSLVRDTVQKF----KSYLIYVESNDLRVIRYSIEKGVDAIISPWVNRKDHVLAKLMVKK
1b0uA           PSEGAIIVNGQNINLVRDKDGQLKVRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDARERALKY
3cnlA           KGIQWFSLENGVKILDTPGI---LYKNIFSEDLAAKLLLVGSLPVERIEDQ--RIFERAFEIFARSIGIE
1d6jA           RDRRVAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTAR----
3di4A           LHDLTERFFSGKTRALHGT-----HVTTGERLWSNLPYLRPATIIEDTLGWYGIDQYGGSVHDVIGTRCD
2dr3D           KMGEPGIYVALEEHPVQVRQ----NMAQFGWDVKPYE-----------------EKGMFAMVDAFTAGIG
1e9sL           LRGDRMVIVDPNGDMLS------KFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSPRGKTDEAE
3ec1A           GKGNVITTSYFPGTTLDMIEIP----LESGATLYDTPGIINHHQMAHFVDARDITPKREIHPRVYQLNEG
3a00A           DSFGFSVSSTTRTPRAG-------EVNGKDYNFVSVDEFKSMIKNNEFI-------EWAQFSGNYYGSTV
2d4uB           -----------------------LNRAGIRYMMDQNNIGSGSTVAELMESQAEKNWADYE-ALPRDPRQS
2an9A           LY-----DTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLA
2anbA           LYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGV--
2aunB           ---------------------------------------TWQPIDGRVIAPASAIATEVL-EATLRQLEV
1e9sE           LRGDRMVIVDPNGDMLS------KFGRDKDIILNPYDQRTKGWSFFN-EIRNDYDWQRYALSVVPRGKTD
3bv4A           ----------------------------------------------------------------------
1e2iA           YWRVLGASETIANIYTTQHRLDQGEISGDAAVVMTSAQITMGMPYAVTVLAPHIGGEAGPPPALTLIFDR
2ancD           LYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVD-
2bofX           PNMSSAEWVRNNPNDPR-----------TPVIRDRIASVPQGTWFAHHNPGQITGQVDALMSAAQKIPIL
2a1fF           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
3c7kC           DGF---------------SGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGVEYGDKERKTDSKMVCDVVSR
2aunA           -------------------------------------WQPIDGRVALIAPASAI--ATEVLEATLRQLEV
3brwA           RTY---------------------HDVIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRLIVTF
3cr7B           RDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNAITSFISPYRKDRDTARQLHEV
1dp0A           -------------------------------------------------------------KKQLLTPLR
2ancF           LYDTQEAIEQVLATGVDVFLDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQA
2bv7A           MYGA-------EWPKVGATLALMWLKRGLRFIQVFLQSICDGERDENH------------PNLIRVNATK
3bczC           ARAIIAPHAGYTYCGSCAAH----AYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQ
1e9rD           LRGDRMVIVDP------NGDMLSKFGRDKDIILNPYDQRTK-----------------GWSFFNEIRNDY
3b55A           --------------------------------------------------------------YNTNQIAK
3d1mB           ------------------------------------------------------------------KQFI
3c15C           NGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYI-----------------------
1c9kC           QVLYIAT--------SQILHHKDGRPAHWRTARHLDTLITADLAPDDAILLECITTMVTNLLFALGD---
1e9sI           LRGDRMVIVDPNGDMLSK------FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR-------------
2aumB           -------------------------------------WQPIDGRVALIAPASAIATEVL--EATLRQLEV
3c7kA           GEDVKQYKPVVYSNTIQSLAAIVRAMDTLGVEYGDKERKTDSKMVCD-----------------------
3dlbB           ------DLWVSDSGAFLLEVDPAYRILCEMSLEAWL----AQGHPLPKRVRNAYDRRTWELLRLGEEDPK
3bs4A           KSDNLVGMFSISYPLQLIIR----ILSRFGVDVIKYLENHRLAIVDTFGSFHGIMPGVWYLEGMETLPIK
1e2jA           YVPEPMTYWRVGASETIANIYTTQHRLDQGEISAGDAAVVMTSANITMGMPYAVTDAVLPPPALTLIFDR
3dvlD           IEFDEPGVFVTFEETPQDII---KNARSFGWDLAKLVDEGKLFILDASPDP-----------EGQEVVGG
3bb1G           VSISPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRV
1azsC           NGEKATKVQDIKNNLKEA------IETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPP----
3cmvB           REGKTCAFIDAEHALDPI------YARKLGVDIDNLLCSQPDTGEQALEICDALARSGVD----VIVVDS
1e2mB           RDDIVYVPEPMTYWRVLGASYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSP
2ancB           LYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATG---
3d1mA           ------------------------------------------------------------------KQFI
1e9rG           LRGDRMVIVDPNGDMLSKF------GRDKDIILNPYDQRTKGWSFFN-EIRNDYDWQRYALSVVPRGKTD
1bmfC           RFNDGTDEKKKLYCIYVAIGQ------KRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAP----
3e8aC           NGEKATKVQDIKNNLKEA------IETIVAAMSNLVPPVELANPENQ-----------------------
1e2nA           RDDIVY--VPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPH
1eamA           NLGVIIKWMLIDGRHHDPILNLRDVTLVTRFVDEEYLRSIKKQLHPSK---------IILISDVRSPSTA
2aumA           -------------------------------------WQPIDGRVALIAPASAIATEVL--EATLRQLEV
2c9gA           NGVLESDIG-------------------------------------------------------------
2e85A           ------------------------------------------SAVTDVLLC--VGNSMMGDDGAGPLLAE
3bwdD           PFSANVVLGLWDTAGEDYNRLRPLSYRGADVFILAFSLISKASYENV---SKKWIPELKHYAPGVPIVLV
3dfdA           --YARIAVETTVYPTFKAKE----LREAYKTEDPVEVAKRVLSVGGEYANWLNKAIE-------------
3cueF           STIGVDFKIKTVELD-GKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQENGVKMWLQEIDRY
3bb1H           VSISPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIK--------------SFLLDKTI
2bkeA           LPPEKGG--------------------LSGKAVYIDTEGTFRWERIENAKALGLDIDNVNNIYYIRAINT
2ck3C           RFNDGTDEKKKLYCIYVAIGQ----KRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYL--------
2dftA           VGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSVTSPGVRAALAGHTVVYLEI
3c14C           NGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELAN---------------------------------
3a00B           DSFGFSVSSTTRTPRAG-------EVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASV----
2a1fD           ----------------------------------------------------------------------
1e1qB           RFNDGTDEKKKLYCIYVAIG----QKRSTVAQLVKRLTDADAMKYTIVVSATASDAASMGEYFRDNGKHA
3cnnA           GIQWFSLENGVKILDTPGILYKNIFSEDLAAKLLLVGSLPIEDQRIFERAFEIFARSIGIESSFSEFFE-
2d7vA           VFSGTSKPTLQQLEKHH-------LAHENCFIANSVE---------------------------------
2d7vB           VFSGTSKPTLQQLEKHH-------LAHENCFIANSVE---------------------------------
2awnA           ITSGDLFIGEKRMNDTPPAER-------------------------------------------------
3dyoA           -------------------------------------------------------------KQLLTPLRD
2dftC           VGLLDTDVAIEQRTGRSIADIFA-TDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHT
1ckvA           KKNVNPTVNVEDRAGYWWIKANGKISELLGRQFNVYDFLVDVS---------------------------
1dvrA           AAHLA-----TGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIELTNNPACKNGFILVGFPRTIP
1av6A           NLGVIIKWMLIDGR---HHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSN
1e2iB           RDDIVYVPE------------PMTYWRVLGASETIANIYTTQHRLDQG----EISAGDAAVVMTSAQITM
3bm2B           --------------------------------ALELLINRR-SASRLAEPAPTGEQRAGRAPDWHFFVIG
1cjuC           NGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELAN---------------------------------
1e2mA           YVPEPMTYW-------RVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPH
2bbtA           PS---------------EGKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISK
1cjvC           EKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANP----------------------------------
2a5vA           LPGGYV-----------RDVVERVAPSV-LLGRRDGLSRVDEFEQRHVHETVAIRSSAISERIAGGSLAI
2e85B           ----------------------------------------------------------------------
3c85A           PGHAQVLILGGRIGTGAYDELRARYGKIS-LGIEIREEAAQQHRSEGRNVISGDATDPDFWERILDTGHV
2a5vB           LPGGYVRDVVERV------------APSVLLGRRDGLSRVDEFEQRHVHETVAIRSSAISERIAGGSLAI
3cphA           NPSFITTIGIDFKIKTINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIYDVTDERTFTNIKQWFKTVNE
3csuA           LSRDDLNVLATAAKLKANPQPELLKHKVIASCFFRTRLSFETSMHRLGASVVGFSDSGKKGETLADTISV
2cbzA           K------------VEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILP
1afrA           CWQPQDFLP-------------------------------------------------------------
2dpyB           ADVIVVGLIGERGREVKDFIENILGPD-GRARSVVIAAPADVSPLLRMQGAAYATRIAEDFRDRGQHVIM
3dkvA           YGIPHISTGDMFRAAMKEET---PLGLEAKSYIDKGELVPDEVTIGIVRERLSKERGFLLDGFPRTVAQA
3bb1D           VSISPFQSEGPRPV---MVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDA
1e2nB           RDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVITMGMPYAVTDAVLHIGGEAGSPPA
1e2lA           PEPMTYWRVLGASETIANIFTTQHRLD-QGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSP
2b0lC           ----------------------------------------------------------------------
2cdnA           IPQIST--GELFRR--NIEEGTKLGVEA-KRYLDAGDLVPSDLTNELVLNNPDAANGFILDGYPRSVEQA
1e9rB           LRGDRMVIVDPNGDMLSKFGRILNPYDQRTKGWSFFNEIRNDYDWQRY----------------------
