[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ55924.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2e8yA.bssp"
#ERROR : Can't open dsspfile "3ecqB.bssp"
#ERROR : Can't open dsspfile "1bf2A.bssp"
#ERROR : Can't open dsspfile "2bhuA.bssp"
#ERROR : Can't open dsspfile "1ehaA.bssp"
#ERROR : Can't open dsspfile "2bhyA.bssp"
#ERROR : Can't open dsspfile "2bhzA.bssp"
#ERROR : Can't open dsspfile "2d0fA.bssp"
#ERROR : Can't open dsspfile "3cejA.bssp"
#ERROR : Can't open dsspfile "1eh9A.bssp"
#ERROR : Can't open dsspfile "2dieA.bssp"
#ERROR : Can't open dsspfile "3czkA.bssp"
#ERROR : Can't open dsspfile "3edfA.bssp"
#ERROR : Can't open dsspfile "3czlA.bssp"
#ERROR : Can't open dsspfile "3edeA.bssp"
#ERROR : Can't open dsspfile "3ecqA.bssp"
#ERROR : Can't open dsspfile "1bliA.bssp"
#ERROR : Can't open dsspfile "1bvzA.bssp"
#ERROR : Can't open dsspfile "1e3xA.bssp"
#ERROR : Can't open dsspfile "3eddA.bssp"
#ERROR : Can't open dsspfile "4cgtA.bssp"
#ERROR : Can't open dsspfile "1c7tA.bssp"
#ERROR : Can't open dsspfile "3czeA.bssp"
#ERROR : Can't open dsspfile "3bmvA.bssp"
#ERROR : Can't open dsspfile "3bh4A.bssp"
#ERROR : Can't open dsspfile "1cygA.bssp"
#ERROR : Can't open dsspfile "3czgA.bssp"
#ERROR : Can't open dsspfile "1c7sA.bssp"
#ERROR : Can't open dsspfile "2cpuA.bssp"
#ERROR : Can't open dsspfile "1d3cA.bssp"
#ERROR : Can't open dsspfile "1cguA.bssp"
#ERROR : Can't open dsspfile "1ea9C.bssp"
#ERROR : Can't open dsspfile "3bakA.bssp"
#ERROR : Can't open dsspfile "3cttA.bssp"
#ERROR : Can't open dsspfile "1a47A.bssp"
#ERROR : Can't open dsspfile "1d7fA.bssp"
#ERROR : Can't open dsspfile "1cgtA.bssp"
#ERROR : Can't open dsspfile "1dhkA.bssp"
#ERROR : Can't open dsspfile "3blkA.bssp"
#ERROR : Can't open dsspfile "1cgwA.bssp"
#ERROR : Can't open dsspfile "1bvnP.bssp"
#ERROR : Can't open dsspfile "1cgxA.bssp"
#ERROR : Can't open dsspfile "1dtuA.bssp"
#ERROR : Can't open dsspfile "2dh2A.bssp"
#ERROR : Can't open dsspfile "2choA.bssp"
#ERROR : Can't open dsspfile "3dhpA.bssp"
#ERROR : Can't open dsspfile "3cgtA.bssp"
#ERROR : Can't open dsspfile "1cxlA.bssp"
#ERROR : Can't open dsspfile "1avaA.bssp"
#ERROR : Can't open dsspfile "1b0iA.bssp"
#ERROR : Can't open dsspfile "3dhuA.bssp"
#ERROR : Can't open dsspfile "1cgvA.bssp"
#ERROR : Can't open dsspfile "1amg-.bssp"
#ERROR : Can't open dsspfile "1cgyA.bssp"
#ERROR : Can't open dsspfile "3dhuB.bssp"
#ERROR : Can't open dsspfile "2droA.bssp"
#ERROR : Can't open dsspfile "6cgtA.bssp"