1ckeA           LDSGAI-YRVLALAALASEDALVPLASHLDVRFVSTNGNL-----EVILEGEDVSGEIRTQEVANAASQV
2awoD           ITSGDLFIGEKRMNVGMVEPSVFLLDEPLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIV
1e2lB           ------LGSRDDIVYVPE---PMTYWRVLGASETIANIFTTQHRLDQGEISAGDAAVVMTSAQITMGMPY
2aexA           ----------------------------------------------------------------------
1e9sA           LRGDRMVIVDPNGDMLSKFG----RDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAE
3cqcA           ----------------------------------------------------------------------
3dm5B           KRGY--------------------KVGVVCSDTWRPGAYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGV
1e2hA           YVPEPMTYWRLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLPPPALTLIFDR
2dpyA           ADVIVVGLIGERGREVKDFIENILGPD-GRARSVVIAAPADVSPLLRMQGAAYATRIAEDFRDRGQHVSL
3b85B           SKQVSRIILTRPAVE---------AGEKLGFLPDPYLRPLHDALRDVE---PEVIPKLEAGIVEVAPLAY
2a1fE           ----------------------------------------------------------------------
3ed8A           VEDGSVQLADHYQQNTPIGDGPVLLPD-NHYLSY------------------------------------
2a1fC           ----------------------------------------------------------------------
1e2kB           RDDIVYYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAHAPPPALTLI
1d2zD           FSAADFVALDFLNESTPARPVDGPGA-LISLELL------------------------------------
1d8jA           ------------------------------------------------------------------GDTH
1d6aA           -KTNFNRAFNPNPKVLNLQE--TWGKISTAIHDAKNGVLP------------------------------
2bboA           ----------------------------------------------------------------------
3cbqA           DSAHEPENPEDTYERRIMVDKEEVTLVVYDIWEQGDAGGWLRDHCLQTGDAFLIVFSVTDRRSFSKVPET
1chdA           ----------------------------------------------------------------------
2bhvC           ---------------------------KLLRTITADKMIPAFLITQIAGKVIA-QVESDIFAHMGKAVLI
2ax4B           HAIPCYSLDGDNVRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIHES
2ax4A           HAIPCYSLDGDNVRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIHES
2axnA           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
1e2jB           RDDIVYVPEPMTYWRVLGAS----ETIANIYTTQHRLDQGEISAGDAAVVMTSANITMGMPYAVTDAVLA
3do6A           IGKKSI----------------------------------------------------------------
1agpA           VDEYDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRV
3b9qA           ----------------------------------------------------------------------
2bwjB           FTHLSTGLLREELASESERSK-------------------------------------------------
1e9sK           LRGDRMVIVDPNGDMLS------KFGRDKDIILNPYDQRTKGWSFFN-----------------------
2a78A           VEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFTEMESFAATADFREQILRVK
1dapA           PDFTASSQIAFGRAAHRMKQQGQSGAFTVLEV--APYLLSPENLDDLI----------------------
2bwjD           FTHLSTGLLREELASESERSK-------------------------------------------------
2c95B           QKYGYTHLSTGDLLRSEVSSGSARGKKLEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFDGYPREVQQG
2c9oA           ----------------------------------------------------------------------
2bwjF           FTHLSTGLLREELASESERSKLIRDIMERG----------------------------------------
3cddA           GQACTVDIGGERVTGYVDDWVPSYDESTITISVSGRDKTADL-VDCSIDYPSGQFNNQTLTQIADIVCKP
3cr8B           -----------------------------------------------------------------YGGTL
2dx7A           DRTAYILGKGEDPRPQLIWTAKRLEECGADFIIMPANFVEDIRKAIKIPIISMIEETAKKVKELGFKLLA
3cddB           YKAF------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
3cddE           -FLGNDAQYKAFIEPIKQQACTVDIGGERVITGYVDDWVPSYDESTITIYPSGQFNNQTLTQIADIVCKP
3dmdA           ----------------------------------------------------------------------
2ekbA           --------------------------------------------------------------RARRTAEL
3e70C           N---------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2ck3A           ----------------------------------------------------------------------
2bwjC           FTHLSTGLLREELASESERSKLIRDIMERG----------------------------------------
2bsqE           ----------------------------------SVV--IRNLSEAAIKFRARAAGRSTEAEIRLILDNI
3dsrB           VPGSESAF--------------------------------------------------------------
1delB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TGLADRLEHLPAKLSGGQQQRVAVARALVGSPEVLYADEPTGNLDSRSGAEVLSFLRDSVRELGQTIVMV
3b5jA           EGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHK--ICKGRTVIII
3dmdC           HAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIIL
2d3wB           MPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSLDI-DALKVVADGVNSLRDGKRSFIIVT
3c95A           LLFNYRARNFPGTLDYAEQQRWLEHRRQVFTPEFL--QGYADELQMLVDKEKVALLKA-LWQYADEIV--
2dwpA           YLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKI-SSPDYKDCNSA
2ccgA           VLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQ-NRLDQED
2ccjB           VLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKN-NRLDQEDLKFH
2ccgB           VLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSLDQEDLKFHEK
3cmvG           TPKAEIEGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLRIGAVKEGENVVGSETRVKV
3cmvH           EGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIG-AVKEGENVVGS
2c03B           KARLEARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVL
1e9cA           RYAFSGVAYTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFG-----HERYENGAFQERAL
2a2zD           YESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHREQGIPLEYLEKLHYKHESWLLHR
2c61B           YTDLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELHR-----KGIYPPI
3b60A           NGLDTIIGENGVLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQK--NRTSLVI
2bifA           FLSEEGGHVAVFDATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPD-YVNRDSD
2dwoA           YLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKI-SSPDYKDCNSA
1d1cA           QSETERNYHIFYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITR--QAMDIVGFSQ
1e69A           IRKPGRRDQKLSLLSGGEKALVGLALLFALMSPFYVLDEVDSPLDDYNAERFKRLLKENSK--HTQFIVI
3eiuA           YTDLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELH------RKGIYPP
2czvA           NVALGFSLRPLLYSNPYERANLAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLG----VVIGMEIPQA
1e9dA           RYAFSGVAYTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENG-----AFQERAL
1e98A           RYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENG----AFQERALR
2akaB           DLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKE-VDPQGQRTIGVI
3eiuB           YTDLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELHR-----KGIYPPI
3dmdB           HAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIIL
3dm5A           YFKSKGVDIIIVDTAGRHKEDKALIEEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEATPIGSIIV
2b8tA           VIISGLDKNFKGEPFGPIAKLFTYADKITKLTAICNECGAEA-------THSLRKIDGKHADYNDDIVKI
1bifA           FLSEEGGHVAVFDATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKL-GSPDYVNRDSD
3cmvC           TPKAEIEGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRAVKEGENVVGSETRVKV
2b8wA           ELTHRIRSKSVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFP
2cjwB           VGNKSDLVRREVSVSEGRAAVVFDCKFIETSAAVQHNVKE--------------------LFEGIVRQVR
2cgtH           LDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEG
2a30D           YESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLNEEQGIPLEYLEKLHYKHESWLLHR
3cmvA           ----EICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFI
2c03A           --RLEARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVL
2cckA           EGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIRLDQEDLKFH
1e9fA           RYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQL------------ADAAKRYENGAFQERAL
1e2dA           YAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQL
2axzC           EIVSNLLNVLPYEEVSSIIKPYPIVDSFGKDYDLTIQTVLKNALTISINRNLKEAQYYINQFIKNISING
2dr3E           ---------------IREFIEVLRQAIRDINAKRVVVDSVTTLYIPAMARSIILQLKRVLAGTGCTSIFV
2a30B           YESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHREQGIPLEYLEKLHYKHESWLLHR
2a2zA           YSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGI
1e9sG           ----YALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAES
2bbsA           SKFAEKDNIVLITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRIL-V
1e9sF           ----YALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAES
2dr3A           IGKEYEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILKRVLAGTGCTSIFV
1aroP           LALHESYEMGEARFRKMFERQLLITTLLPKMIARINDWFEEVKAKRGKRPTAFQFLQEIKPE-AVAYITI
3d3kA           LVINCLDCPENVFLRDQPWYKAAVAWANQNRAPVLSIDPPVH-IDAKWSLALGLPLPLGEHAGRIYLCDI