#ERROR : Can't open dsspfile "3clwA.bssp"
#ERROR : Can't open dsspfile "2d73A.bssp"
#ERROR : Can't open dsspfile "2aaaA.bssp"
#ERROR : Can't open dsspfile "1aqmA.bssp"
#ERROR : Can't open dsspfile "3blpX.bssp"
#ERROR : Can't open dsspfile "3cusR.bssp"
#ERROR : Can't open dsspfile "1cdgA.bssp"
#ERROR : Can't open dsspfile "3bsgA.bssp"
#ERROR : Can't open dsspfile "3bshA.bssp"
#ERROR : Can't open dsspfile "1eceA.bssp"
#ERROR : Can't open dsspfile "1cvuA.bssp"
#ERROR : Can't open dsspfile "2dh3B.bssp"
#ERROR : Can't open dsspfile "3a5vA.bssp"
#ERROR : Can't open dsspfile "1cbyA.bssp"
#ERROR : Can't open dsspfile "3dc0A.bssp"
#ERROR : Can't open dsspfile "3cc1A.bssp"
#ERROR : Can't open dsspfile "2choB.bssp"
#ERROR : Can't open dsspfile "1b5tB.bssp"
#ERROR : Can't open dsspfile "3b40A.bssp"
#ERROR : Can't open dsspfile "1bagA.bssp"
#ERROR : Can't open dsspfile "3bc9A.bssp"
#ERROR : Can't open dsspfile "3clwC.bssp"
#ERROR : Can't open dsspfile "2dh3A.bssp"
#ERROR : Can't open dsspfile "1chkA.bssp"
#ERROR : Can't open dsspfile "2agaA.bssp"
#ERROR : Can't open dsspfile "3cnyA.bssp"
#ERROR : Can't open dsspfile "1bplA.bssp"
#ERROR : Can't open dsspfile "2bs9A.bssp"
#ERROR : Can't open dsspfile "3civA.bssp"
#ERROR : Can't open dsspfile "1bplB.bssp"
#ERROR : Can't open dsspfile "1b5tA.bssp"
#ERROR : Can't open dsspfile "3cc1B.bssp"
#ERROR : Can't open dsspfile "3bobA.bssp"
#ERROR : Can't open dsspfile "2bfgA.bssp"
#ERROR : Can't open dsspfile "1cz1A.bssp"
#ERROR : Can't open dsspfile "2aamC.bssp"
#ERROR : Can't open dsspfile "2aamA.bssp"
#ERROR : Can't open dsspfile "2c0hA.bssp"
#ERROR : Can't open dsspfile "2aamB.bssp"
#ERROR : Can't open dsspfile "3coyA.bssp"
#ERROR : Can't open dsspfile "1cbgA.bssp"
#ERROR : Can't open dsspfile "3cozB.bssp"
#ERROR : Can't open dsspfile "1b4dA.bssp"
#ERROR : Can't open dsspfile "1b31A.bssp"
#ERROR : Can't open dsspfile "1a5sA.bssp"
#ERROR : Can't open dsspfile "1bxcA.bssp"
#ERROR : Can't open dsspfile "2c7fD.bssp"
#ERROR : Can't open dsspfile "2c7fF.bssp"
#ERROR : Can't open dsspfile "2cleA.bssp"
#ERROR : Can't open dsspfile "2cliA.bssp"
#ERROR : Can't open dsspfile "1a5bA.bssp"
#ERROR : Can't open dsspfile "2cncA.bssp"
#ERROR : Can't open dsspfile "3c0uA.bssp"
#ERROR : Can't open dsspfile "2diwA.bssp"
#ERROR : Can't open dsspfile "3a21A.bssp"
#ERROR : Can't open dsspfile "3a21B.bssp"
#ERROR : Can't open dsspfile "3cqhA.bssp"
#ERROR : Can't open dsspfile "2c8nD.bssp"
#ERROR : Can't open dsspfile "2a6tA.bssp"