2a5gA           DAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTS------------
2c04A           KARLEARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVL
1dkiA           ISVDMDYGPSSGSAGSSRVQRALKENFGYNQSVHQINRGDFSKQDWE-------AQIDKELSQNQPVYYQ
4dcgA           RCPFPAQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKNKVVV
3dhwC           VGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRLGLTILLI
3czpB           SEYGIIVVKFWLAIDKQTQERF-KEREKTPYKRYKITEEDWRNRD------KWDQYVDAVGDVDRTTEIA
1cr4A           LFGNDTFHLYDSFAEAETLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFA---KSTGVVLVVI
2a30A           RYIFASNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHREQGIPLEYLEKLHYKHESWLLHR
421pA           KDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQ--------
1e2fA           RYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYE----NGAFQERALR
2axpA           VYLHALRVRGDEYIEGKDIDSILELYREVSNAGLHTYSWDTGQWSSDEIAKDI-----------------
2a2zB           YESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHREQGIPLEYLEKLHYKHESWLLHR
3b85A           DEAQNTTPAQKFLTRLGFGSKVVTGDGLRLVRHIL-RGVDDVHFSELTSSDVVRLVGHIVDA--------
3a1wA           LLLEILEMEKKVILAMTAIDEAKKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQ---------
2ctsA           KHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYA--------------------------------
2bc9A           LAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSDFVSFFPDFVWTLRDFSLDLEALTPDEYLTY
1e4yA           AQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKV
3b2qB           YTDLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELHR------KGIYPP
1e9rA           EWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVL
3b2qA           HGMHVLVILTDITNYAEALRQMGAARNE---VPGRRGYPGYMYTDLATLYERAGIVKG-AKGSVTQIPIL
2c9yA           DLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLI--RRSDDNE
1bg0A           MEDELKGTYYPLGMSKATQQQLIDDHFLFKEGDRFLQTANACRYWPTGRGIFHNDAKTFLVWLRIISMQK
3dm9B           -QHAKARGIDVVLIDTAGRSETNRNLDEKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIIL
3cmxA           LKQSNTLLIFINQIRNPETTTGGNALKF-YASVRLDIRRIGAVKEGENVVGSETRVK------VVKNKIA
3cr7C           AEQRDPKGLYKKAREGVIKEFTGISAPYE-APANPEVHVKNYELPVQDAVQIIDYLDT------------
2a5jA           SSSNMVIMLIGNKSDLESRRDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGL--
1e3mB           IGSYVPAQKVIFTRVGTFVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACENLANKIKALTLFA
2b8tB           VIISGLDKNFKGEPFGPIAKLFTYADKITKLTAICNECGAEATHSLR--------KIDGKHADYNDDIVK
1e0jB           YDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVI
3cmwC           DSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGN
1e3mA           AQKVEIGPIDRIFTRVGFVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACAELANKIKALTLFA
2awnB           LQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYV
2c4rL           PDFSSKIKLYTGEIPLFSHYQIESQIESAFQRGGSIVIDSTEALTAIDINSARGDIEETAFNTNLEAADE
2awnC           LQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYV
3da4A           GIIGESLTRLGAMFSGKEYQILLPGEIHIKES--------------------------------------
3bpbA           IGESARTNAEGARQMIAILEKHGLSGSVVRLEKVLGLKTGLAYLEHNNLLAAGE-FVSKPEFQDFNIIEI
2bdtA           IILWTNREELLRRDALRKKGERCLELVE--EFESKGIDERYFYNTSHLQPTNLNDIVK-NLKTNPRFI--
2bwjA           EEFGRRIGDPQLVICMDCSADTMTNRLLQMSRSSLPVDDTTKTIAKRL-EAYYRASIPVIAYYETKTQLH
2d4uA           TAAAAEIKRNYDIYHNALAELIQLLGAGKINE---FFDQPTQGYQDGFEKQYVAYMEQ-NDRLHDIAVSD
1dhjA           SLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGG
2bkhA           GKEERNYHIFYRLCAGASEDIRERLHLSPDNFRYLNRGCTRYFANKETDKQILNRKSPEYLKAGSLKDPL
1dekB           LEVITIMEQAFCYLNGKSPIKGVFVFDDEG-KESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVN
3dtbB           IDEPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWGVPIEGIIFGGRRPAGVPLVYE
1e0jA           YDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVI
2d62A           LGLTELLNRKPRELSGGQRQRVALGRAIIRRPKV-FLDEPLSNLDAKL-RVKRAELKKLQRQLGVTTIYV
1dg3A           LTHRIRSKSDSADFVSFFPDFVWTLRDFSLDLQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFP
1e9sJ           -------SVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAES
3cddD           FGIKVIVNFQRIQIEQGETPHELLARLAKQ-RGVLLTSDTFGNLVITRASKTKAGVS---LILGDNVKAA
1cr1A           LFGNDTFHLYDSFAEAETDRLLAKLARSGLGCDVIILDHISIRKMI---DNLMTKLKGFAKSTGVVLVVI
3d7wA           PLGIDQLIQSVTALRFPGGQTKTQARSILILIQMI--SEAARFNPIL---WRARQYINSGASFLPDVYML
2cvfA           VVVDSITAHYVLLWIARKHNIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILRLDK-LPKPGLRVAVL
2b92B           VTELTHRIRSKSSFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYS-LKLKKGTSQKDETFNLPRLCI
3adkA           EEFERKIGQPTLLLYVDAGPETMTKRLLKRGETSGRVDDNEETIKKRL-ETYYKATEPVIAFYEKRGIVR
2awnD           QVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAPKMNFLPVKVTATAIDQVQVELPMPNRQQVWL
2d0kA           DLAWFKRNTLNKPVIYGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAAGDVPEIFVIGG
2c61A           EHGMHVLVILTDITNYAEALRQMGAARNEVPGRRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMP
3dt2A           IDEPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIRPAGVPLVYE
2c0bL           PDFSSKIKLYTGEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEAIEETAFNTNLEAADEIARQLR
3cddC           FGIKVIVPFQRIQIEQGETPHELLARLAK-QRGVLLTSDTFGNLVITRASKTKAGVS---LILGDNVKAA
1e9sD           ---------------DEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGAESLF
1e9sB           ---SYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVL
2awoC           LQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYV
3dt4C           IDEPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPPEGVPIEGIIFGGRRPAGVPLVYE
2c7cH           LDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEG
2cckB           AYQGGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQEIIRFKSVNA
2bjbA           QFVSGLLLSAAS--FTDGLTVQHTGSSLPSAPHIAMTAAMLRQAGVDIDDSTPNRWQVRPGPVAARRWDI
2dr3B           TAGIGEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKMARSIILQLKRVLAGTGCTSIFV
2akaA           SETERNYHIFYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEE----FKITRQAMDIVGFS
2dr3F           KSKEYEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYKPAMARSIILQLKRVLAGTGCTSIFV
3dauA           DLAWFKRNTLNKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGG
2c9oC           AELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMII
3be4A           LSEIGDSLTSVIYFESGRCTHPASGRIYHVKYNPPKQPGIDDVTGEPLVWRDDDNAEAVKVRLDVFHKQT
3cioD           LLEWANDHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQGVNIKGAILNGV
3c8uA           --LFDRARDIAI---AGAAEVGPECRVAIIEGNYLLFDAPGWRTAIWDVSIRLEVPADLEARLVQRWLDH
3bh0A           FDKAGQSVNYIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQSRDLKKMARELDVVVIAL
2b8tC           GFVVILDKNFKGEPFGPIAKLFTYADKITKLTAICNECGAEATHS-------LRKIDGKHADYNDDIVKI
1e6cA           VVYLFAPAEEHQRPTLTGRPIAEEMEAVLREREALYQDVAHYVVDATQPPAAI--VCELMQTM-------
3dymA           LRDQFTRAPLDNDIGVSEATRIDPNAWVWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFI
2bkiA           GKEERNYHIFYRLCAGASEDIRERLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYLKAGSLKD
3dt4A           IDEPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIRPAGVPLVYE
1dhiA           SLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGG
2b8wB           SIGTINQQAMDQLYYVTELTHRIRSKSSVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTS
1cfrA           C-LSEFIYDLRSKLTSNPDFSIIDIRGRREELKSMLKDISFSNISLSTISEIDNLYKNFIDYAELEHIKS
3cr7A           AEQRDPKGLYKKAREGVIKEFTGISAPYAPANPEVHVKNYELPVQDAVKQIIDYLDT-------KGYLP-
3cmvE           TPKAEIEGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETR
1d6jB           ATPGEETGLPFVEVYVDVPVEVAEQRAPYEAPANPEVHVKNYELPVQDAVQIIDYLDT------------
1e2kA           -PYAVTDAVLAPHIGGEAGPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNI
1cjaA           ESSQFHSIRDI--ITLYTGYDVGTEGSISMQEGFLATVRECASFDLDAFERELLSWQESLQKCPQAIPFI
2d4hB           FVWTLRDFSLDLEADGQPLTPDEYLTSLKLKKGTSQKDRPVHRRKLAQLEKLQDEELDPEVQQVADFCSY
3d3qA           LYNYAFEISEDKKQVKLKEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKLKKVQQFTENYDTLLIGI
3d31A           LKIEHLLDRNPLTLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNKLTVLHI
3czpA           EEQLSEYGKFWLAIDKQTQERF-KEREKTPYKRYKITEEDWRNRDKTSTEIAPWTLVEANDKRFARVKVL
1cr2A           -------LYDSFEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFA---KSTGVVLVVI
1e3aB           DLNLRLFLPTLQAATQSDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVW-LTSMLKRTVVAAVPM
1draA           ELAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGG
2dflA           DHQIAIVDDLQELVSKDPSIKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLTRLAEVYDIAVIIT
3cmtD           MRKLAGNLKQINQIRMKNPETTTGGNALKFYASVRLDIRRIGAVK-----EGENVVGSETRVKVVKNKIA
2bhjA           IETTGTYQLTLDELIFATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYATNNGNIRS
1e59A           QWRRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRV-IPYWNETILPRMKSGERVIIA
1e2gA           RYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGERYENGAF---------QERAL
2bhvD           PKGSKVIGYYSNNNKMGEYLDIVWSRIITPHGINIMLTNGYNGLVGELIERNFQRYGVPLFGDYLLMQLM
2drcA           DLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGG
1dyhA           DLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGG
3dt7A           IDEPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEEGIIFGGRRPAGVPLVYE
3cddF           RFSWRQRFSKFTIKAAGIKADVTDSEIGRYRPLIIVNEEVTTAEGAAKRGQWERQRSI--GKSNAEYTVT
3bgwA           ----NIFDKAGQSVNYIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQIARELDVVVIAL
1cjtC           ----------------------------------------------------------------------
1e9sM           EWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVL
2bbsB           FAEKDNIVLGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVC-KLMANKTRILV
3dffA           LRVAHRHGRFLDSIRKLPDGRWLTAHVEGRQKLAVNDHSPDSDHDLVG--EVADDIRSIIDEFDPTLVVT
3d3qB           QSLLYNYAFEDKKQVKLKLKELELNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKNYDTLLIGI
3cr7D           AEQRDPKGLYKKAREGVIKEFTGISAPYEA-PANPEVHVKNYELPVQ--DAVKQIIDY-LDTKGYLP---
3bb1B           DKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLASDIPVVLIENS
5dfrA           DLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGG
3bjdB           AIYRVEERFPAADLSRALEQEIAAQSRERHPSQYVFGSASRAQLQVFLRHQWFRTFRLYRDAA--DLLVN
2d2eA           KLLDWDESYLSRYLNEGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVIT
3bo6B           VKPDQENSQYSASSLHNTRQFIECLESRLSESGLMPGQYPESDVHPENWKYVSYRNEL-RSGRDGGEMQA
3cm0A           TGT-RLLGVVLVEVPEEELVRRILRRALEGRSDDN--EETVRRRLEVYREKTEPLVGYYEARGVLKRVDG
4dfrA           DLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGG
2d4hA           YVTELTHRIRSKSSPDESADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSCIRKFFP
3ch4B           SDIQWFREAYGAVTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRLK---------
1ai4B           RLFLPTLQAATSGLTQSDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSM-LKRTVVAAVPM
3clvA           LKISSNYIIILVANKIDKNFQVDILEVQKYAQDNNLLFIQTSAKTGTNIKNIFYMLAEEIYK--------
1eilA           PAWDHFLTKSVGLMAAGSAGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDDAALERMADKLRQAGVAF
2bx2L           PDFSSKIKLYTGEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSA-RGDIEETAFNT
2eg5G           CYCLQWLSQVPSGIYSSKASRLPVQKAYLDQFTKDFTTF----LRIHSEELFSHGRMLLTCICKGVELDA
3bb1C           DKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASL--KSDIPVVLIE
2bhvA           PKGSKVIGYYSNNNKMGEYRDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYGTSAFGDYLLMQLM
3dfpC           --------SHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRR-FYRQLLL
1cr0A           LFGNDTFHLYDSFAEAETDRLLAKLAYMRSGCDVIILDHISIRKMID---NLMTKLKGFAKSTGVVLVVI
3dfnC           --------SHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRR-FYRQLLL
2dr3C           ----------------REFIEVLRQAIRDINAKRVVVDSVTTLYIPAMARSIILQLKRVLAGTGCTSIFV
1dw9A           VADPEGGERAVITLDGK-----------------------------------------------------
2awoA           LQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYV
2ahwD           IGIGTFVDPRQQGGKLNEVTKEDLIKLVEFDNKEYLYYKAIAPDIAFIRATTCDSEGYATFEDEVMYLDA
1e2hB           LIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLAMLAA
2d3wC           MPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDDIDALKVVADGVNSLRDGKR--SFIIVTH
3bb1E           DKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASL-KKASDIPVVLI
1bglA           -------------VSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFI
3bk7A           LGIIDLYDRNVEDLSGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNEKTALVV
3cmuA           AALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQ--------------------------------
3bgwD           FDKAGQSVNYIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQIRDLKKMARELDVVVIAL
1ak2A           DLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDIGEPLIRRSDDNKKAL
2d3wA           LMEEKIALLKNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDG-KRSFIIV
3dfqA           --------SHPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRR-FYRQLLL
2ccjA           VLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSNRLDQEDLKFH
3dfnD           --------SHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRR-FYRQLLL
3cbnA           ESLVRVILRTENGLTLDHPTDIVCRKSDYICSRTLIRADKAAFDLDENLVRDLR---------KGRELKV
2boeX           TWFAH---HNPGQITGQVDALMSAAQAAGKIPILVVSNAPGRDCGHSAYRSWIDEFAAGLKNRPAYIIVE
1dekA           GKESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPD
1e9rE           --------------TDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLSLF
1akeA           PQADAMKEAGINVDEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDTAPLI
2bbtB           KFAEKDNIVLGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVC-KLMANKTRILV
1cs4C           ----------------------------------------------------------------------
3dfoD           --------SHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRR-FYRQLLL
3dfpD           --------SHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRR-FYRQLLL
2b8tD           VIISGLDKNFKGEPFGPIAKLFTYADKITKLTAICNECGAEATHSLR-------KIDGKHADYNDDIVKI
1adoA           --------SHPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRR-FYRQLLL
3dfqD           --------SHPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRR-FYRQLLL
1aldA           --------QYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRR-FYRQLLL
3ecpA           IRNPNV--SAEAIRKAGAMQTVKLAQE----FPELLAIEDTTSLSYRHQVAE--ELGKLGSIQDKSRGWW
2d3wD           MPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDGLDIDALKVVADGVNSLRDG--KRSFIIV
1e9rF           EWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVL
3crmA           PLL-VGGTMLYYKALLEGLPYTVAQLAIAPEQRQVLHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLS
2ahvA           IGIGTFVDPRQQGGKLNEVTKEDLIKLVEFDNKEYLYYKAI-----------------------------
6aldA           --------SHPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRR-FYRQLLL
3dfnA           --------SHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRR-FYRQLLL
3dftD           --------SHPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFY-RQLLL
3bb1F           DNLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASL--KKDIPVVLIE
3dfqC           --------SHPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRR-FYRQLLL
1culC           ----------------------------------------------------------------------
3bb1A           DKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRS----EALLQVVRSGASLKIPVVLIE
1ek0A           KDIIIALVGNKIDLQEGGERKVARGEKLAEEKGLLFFE--TSAKTGENVNDVFLGIGEKIPL--------
1e4vA           MKEAGINVDYVLE---FDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTHQMTAPLI
3dfoC           --------SHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRR-FYRQLLL
2d2fA           WDESYLSRYLNEGFSGGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVIT
1drbA           CLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGG
3dftC           --------SHPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFY-RQLLL
4atjA           ADLLTIAAQQSVTLAGGPSWRVPLGRRDSLQAFLDLAPAPFFTLPQLKDSFRNVGLNR-SSDLVALSGGH
1bccF           LDLNMRQQILP---KEQWTKYEEDVPYLEPYLKEV-----------------------------------
2ausC           LHIQYGVINLPGPTSHEVVAWIKRILNLEKAGHGGTLDPKVSGVLPVALERATRVVQA-LLPAGKEYVAL
1e9sH           EWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVL
1accA           IKLNAILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILS------GYIVEIE
2czvB           NVALGFSLRPLLYSNPYERANLAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVVIGMEIPQAKASI
1b0uA           GIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEE-GKTMVVV
3cnlA           SSFSEFFEDFGLLKKGGVPDIERALMLFFGKAGRVSFERPE-----------------------------
1d6jA           --------QLHEVATPGEETGLPFVEVYVDVPVEAPYEAPANKNYELPVQDAVKQIIDYLDTKG------
3di4A           PYTGNLLLADHTGLPLHEAELVHDVLNVFRDTGQYFKASPVRPGD----YLEFFAEIDLLGNL-SACPGG
2dr3D           KSKEYEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYKPAMARSIILQLKRVLAGTGCTSIFV
1e9sL           EWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVL
3ec1A           QTLFFGGLARLDYIKGGRRSFVCYMANELTVHR-TKLEKADSLYANQLGELLSPPSKRYAAE---FPPLV
3a00A           ASVKQVSKSGKTCILDIDMQGVKSVKAIPELNARFLFIAPPSVTGAHDKVIVNDDLDKAYKEL--KDFIF
2d4uB           TAAAAEIKRNYDIYHNALAELIQLLGAGKINE---FFDQPTQGYQDGFEKQYVAYMEQ-NDRLHDIAV--
2an9A           TGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQMSHYAEYDYLIV
2anbA           ---DVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVMAQAVAEMSHYAEYDYLIV
2aunB           HGVGRHVEARYRYLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRL-EAASPRPLIGF
1e9sE           EAEEWASYGRLLLRETAKKLALIGTP--------------------------------------------
3bv4A           ----------PALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRR-FYRQLLL
1e2iA           HPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTRHIDRLAKRQRPGLDLAMLAAIRRVYGLLANT
2ancD           ----VFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAQAVAEMSHYAEYDYLIV
2bofX           VVSNAPGRDCGAPSHSAYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQEVLETMAYAGKALKA
2a1fF           --------------SQPIYKRILLKL-----SGEALQGEDGLGIDPAILDRMAVEIKE-LVEMGVEVSVV
3czjA           ----------DIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFI
3c7kC           MEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAGDYQPTEQDILRTRVKTT
2aunA           HGVGRHVEARYRYLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFS
3brwA           DEHVISNNFKFGVIYQKLGATSEEELFSTN-EESPAFVEFLEFLGQKVKLQDFGGLDVTHGQTGTESVYC
3cr7B           ETGLPFVEDVPVEVQRDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKN----------YELPVQDA
1dp0A           DQFTRAPLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFI
2ancF           VAEMSHYANDDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLLA------------------------
2bv7A           AY------EMALKKYHGWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKVRL-FLVNYTATIDV
3bczC           KKTGFERSLQTDEDEHSIEHLPYTAKAESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSQRFRYS
1e9rD           DWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGAESLF
3b55A           WLEAHAKPLKTTNPTASLNDLKPLKNVG--SASIVGLGEATHGAHEVFTKHRI--VKYLVSEKGFTNLVL
3d1mB           PNVAEKTLGASGRYEGKITRNSERFKEPNYNPDIIFKDEENTGADRLMTQRCKDKLNAVMNQWPGVKLRV
3c15C           ----------------------------------------------------------------------
1c9kC           ----PEQWDYAAMERAIDDEIQILIAACQRCPAKVVLVTNEVGMGIVPENRLARHFRDIAGRVNQRL---
1e9sI           ----YALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAES
2aumB           HGVGRHVEARYRYLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFA
3c7kA           ----------------------------------------------------------------------
3dlbB           EPGGLSLLDYHASKGRLQGREGGRVAWVADPKDP---RKPIPHLTGLLVPVGSLALSLPWEERRRRTREI
3bs4A           YAKAVEDHKKVWMDLNLFEGRELYGFAISMSGYLEVFTPEETLRYLETSAEVRYGHPAYKKYPRGTNFWL
1e2jA           HPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAA
3dvlD           FDLSALIERINYAIQKYRARRVSIDSV----TSVFQQYDASSVVR-----RELFRLVARLKQIGATTVMT
3bb1G           DNLDKLVAKAITGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLSDI----PVVLI
1azsC           ----------------------------------------------------------------------
3cmvB           VAALTPKAEIEGEISHMGLAARMMSQAMRKLAGNLKQSNTSVRLDIRRIGAVKEGENV--VGSETRVKVV
1e2mB           PALTLIFDRALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLAMLAA
2ancB           --VDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAEMSHYAEYDYLIV
3d1mA           PNVAEKTLGASGRYEGKITRNSERFKELNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVGVKLRVT
1e9rG           EAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEALSDKLPEH
1bmfC           ----------------YSGCSMGEYFRDNGKHALIIYDDLSKQAVAYR--QMSLLLRRPPGREAYPGDVF
3e8aC           ----------------------------------------------------------------------
1e2nA           GEAGSPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLA-----------------------------
1eamA           DLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYGENMRLT
2aumA           HGVGRHVEARYRYLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAA---SPRPLI
2c9gA           ----------------------------------------------------------------------
2e85A           -KCAAAPKGNWVVIDGGSAPENDIVAIRELRPTRLLIVDAT-----DMGLNPGEIRIIDPDDIAEMFMMT
3bwdD           GTKLDLRDDKQFFIDHAVPITTVQGEELKKLIGAPAYIECSSKSQENVKGVFDAAIRV------------
3dfdA           ----------------------------------------------------------------------
3cueF           ATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKE-SMS----
3bb1H           DVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVR
2bkeA           DHQIAIVDDLQELVSKDPSIKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLTRLAEVYDIAVIIT
2ck3C           --------------APYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYR--QMSLLLRRPPGREAYPGDVF
2dftA           SAAEGVRRTGGNDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPG-------------------------
3c14C           ----------------------------------------------------------------------
3a00B           ---KQVSKSGKTCILDIDMQGVKSVKAIPELNARFLFIAPPSGAHD----KVIVNDDLDKAYKELKDFIF
2a1fD           --------------------QPIYKRILLKLSGEALQGEDGLGIDPAILDRMA-VEIKELVEMGVEVSVV
1e1qB           LIIYDDLSKQARPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGD------VSAYIP
3cnnA           ----DFARKRGLLKKGGVPDIERALMLFFGKAGRVSFERPE-----------------------------
2d7vA           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
2awnA           --------------------------------------EPLSNLDAALRVQMRIEISRLHKRLGRTMIYV
3dyoA           QFTRAPLDN-DIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFI
2dftC           VVYLEISAAEGGDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPG-------------------------
1ckvA           ----------------------------------------------------------------------
1dvrA           QMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQISDDNADA
1av6A           YALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTTKSD
1e2iB           GMPYAVTDAVLAPHIGGEAHAPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGT
3bm2B           RERFSAVLEQGAIAAGSDDKAIDKARNAPFRAPLIITVVAKVPRWEQE--SAGCAVAQAAVAQGFGGIWR
1cjuC           ----------------------------------------------------------------------
1e2mA           ---------IGGEAGSPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGA
2bbtA           FAEKDNIVLGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMA-NKTRILV
1cjvC           ----------------------------------------------------------------------
2a5vA           VGV-------------------------------------------------------------------
2e85B           --CAAAPKGNWVVIDGGSAPENDIVARELRPTRLLIVDATDMGLN------PGEIRIIDPDDIAEMFMMT
3c85A           KLVGNQTALEQLQRRNYKGQIAAIAEYP-DQLEGLLESGVDAAFNIYSEA-GSGFARHVCKQLEPQFTSI
2a5vB           VGV-------------------------------------------------------------------
3cphA           HANDEAQLLLVGNKSDMETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQE-KIDSNKL
3csuA           IVMRHPQEGAARLATEFSGNVPVLNAGDQTLLDLFTIQETQGRLDLKYGRTVHSLTQALAKFDGNRFYFI
2cbzA           SGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRIL
1afrA           -------------------SFQERATFISHGNTARQAKEHGDIKLAQICGTI-------AADEKRHETAY
2dpyB           DSLTRYAMAQRALAIGEPPATKGYPPSVFAKLPALV----------------------------------
3dkvA           EALEEILEEMGRPI--------------------------------------------------------
3bb1D           YRVDNLDKLVAKAILQVVRSGASLKKDAASDIPVVLIENSGRCNDEKVLPNGIAWIPHLVQTI--TEVAL
1e2nB           LTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVTLPGTNIVLGALPEDRHIDRLAKLDLAMLAAIRRV
1e2lA           PPALTLIFDRHPIAALLCYPAARYLM--------------------------------------------
2b0lC           --------------------------HHMSKAVVQMAISSLSYSELEAIEHIFEELDGNEGLLVRVGITR
2cdnA           KALHEMLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRM-KVYRDETAPLLEYYRDQLKTV
1e9rB           ----------------------------------------------------------------------
1ckeA           AAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQVKGFSVNFER
2awoD           VLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQV-------ELPMPNRQQVWL
1e2lB           AVTDAVLAPHIGGEAGSPPALTLIFDRHPIAALLCY-PAARYLMGSMTPQAVLAFVALIPPTLGTNIVLG
2aexA           -------------------------------DELAHRCSSFMAPPVTDLGELRRRPLETQAQVCQALAQV
1e9sA           EWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVL
3cqcA           ------------------------------------------------------------------ILHS
3dm5B           DYFKSKGVDIIIVDTAGRHKEDKALIEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEATPIGSIIV
1e2hA           HPIAALLYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAA
2dpyA           TRYAMAQRE-IALAIGEPPATKG-----------------------------------------------