#ERROR : Can't open dsspfile "3cepA.bssp"
#ERROR : Can't open dsspfile "2clhA.bssp"
#ERROR : Can't open dsspfile "3d9iB.bssp"
#ERROR : Can't open dsspfile "3cqhB.bssp"
#ERROR : Can't open dsspfile "1a5aA.bssp"
#ERROR : Can't open dsspfile "1ac0A.bssp"
#ERROR : Can't open dsspfile "1edgA.bssp"

## Summary of PDB Search
:707
    3e-73  21%  2e8yA  [x.x.x] AMYX PROTEIN
    1e-70  10%  3ecqB  [x.x.x] ENDO-ALPHA-N-ACETYLGALACTOSAMINIDASE
    1e-69  30%  1bf2A  [x.x.x] ISOAMYLASE
    3e-65  21%  2bhuA  [x.x.x] MALTOOLIGOSYLTREHALOSE TREHALOHYDROLASE
    5e-65  17%  1ehaA  [b.1.18 - c.1.8 - b.71.1] GLYCOSYLTREHALOSE TREHALOHYDROLASE
    8e-65  21%  2bhyA  [x.x.x] MALTOOLIGOSYLTREHALOSE TREHALOHYDROLASE
    7e-64  20%  2bhzA  [x.x.x] MALTOOLIGOSYLTREHALOSE TREHALOHYDROLASE
    8e-63  11%  2d0fA  [x.x.x] ALPHA-AMYLASE I
    1e-60  12%  3cejA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-60  20%  1eh9A  [b.1.18 - c.1.8 - b.71.1] GLYCOSYLTREHALOSE TREHALOHYDROLASE
    1e-57  13%  2dieA  [x.x.x] AMYLASE
    2e-57  19%  3czkA  [x.x.x] SUCROSE HYDROLASE
    2e-57  12%  3edfA  [x.x.x] CYCLOMALTODEXTRINASE
    3e-57  18%  3czlA  [x.x.x] SUCROSE HYDROLASE
    6e-55  12%  3edeA  [x.x.x] CYCLOMALTODEXTRINASE
    7e-55  11%  3ecqA  [x.x.x] ENDO-ALPHA-N-ACETYLGALACTOSAMINIDASE
    1e-54  12%  1bliA  [x.x.x] ALPHA-AMYLASE
    4e-53  18%  1bvzA  [b.1.18 - c.1.8 - b.71.1] PROTEIN (ALPHA-AMYLASE II)
    7e-53  14%  1e3xA  [c.1.8 - b.71.1] ALPHA-AMYLASE
    1e-52  12%  3eddA  [x.x.x] CYCLOMALTODEXTRINASE
    7e-51  15%  4cgtA  [x.x.x] CYCLODEXTRIN GLYCOSYLTRANSFERASE
    1e-50   7%  1c7tA  [b.2.2 - d.92.2 - c.1.8 - b.1.18] BETA-N-ACETYLHEXOSAMINIDASE
    9e-50  18%  3czeA  [x.x.x] SUCROSE HYDROLASE
    3e-49  13%  3bmvA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    9e-48  14%  3bh4A  [x.x.x] ALPHA-AMYLASE
    3e-46  16%  1cygA  [x.x.x] CYCLODEXTRIN GLUCANOTRANSFERASE
    1e-45  17%  3czgA  [x.x.x] SUCROSE HYDROLASE
    1e-44   9%  1c7sA  [b.2.2 - d.92.2 - c.1.8 - b.1.18] BETA-N-ACETYLHEXOSAMINIDASE
    5e-44  17%  2cpuA  [c.1.8 - b.71.1] ALPHA-AMYLASE
    1e-43  18%  1d3cA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
    1e-43  17%  1cguA  [x.x.x] CYCLODEXTRIN GLYCOSYL-TRANSFERASE
    1e-43  16%  1ea9C  [b.1.18 - c.1.8 - b.71.1] CYCLOMALTODEXTRINASE
    1e-43  16%  3bakA  [x.x.x] PANCREATIC ALPHA-AMYLASE
    2e-43  11%  3cttA  [x.x.x] MALTASE-GLUCOAMYLASE
    5e-43  16%  1a47A  [x.x.x] CYCLODEXTRIN GLYCOSYLTRANSFERASE
    8e-43  16%  1d7fA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
    8e-43  17%  1cgtA  [x.x.x] CYCLODEXTRIN GLYCOSYL-TRANSFERASE
    1e-42  18%  1dhkA  [c.1.8 - b.71.1] PORCINE PANCREATIC ALPHA-AMYLASE
    3e-42  17%  3blkA  [x.x.x] ALPHA-AMYLASE 1
    5e-42  19%  1cgwA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    6e-42  19%  1bvnP  [c.1.8 - b.71.1] PROTEIN (ALPHA-AMYLASE)
    1e-41  18%  1cgxA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    2e-41  19%  1dtuA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] PROTEIN (CYCLODEXTRIN
    8e-41  16%  2dh2A  [x.x.x] 4F2 CELL-SURFACE ANTIGEN HEAVY CHAIN
    4e-40   6%  2choA  [x.x.x] GLUCOSAMINIDASE
    4e-40  18%  3dhpA  [x.x.x] ALPHA-AMYLASE 1
    1e-39  18%  3cgtA  [c.1.8 - b.71.1 - b.1.18 - b.3.1 (8cgtA)] CYCLODEXTRIN
    1e-39  18%  1cxlA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] PROTEIN
    2e-39  13%  1avaA  [c.1.8 - b.71.1] BARLEY ALPHA-AMYLASE 2(CV MENUET)
    6e-38  14%  1b0iA  [c.1.8 - b.71.1] PROTEIN (ALPHA-AMYLASE)
    1e-37  19%  3dhuA  [x.x.x] ALPHA-AMYLASE
    2e-37  18%  1cgvA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    2e-37  15%  1amg-  [x.x.x] 1,4-ALPHA-D-GLUCAN MALTOTETRAHYDROLASE (E.C.3.2.1.60)
    3e-37  18%  1cgyA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    5e-37  19%  3dhuB  [x.x.x] ALPHA-AMYLASE
    7e-37   7%  2droA  [x.x.x] XYLANASE Y
    1e-36  17%  6cgtA  [x.x.x] CYCLODEXTRIN GLYCOSYLTRANSFERASE
    3e-36   6%  3clwA  [x.x.x] CONSERVED EXPORTED PROTEIN
    5e-36   7%  2d73A  [x.x.x] ALPHA-GLUCOSIDASE SUSB
    7e-36  16%  2aaaA  [x.x.x] ALPHA-AMYLASE
    7e-36  15%  1aqmA  [c.1.8 - b.71.1 (1g94A)] ALPHA-AMYLASE
    8e-36  17%  3blpX  [x.x.x] ALPHA-AMYLASE 1
    5e-35  13%  3cusR  [x.x.x] PERIPLASMIC [NIFE] HYDROGENASE LARGE SUBUNIT
    5e-35  18%  1cdgA  [x.x.x] CYCLODEXTRIN GLYCOSYL-TRANSFERASE
    7e-34  18%  3bsgA  [x.x.x] ALPHA-AMYLASE TYPE A ISOZYME
    2e-33  19%  3bshA  [x.x.x] ALPHA-AMYLASE TYPE A ISOZYME
    5e-32  12%  1eceA  [c.1.8] ENDOCELLULASE E1
    1e-31   9%  1cvuA  [g.3.11 - a.93.1] PROSTAGLANDIN H2 SYNTHASE-2
    3e-31  15%  2dh3B  [x.x.x] 4F2 CELL-SURFACE ANTIGEN HEAVY CHAIN
    1e-30   8%  3a5vA  [x.x.x] ALPHA-GALACTOSIDASE
    2e-30  14%  1cbyA  [x.x.x] DELTA-ENDOTOXIN CYTB
    7e-30  16%  3dc0A  [x.x.x] ALPHA-AMYLASE
    8e-30   9%  3cc1A  [x.x.x] PUTATIVE ALPHA-N-ACETYLGALACTOSAMINIDASE
    1e-29   7%  2choB  [x.x.x] GLUCOSAMINIDASE
    1e-29   8%  1b5tB  [c.1.23] PROTEIN (METHYLENETETRAHYDROFOLATE REDUCTASE)