3b85B           RGRTLNDAFVILDEAQNTTPAQKFLTRLGFGSKVVTGDSGLRLVRHILRGVDDVHFSELTSSDVVRHQLV
2a1fE           --------------------QPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVL
3ed8A           ----------------------------------------------------------------------
2a1fC           --------------SQPIYKRILLK-----LSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVL
1e2kB           FDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRERLDLAMLAA
1d2zD           ----------------------------------------------------------------------
1d8jA           PLTLDEILDETQHLDIGLKQKQWLMTEAVNNPKIEVIDGKYAFKPKYN----------------------
1d6aA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
3cbqA           LLRLRAGRPHGNKSDLARSREVSLEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIRL--------
1chdA           ---------------------------LLSSEKLIAIGASTGGTEA-----IRHVLQPLPLSSPAVIITQ
2bhvC           PKGSKVIGYYSNNNKMGEYLDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYG-------------
2ax4B           AGLPFFEIFVDAPLN------ICESR----DVKGLYKRARAGEIKGFTG---------------------
2ax4A           AGLPFFEIFVDAPLN------ICESR----DVKGLYKRARAGEIKGFTG---------------------
2axnA           ----------------------------------------------------------------------
3bjqB           ------------------QARVV---------DPILSTHARGYRQSTLIGKKLFPVAPVAQY-GGKILTF
2c5mD           ------------------KSCGLHVTSIKIDP-YINIDAGLTKDNNLTTGKIYQYVIRKGDYLGKTVQVV
1e2jB           PHIGGEAGSPPPAL--------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1agpA           KDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQ--------
3b9qA           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2a78A           EDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRA--------
1dapA           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2c95B           EEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETKATEPVIAFYEKRGIVRKVN
2c9oA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3cddA           FGIKVIVNTQRIQIEQGETPHELLAR-LAKQRGVLLTSDTFGNLKAGVSLILGDNVKAARGRFSWRQRFS
3cr8B           VNLIDPEKREALKHEALSLPSLDLDWQQQCELEML-MTGAYSPLTGFMTRAQCARVESAQQLDDGSFWPS
2dx7A           TTGTIVSGVYEKEFSKYGVEIMTPTEDEQKDVMRGIYEGVKAGNLKLGRELLLKTAKILEERGAECIAGC
3cddB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3ci2A           -----------------------------------------------SVEEAKKVILQDKPE-AQIIVLP
3cddE           FGIKVIVNFQRIQIEQGETPHELLARLA-KQRGVLLTSDTFGNL-----VITRASKTKAGVSLILGDNVK
3dmdA           ----------------------------------------------------------------------
2ekbA           AGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLF
3e70C           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------KSGNMAAATVERENRN-VHAIVLK
1e6vC           -------------KYMNPNYELKKLREIPDEDIVRLMGHREPGEEYPSVHPPLEEMEEPECPIRELVEPT
2ck3A           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
2bsqE           VRLGSMLASIGQEIGGVELEDVR-----------------------------------------------
3dsrB           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           THDPIAASYADRVVFLRDGRVVDDVTHPTPQLILDRLAGLEG
3b5jA           AHRLSTVKNADRIIVMEKGKIVEQGKH---------------
3dmdC           TKLDDARGGAALSISYVIDAPILFVGV---------------
2d3wB           HYRILDYIKPDYVHVLYQGRIVKSGDF---------------
3c95A           ------------------------------------------
2dwpA           EAMDFMKRISCYEASY--QPLDPDKCD---------------
2ccgA           LKFEKVIEGYQEIIHNESQRFKSVNADQPLENVVED------
2ccjB           EKVIGYQEIIQRFKSVNADQPLENVVEDTYQTIIKYL-----
2ccgB           VIEGIIHNESQRFKSVNADQPLENVVEDTYQTIIKYL-----
3cmvG           VKNIAAPFKQAEFQILYGEGINFYGEL---------------
3cmvH           ETRVAAPFKQAEFQILYGEGINFYGEL---------------
2c03B           TKLDDARGGAALSARHVTGKPIYFAG--VSEKPEG-------
1e9cA           RCFQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIATATE
2a2zD           TLKTNDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL--
2c61B           NVLPSLSRLMNSGIGAGKTREDHKAVS---------------
3b60A           AHRLSTIEQADEIVVVEDGIIVERGTH---------------
2bifA           EATEFMRRIECYENSYESLDEEQDRDLSYIK-----------
2dwoA           EAMDFMKRISCYEASY--QPLDPDKCD---------------
1d1cA           EEQMSIFKIIAGILHLGNIKFEKGAGE---------------
1e69A           THNKIVMEAADLLVTMVNG-----------------------
3eiuA           INVLPSLSLMNSGIGAGKTREDHKAVS---------------
2czvA           KASI--SMYPEIIL----------------------------
1e9dA           RCFQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIATATE
1e98A           CFHQLMKDTTLNWKMVDASKRIEAVHEEIRVLSEDAIRTATE
2akaB           TKLDLMDEGTDARDVLENKLLPLRRGYI--------------
3eiuB           NVLPSLSRLMNSGIGAGKTRED--------------------
3dmdB           TKLDDARGGAALSISYVIDAPILFVGV---------------
3dm5A           TKLGSAKGGGALSAVAATGAPIKFIGT---------------
2b8tA           GCQEFYSAVCRHHHKV-PNRPYLNSNS---------------
1bifA           EATEDMRRIECYENSYESLDEEQDRDL---------------
3cmvC           VNKIAAPFKQAEFQILYGEGINFYGEL---------------
2b8wA           KKKCVFDRPVHRRKLAQLEKLQDEELD---------------
2cjwB           LRRDSKEKNERRLAYQKRKE----------------------
2cgtH           EALALVVNTMRGIVKVAAVK----------------------
2a30D           TLKTNDYLQEVPILTLDVNEYESLVEK---------------
3cmvA           NQGGALKFYASVRLDIRRIGAVKEGEN---------------
2c03A           TKGDARGGAALSARHVTGKPIYEGLEPFYPERLAGRILGM--
2cckA           EKVIGYQEIIRFKSVNADQPLENVVEDT--------------
1e9fA           RCFHLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAI-----
1e2dA           MKD-----TTLNWKMVDASKSIEAVHEDIRVLSEDAIATATE
2axzC           YYDLEINYLKQIYQFLTDKNIDSYNIINIFKIIGKE------
2dr3E           SQVPGVEHGVDGIIRLDLDEIDGELKR---------------
2a30B           TLKTNDYLQEVPILTLDVNEYESLVEK---------------
2a2zA           PLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPIL--------
1e9sG           LFAGSSKALTSARFVLSDKLPEHVTMPDGDFSIRS-------
2bbsA           TSKMEHLKKADKILILHEGSSYFYGTF---------------
1e9sF           LFA---------------------------------------
2dr3A           SQVSGVEHGVDGIIRLDLDEIDGELKR---------------
1aroP           KTTLCLTSADNTTVQAVASAIGRAIEDEARF-----------
3d3kA           GIPQQVFQEVGINYHSPFCKFVIPLH----------------
2a5gA           ------------------------------------------
2c04A           TKLDGDARGALSARHVTGKPIYFA---GVSEKPEG-------
1dkiA           GVG----KVGGHAFVI-DGADGRNFYH---------------
4dcgA           NFDYP----NQEYDYFHMYFMLRTVYC---------------
3dhwC           THEMVVKRICDCVAVISNGELIEQDTV---------------
3czpB           PWTLVEAKRFARVKVLRT------------------------
1cr4A           CHLKALRQLSDTIIALERNQLVLVRIL---------------
2a30A           TLKTNDYLQEVPILTLDVNEYESLVEK---------------
421pA           ------------------------------------------
1e2fA           CFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIATATE
2axpA           ------------------------------------------
2a2zB           TLKTNDYLQEVPILTLDVNEDFKDKYESLVEKVKEFL-----
3b85A           ------------------------------------------
3a1wA           ------------------------------------------
2ctsA           ------------------------------------------
2bc9A           SLK---------------------------------------
1e4yA           EGKDDV--TGEELTTRKDDQEETVRKR---------------
3b2qB           INVPSLSRLMNSGIGAGKTR----------------------
1e9rA           SDKLPEHVTMPDGDFSIRS-----------------------
3b2qA           SMPGDDITHPIPDLSGYITEGQIVVARELHR-----------
2c9yA           KALKIRLQAYHTQTTPLIEYYRKRGIH---------------
1bg0A           GGDLTVYKRLVTAVDNIESKLP--------------------
3dm9B           TKLDADARGGAAILFVGVGQGYDDLRPFEKEWFLERIFG---
3cmxA           APFKQAEQILYGEGINFYGELV--------------------
3cr7C           ------------------------------------------
2a5jA           ------------------------------------------
1e3mB           THYFLTQLPEKEGVANVHLDALEHGDTIAFHSVQDGAAS---
2b8tB           IGCQEFYSAVCRHHHKVPNRPYLNSNS---------------
1e0jB           CHLKNPDQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTG
3cmwC           ALKFASVRLDIRRIGAVKEGVVGSETR---------------
1e3mA           THYFLTQLPEKEGVANVHLDALEHGDT---------------
2awnB           THDVEAMTLADKIVVLDAGRVAQVGKP---------------
2c4rL           IARQLRLRDLGGLIVIDFIDMT--------------------
2awnC           THDQEAMTLADKIVVLDAGRVAQVGKP---------------
3da4A           ------------------------------------------
3bpbA           PEEES---YAANCIWVNERVIMPAGYP---------------
2bdtA           ------------------------------------------
2bwjA           KINTPEDVFLQLCTAIDSI-----------------------
2d4uA           NN----------------------------------------
1dhjA           GRVYQFLPKAQKLYLTHIDAEVEGDTH---------------
2bkhA           LDDGDFIRMCTAMKKIGLDDEE--------------------
1dekB           NFDRYWVKLFALDYLDKFNSGYDYYI----------------
3dtbB           ALSWQHGVFVGAAMRSEAKVIMHDPFA---------------