    2e-29   8%  3b40A  [x.x.x] PROBABLE DIPEPTIDASE
    3e-29  16%  1bagA  [x.x.x] ALPHA-1,4-GLUCAN-4-GLUCANOHYDROLASE
    3e-28  19%  3bc9A  [x.x.x] ALPHA AMYLASE, CATALYTIC REGION
    1e-27   8%  3clwC  [x.x.x] CONSERVED EXPORTED PROTEIN
    2e-26  15%  2dh3A  [x.x.x] 4F2 CELL-SURFACE ANTIGEN HEAVY CHAIN
    3e-26   9%  1chkA  [d.2.1] CHITOSANASE
    3e-26   9%  2agaA  [x.x.x] MACHADO-JOSEPH DISEASE PROTEIN 1
    1e-25   8%  3cnyA  [x.x.x] INOSITOL CATABOLISM PROTEIN IOLE
    5e-25  20%  1bplA  [c.1.8] ALPHA-1,4-GLUCAN-4-GLUCANOHYDROLASE
    5e-25   7%  2bs9A  [x.x.x] BETA-XYLOSIDASE
    2e-24   6%  3civA  [x.x.x] ENDO-BETA-1,4-MANNANASE
    3e-24  14%  1bplB  [c.1.8 - b.71.1] ALPHA-1,4-GLUCAN-4-GLUCANOHYDROLASE
    3e-24   9%  1b5tA  [c.1.23] PROTEIN (METHYLENETETRAHYDROFOLATE REDUCTASE)
    4e-24   9%  3cc1B  [x.x.x] PUTATIVE ALPHA-N-ACETYLGALACTOSAMINIDASE
    9e-24   9%  3bobA  [x.x.x] CADMIUM-SPECIFIC CARBONIC ANHYDRASE
    1e-23   5%  2bfgA  [x.x.x] BETA-XYLOSIDASE
    1e-23   8%  1cz1A  [c.1.8] PROTEIN (EXO-B-(1,3)-GLUCANASE)
    3e-23   8%  2aamC  [x.x.x] HYPOTHETICAL PROTEIN TM1410
    3e-21  10%  2aamA  [x.x.x] HYPOTHETICAL PROTEIN TM1410
    1e-18   6%  2c0hA  [x.x.x] MANNAN ENDO-1,4-BETA-MANNOSIDASE
    1e-18   9%  2aamB  [x.x.x] HYPOTHETICAL PROTEIN TM1410
    4e-17  14%  3coyA  [x.x.x] PANTOTHENATE SYNTHETASE
    5e-17  11%  1cbgA  [x.x.x] CYANOGENIC BETA-GLUCOSIDASE
    4e-16  16%  3cozB  [x.x.x] PANTOTHENATE SYNTHETASE
    7e-15  20%  1b4dA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE B)
    2e-14   9%  1b31A  [c.1.8] PROTEIN (XYLANASE)
    2e-14  10%  1a5sA  [c.1.2] TRYPTOPHAN SYNTHASE (ALPHA CHAIN)
    9e-14   8%  1bxcA  [c.1.15] XYLOSE ISOMERASE
    2e-13   9%  2c7fD  [x.x.x] ALPHA-L-ARABINOFURANOSIDASE
    7e-13   6%  2c7fF  [x.x.x] ALPHA-L-ARABINOFURANOSIDASE
    6e-12  10%  2cleA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    6e-12  11%  2cliA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    1e-11  11%  1a5bA  [c.1.2] TRYPTOPHAN SYNTHASE (ALPHA CHAIN)
    2e-11  12%  2cncA  [x.x.x] ENDOXYLANASE
    3e-11   8%  3c0uA  [x.x.x] UNCHARACTERIZED PROTEIN YAEQ
    3e-11  11%  2diwA  [x.x.x] PUTATIVE RNA-BINDING PROTEIN 16
    8e-11   9%  3a21A  [x.x.x] PUTATIVE SECRETED ALPHA-GALACTOSIDASE
    1e-09  11%  3a21B  [x.x.x] PUTATIVE SECRETED ALPHA-GALACTOSIDASE
    1e-08  13%  3cqhA  [x.x.x] L-RIBULOSE-5-PHOSPHATE 3-EPIMERASE ULAE
    2e-08  11%  2c8nD  [x.x.x] ALPHA-L-ARABINOFURANOSIDASE