1e0jA           CHLGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTG
2d62A           THDQV--EATGDRIAVNKGELQQVGTP---------------
1dg3A           KKK--CFVFDRPVHELDPEFVQQVADF---------------
1e9sJ           LFAGASKALTSARFVLSDKLPE--------------------
3cddD           RGRFSWRQRFSKFTIKDSAG----------------------
1cr1A           CHLKTLRQLSDTIIALERNQLV--------------------
3d7wA           ELETSWGQQSTQVQHSTDGVFNNPIA----------------
2cvfA           ERHRFRPGLMAYFRITERGIEDVE------------------
2b92B           RKF---FPKKKCFVFDRPVHRR--------------------
3adkA           KVNSVDDVFSQVCTHLD-------------------------
2awnD           PVESDVQVGANMSLGIRPEHLLPSDIA---------------
2d0kA           GRVYEFLPKAQKLYLTHIDAEVEGDTH---------------
2c61A           GDDITHPIPDLSGYITEGQIVVARELH---------------
3dt2A           ALSWVGAAMRSEAAAEHKGKVIMHDPF---------------
2c0bL           LRDLIVIDFIDMTPVRHQRAVENRLRE---------------
3cddC           RGRFSWRQRFSKFTIKADSAGLPTVGGIKADVTDSEIG----
1e9sD           AGSEASKALTSARFVLSDKLPE--------------------
1e9sB           SDKLPEH-----------------------------------
2awoC           THDQEAMTLADKIVVLDAGRVAQVGKP---------------
3dt4C           ALSW--------------------------------------
2c7cH           EALALVVNTMRGIVKVAAVKAPGFGDR---------------
2cckB           DQPLNVVEDTYQTI----------------------------
2bjbA           EPDLTNAVAFLSAAVVSGGTVRRVSVQPADHIL---------
2dr3B           SQVSGERGFGGPGEHGVDGIIRLDLDE---------------
2akaA           QEEQSIFKIIAGILHLGNIKFEKGAGE---------------
2dr3F           SQVSGVEHGVDGIIRLDLDEIDGELKR---------------
3dauA           GRVYQFLPKAQKLYLTHIDAEVEGDTH---------------
2c9oC           RTMLYTPQEMKQIIKIRAQTEGINISEEALNHL---------
3be4A           APLVFYEDLGILKRVNAKLPPKE-------------------
3cioD           IKRASTA-----------------------------------
3c8uA           GLNHAAVARAQGNDLANARAIEAARLP---------------
3bh0A           SQLSQVEQRQDKRPMLSDLRESGQLEQDADIIEFLY------
2b8tC           GCQEFYSAVCRHHHKVPNRPYLNS------------------
1e6cA           ------------------------------------------
3dymA           SRKTYRIDGSGQMAITVDVEVASDTPHPARIG----------
2bkiA           PLLDDHGDFIRMCTAMKKIGLDDEEKLDLFR-----------
3dt4A           ALSWVGAAMRSEAAAEHKGKVIMHDPF---------------
1dhiA           GRVYQFLPKAQKLYLTHIDAEVEGDTH---------------
2b8wB           QKDETNLPRLCIRKFFPKKKCFVFDRP---------------
1cfrA           FLSKTTFRPDRRLQLAHEGSLMKALYT---------------
3cr7A           ------------------------------------------
3cmvE           VKVVNKIAAPFKQAEFQILYGEGINFY---------------
1d6jB           ------------------------------------------
1e2kA           VLGALPEDRHIDRLAKRQRPG---------------------
1cjaA           LRM---------------------------------------
2d4hB           IFSNSTKTLSGGIQVNGPRLESLVLTY---------------
3d3qA           ESRELYLRINKRVDILGHGLFNEVQHLV--------------
3d31A           THDQEARIMADRIAVVMDGKLIQVGKP---------------
3czpA           RTINDAIEAAYK------------------------------
1cr2A           CHLGALRQLSDTIIALERNNLV--------------------
1e3aB           PFDKYSASGYETTQDGPTGSLNISVGA---------------
1draA           GRVYQFLPKAQKLYLTHIDAEVEGDTH---------------
2dflA           NQVMTLYHVPGIRIQLKKSRGNDAPHLPEGEVVFA-------
3cmtD           APFKQAEQILYGEGINFYGELV--------------------
2bhjA           AITVFQRSDGKHDFRLWNSQLIRYAGY---------------
1e59A           AHGNSLRALVKYLDNMSEEEILELNIP---------------
1e2gA           RCFQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIATATE
2bhvD           RQSGMGINQIAPIVVIREGSRVFISPN---------------
2drcA           GRVYQFLPKAQKLYLTHIDAEVEGDTH---------------
1dyhA           GRVYQFLPKAQKLYLTHIDAEVEGDTH---------------
3dt7A           ALSWVGAAMRSEAAAEHKGKVIMHDPF---------------
3cddF           GWRIPQTGKLWNIPVIDEIGLDEELI----------------
3bgwA           SQLSQVEQRQDKRPMLSDLRESGQLEQDADIIEFL-------
1cjtC           ------------------------------------------
1e9sM           SDKLPEHVTMPDGDF---------------------------
2bbsB           TSKMEHLKKADKILILHEGSSYFYGTF---------------
3dffA           CAAIGE--HPDHEATRDAALFATHEKN---------------
3d3qB           ESRELYLRINKRVDILGHGLFNEVQHLV--------------
3cr7D           ------------------------------------------
3bb1B           GRCNSDEKVLPNGIAWIPHLVQTITEVALNKSESIFVNLIDG
5dfrA           GRVYQFLPKAQKLYLTHIDAEVEGDTH---------------
3bjdB           LTDVDEAAALARYLYGELGEEDEKGSH---------------
2d2eA           HYQRILYIQPDKVHVMMDGRVVATGGP---------------
3bo6B           LRE---EPFYRLM-----------------------------
3cm0A           LGTPEVYARIRAAL----------------------------
4dfrA           GRVYQFLPKAQKLYLTHIDAEVEGDTH---------------
2d4hA           KKKCFVFDRPVHRRKLAQLEKLQDEELD--------------
3ch4B           ------------------------------------------
1ai4B           PFDWYSASGYETTQDGPTGSLNISVGA---------------
3clvA           ------------------------------------------
1eilA           TRGDEAL-MQQRKVMGLLCLQDPFGLP---------------
2bx2L           NLE-AADEIARQLRLRDLGGLIVIDFI---------------
2eg5G           RNAIDLLEMAINDLVVEGHLEEEKLDSF--------------
3bb1C           NSGRCNKNDSDEKVLPNGIAWIPH----LVQTITEV------
2bhvA           RQSGGINQVVNQIL----------------------------
3dfpC           TADDVNPCIGGVILFHETLYQKADDGRPFPQVI---------
1cr0A           CHLKALRQLSDTIIALERNQLV--------------------
3dfnC           TADDVNPCIGGVILFHETLYQKADDGRPFPQVI---------
2dr3C           SQVSGVEHGVDGIIRLDLDEIDGELKR---------------
1dw9A           ------------------------------------------
2awoA           THDQEAMTLADKIVVLDAGRVAQVGKP---------------
2ahwD           LVIAQAVHNNGGIVMMQVQKMVKKATL---------------
1e2hB           IRR-VYGLLANTVRYLQCGGSWREDWG---------------
2d3wC           YQRILDYIKPDYVHVLYQGRIVKSGDF---------------
3bb1E           ENSGRCNKNDSDEKVLPNGIA---WIPHLVQTITEVALN---
1bglA           SRKTRIDGSGQMAITVDVEVA---------------------
3bk7A           EHDVMIDYVSDRLIVF-EGEPG--------------------
3cmuA           ------------------------------------------
3bgwD           SQLSQVEQRQDKRPMLSDLRESGQLEQDADIIEFLY------
1ak2A           KIRLAYHTQTTPLVEYYSKRHSAIDASQTPDVVFASIL----
2d3wA           THYQLDYIKPDYVHVLYQGRIVKSGDF---------------
3dfqA           TADDVNPCIGGVILFHETLYQKADDGRPFPQVI---------
2ccjA           EKVEGYQEIIHRFKSVNADQPLENVVEDTYQTIIKYL-----
3dfnD           TADDVNPCIGGVILFHETLYQKADDGRPFPQVI---------
3cbnA           EIIVEYEGH---------------------------------
2boeX           PDLSLMSSCMQHVQQEVLETMA--------------------
1dekA           TRQDHEMRAMGATVIHVVRPGQK-------------------
1e9rE           AGSEASKALTSARFVLSDKLPE--------------------
1akeA           GYYSEAEAGNTKYAKVDGTKPVAEVRAD----LEKILG----
2bbtB           TSKMEHLKKADKILILHEGSSYFYGTF---------------
1cs4C           ------------------------------------------
3dfoD           TADDVNPCIGGVILFHETLYQKADDGRPFPQVI---------
3dfpD           TADDVNPCIGGVILFHETLYQKADDGRPFPQVI---------
2b8tD           GCQEFYSAVCRHHHKVPNRPYLNSNSE---------------
1adoA           TADDVNPCIGGVILFHETLYQKADDGRPFPQVI---------
3dfqD           TADDVNPCIGGVILFHETLYQKADDGRPFPQVI---------
1aldA           TADDVNPCIGGVILFHETLYQKADDGRPFPQVI---------
3ecpA           VHSVLLEATTFRTVGLLHQEWWMRPDD---------------
2d3wD           THYQRILDKPDYVHVLYQGRIVKSGDF---------------
1e9rF           SDKLPEH-----------------------------------
3crmA           IRAVGYRQVWDYLDGKLSYAEMTERGIIATRQLAKRQ-----
2ahvA           ------------------------------------------
6aldA           TADDVNPCIGGVILFHETLYQKADDGRPFPQVI---------
3dfnA           TADDVNPCIGGVILFHETLYQKADDGRPFPQVI---------
3dftD           TADDVNPCIGGVILFHETLYQKADDGRPFPQVI---------
3bb1F           NSGRCNKNDSDEKVLPNGIAWIPHLVQTITEVALNKSE----
3dfqC           TADDVNPCIGGVILFHETLYQKADDGRPFPQVI---------
1culC           ------------------------------------------
3bb1A           NSGRCNKNDSDEKV-LPNGIAWIPHLV---------------
1ek0A           ------------------------------------------
1e4vA           GYYSEAEAGNTKYAKVDGTKPVAEVRA---------------
3dfoC           TADDVNPCIGGVILFHETLYQKADDGRPFPQVI---------
2d2fA           HYQRILNIQPDKVHVMMDGRVVATGGP---------------
1drbA           GRVYQFLPKAQKLYLTHIDAEVEGDTH---------------
3dftC           TADDVNPCIGGVILFHETLYQKADDGRPFPQVI---------
4atjA           TFGKNCRFIMDRLYNFSNTGLPDPTLNT--------------
1bccF           ------------------------------------------
2ausC           MHLHGDVPEDKIRAVMKEFEGEIIQRTRK-------------
1e9sH           SDKLPEHVTPDGDFSIRSWLEDPNGGNLFITWREDMG-----
1accA           DTEGLKEVINDRYDMLNISSLRQDGKT---------------
2czvB           SMYP--------------------------------------
1b0uA           THEGFARHVSSHVIFLHQGKIEEEGDP---------------
3cnlA           ------------------------------------------
1d6jA           ------------------------------------------
3di4A           DCSSEASCHPLLVEIFAPAEGLGDWPSPSV------------
2dr3D           SQVSGERGFGGPGVHGVDGIIRLDLDE---------------
1e9sL           SDKLPEHVTMPDGDFSIRSWLEDP------------------
3ec1A           PRSLSVKERKTDIVFSGLGWVTCNDPG---------------
3a00A           AE----------------------------------------
2d4uB           ------------------------------------------
2an9A           NDDFTALTDLKTIIRAERLRMSRQKQR---------------
2anbA           NDDFTALTDLKTIIRAERLRMSRQKQR---------------
2aunB           SDISSAFHRHGLPAI--HGPVATGLGLE--------------
1e9sE           ------------------------------------------
3bv4A           TADDRVNCIGGVILFHETLYQKADDGRPFPQVI---------
1e2iA           VRYLQGGSWREDWGQLSGTGPRPHIGD---------------
2ancD           NDDFTALTDLKTIIRAERLRMSRQKQR---------------
2bofX           GSSQA-------------------------------------
2a1fF           LGGGLFRGAKLAKAGMNRVVGDHMGML---------------
3czjA           SRKTYIDGSGQMAITVDVEVASDTPHP---------------
3c7kC           GIVETFTFKNLHFRLFDVGG----------------------
2aunA           DISVLLSAFHRHGLPAIHGPVATGLGL---------------
3brwA           NFRNKEITEGDAQQLQRKRHIGNDIVA---------------
3cr7B           VKQIIDYLDTKGYL----------------------------
1dp0A           SRKTYIDGSGQMAITVDVEVASDTPHP---------------
2ancF           ------------------------------------------
2bv7A           IYEMYTRMNAEL------------------------------
3bczC           YYDESQGEIYRSIEHLDKGSIIEQLDP---------------
1e9rD           AGSNESKALTSARFVLSDKLPE--------------------
3b55A           EEGWDRALELDRYVLTGKGNPSQHLTPVFKTKELDLLDWI--
3d1mB           TEGWDEDGHHSEESLHYEGRAVDITTS---------------
3c15C           ------------------------------------------
1c9kC           ------AAAADEVWLVVSGIGV--------------------
1e9sI           LFAEASKALTSARFVLSDKLP---EHVTMPDGDFSI------
2aumB           DISVLLSAFHRHGLPAIHGPVATGL-GLEQQERLASLASV--
3c7kA           ------------------------------------------
3dlbB           ASWIGRLGLGTPEAVRAQAYRL--------------------
3bs4A           WEGVKDKRVLLSVYRRADYVL---------------------
1e2jA           IRR-VYGLLANTVRYLQCGGSWREDWG---------------
3dvlD           TEREEYGPIARYGVFVSDNVVILR------------------
3bb1G           ENSGRCNKNDSDEKVLPNGIAWIPHLV---------------
1azsC           ------------------------------------------
3cmvB           KNKIAAPFKQAEFQILYGEGINFYGEL---------------
1e2mB           IRR-VYGLLANTVRYLQCGGSWREDWGQLSGPQSNA------
2ancB           NDDFTALTDLKTIIRAERLRMSRQ--KQRHDALISK------
3d1mA           EGWDEDGHHSEESLH-YEGRAVDITTS---------------
1e9rG           VTMPDGDFSIRSWLEDPNGGNLFITWREDMGPALRPLISA--
1bmfC           YLHSLLERAAKMNDAFGGGSLTALPVI---------------
3e8aC           ------------------------------------------
1e2nA           ------------------------------------------
1eamA           RVTKSDAVYAKKMYYLNKIVRN--------------------
2aumA           GFAD---ISVLLSAFHRHGLPAIHGPV---------------
2c9gA           ------------------------------------------
2e85A           THNMIDQLKEDIGEVIFLGIQPDIVGF---------------
3bwdD           ------------------------------------------
3dfdA           ------------------------------------------
3cueF           ------------------------------------------
3bb1H           SGASLKDSDIPVVLIENSGRCNKNDSD---------------
2bkeA           NQVVPGI--RIQLKKSRGNRRIARVVD---------------
2ck3C           YLHSLLERAAKMNDAFGGGSLTALPVI---------------
2dftA           ------------------------------------------
3c14C           ------------------------------------------
3a00B           AE----------------------------------------
2a1fD           LGGNLFRGAKLAKAGMNRVVGDHMGML---------------
1e1qB           TNVIS---ITDGQIFL-ETELFYKGIRP--------------
3cnnA           ------------------------------------------
2d7vA           ------------------------------------------
2d7vB           ------------------------------------------
2awnA           THDQEAMTLADKIVVLDAGRVAQVGKP---------------
3dyoA           SRKTRIDGSGQMAITVDVEVASDTPHP---------------
2dftC           ------------------------------------------
1ckvA           ------------------------------------------
1dvrA           LKKRLAQTEPIVDFYKKTGIWAGVDASQPPATVWADI-----
1av6A           AVNYEKKMYYLNKIVRNKVVVNFDPNQEYDYFHMYF------
1e2iB           NIVLGALPEDRHIDRLAKRERLDLAMLAAIRRVYGLLA----
3bm2B           SGALTESPVVREAFGCREQDKI--------------------
1cjuC           ------------------------------------------
1e2mA           LPEDRH------------------------------------
2bbtA           TSKMEHLKKADKILILHEGSSYFYGTF---------------
1cjvC           ------------------------------------------
2a5vA           ------------------------------------------
2e85B           THYLIDQLKEDIGEVIFLGIQPDIVGF---------------
3c85A           ------------------------------------------
2a5vB           ------------------------------------------
3cphA           VG----------------------------------------
3csuA           APDAAMPQYILDMLDEKGIAWS--------------------
2cbzA           VTHMSYLPQVDVIIVMSGGKISEMGSY---------------
1afrA           TKIVKLFEIDPDGTVLAFADMMRKKIS---------------
2dpyB           ------------------------------------------
3dkvA           ------------------------------------------
3bb1D           NKSESIFVDKNLI-----------------------------
1e2nB           YGL-----LANTVRYLQCGGSWREDWG---------------
1e2lA           ------------------------------------------
2b0lC           SVIVNALRKLESAGVIESRSLGMKGTY---------------
2cdnA           DAVTMDEVFARALRALG-------------------------
1e9rB           ------------------------------------------
1ckeA           LLAEIKLVPADALVLDSTTLSIEQVIEKALQYARQKLA----
2awoD           PVESDVQVGANMSLGIRPEHLLPSDIA---------------
1e2lB           ALPE--------------------------------------
2aexA           DGGAFSVDRWERKEGGGG------------------------
1e9sA           SDK---------------------------------------
3cqcA           TGQYQECLQLADMVSSERHKLYL-------------------
3dm5B           TKLDSAKGGGALSAVAATGAPIDDIEPFDPPRFVSRLLGLG-
1e2hA           IRRVYGL-LANTVRYLQCGGS---------------------
2dpyA           ------------------------------------------
3b85B           GHI---------------------------------------
2a1fE           GGGNLFRGAKLAKAGMNRVVGDHMGML---------------
3ed8A           ------------------------------------------
2a1fC           GGGNLFRGAKLAKAGMNRVVGDHMGML---------------
1e2kB           IR----------------------------------------
1d2zD           ------------------------------------------
1d8jA           ------------------------------------------
1d6aA           ------------------------------------------
2bboA           ------------------------------------------
3cbqA           ------------------------------------------
1chdA           HMPPFTRSFAERLNKLCQISVK--------------------
2bhvC           ------------------------------------------
2ax4B           ------------------------------------------
2ax4A           ------------------------------------------
2axnA           ------------------------------------------
3bjqB           GKEAFTKRNTKRIDFGYEGDPY--------------------
2c5mD           PHITAIQEWVMRQALEPQVCVIELGGTV--------------
1e2jB           ------------------------------------------
3do6A           ------------------------------------------
1agpA           ------------------------------------------
3b9qA           ------------------------------------------
2bwjB           ------------------------------------------
1e9sK           ------------------------------------------
2a78A           ------------------------------------------
1dapA           ------------------------------------------
2bwjD           ------------------------------------------
2c95B           AEGSVDSVFSQ-------------------------------
2c9oA           ------------------------------------------
2bwjF           ------------------------------------------
3cddA           KFTIKAAKADDSEIGRYRPLII--------------------
3cr8B           PITLTSRDRALADRRPGE------------------------
2dx7A           TEVSVLKQDDLKVPLIDPMDVIAE---VAVKVALEK------
3cddB           ------------------------------------------
2c9oB           ------------------------------------------
3ci2A           VGTITMEYRIDRVRLFVDKLDN--------------------
3cddE           AARG--------------------------------------
3dmdA           ------------------------------------------
2ekbA           THGGV-------------------------------------
3e70C           ------------------------------------------
1dwmA           EGSAMTKFRCDRVWVIVNDHGV--------------------
1e6vC           EGAKAGDRIRYIQFTDSVYFAPIHPYIRARMYMWRY------
2ck3A           ------------------------------------------
2bwjC           ------------------------------------------
2bsqE           ------------------------------------------
3dsrB           ------------------------------------------
1delB           ------------------------------------------