    1e-07  10%  2a6tA  [x.x.x] SPAC19A8.12
    1e-07  10%  3cepA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    1e-06  11%  2clhA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    2e-06  13%  3d9iB  [x.x.x] RNA-BINDING PROTEIN 16
    5e-06  14%  3cqhB  [x.x.x] L-RIBULOSE-5-PHOSPHATE 3-EPIMERASE ULAE
    3e-05  10%  1a5aA  [c.1.2] TRYPTOPHAN SYNTHASE (ALPHA CHAIN)
    1e-04  17%  1ac0A  [x.x.x] GLUCOAMYLASE
    6e-04   9%  1edgA  [x.x.x] ENDOGLUCANASE A
:707

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxEVWPGHAYPLGATYDGSGTNFSLFSEVATGVELCLFDDDGAETRVPLTEQDGHVWHGYLPTVGPGQ
2e8yA           ----DDEFYYDGELGAVYTADHTVFKVWAPAATSAAVKLSHPNKSGRTFQMTRLEKGVYAVTVTGDLHGY
3ecqB           -------GDDHIDVTNPKDLAKGYYGFVSTDKLAAGVWSNSQNGSNDWTRLTAYKETVGNANYVGIHSSE
1bf2A           --------INSMSLGASYDAANITFRVYSSQATRIVLYLYSAGYGVATYTLSPAGSGVWSIKAAGITGAV
2bhuA           --------DPRTRLGATPGGAGTRFRLWTSTARTVAVRVNGT-----EHVMTSLGGGIYELELP-VGPGA
1ehaA           -------------FAYKIDGNEVIFTLWAPYQKSVKLKVLEKG----LYEMERDEKGYFTITLNNVKVRD
2bhyA           ----QTQHDPRTRLGATPGGAGTRFRLWTSTARTVAVRVNGTE------HVTSLGGGIYELELP-VGPGA
2bhzA           ----QTQHDPRTRLGATPGGAGTRFRLWTSTARTVAVRVNGTE------HVTSLGGGIYELELP-VGPGA
2d0fA           -----------DNAPEPTSTQSVTLKLRTFKGDITSANIKYWDTMVWDSNDPTGTFDYWKGTIPASPSIK
3cejA           ----------------------------------------------------------------------
1eh9A           -------------FAYKIDGNEVIFTLWAPYQKSVKLKVLEKG----LYEMERDEKGYFTITLNNVKVRD
2dieA           ----------------------------------------------------------------------
3czkA           -------------------------------------------------------------------PAL
3edfA           ---------------------------------------------------------IEHMEPPFWWGMQ
3czlA           -------------------------------------------------------------------PAL
3edeA           ---------------------------------------------------------IEHMEPPFWWAGQ
3ecqA           -------------------------------------------GSNDWTRLTAYKETVGNANYVGIHSSE
1bliA           ----------------------------------------------------------------------
1bvzA           ------------SYAYPISETQLRVRLRAKKGDVVRCEVLYAD--------------------RYASPEE
1e3xA           ----------------------------------------------------------------------
3eddA           ----------------------------TAIEHMEPPFWWAGMQ-HKGLQLMVHGRDIGRMEAALDYPGV
4cgtA           ----------------------------------------------------------------------
1c7tA           --------------------------------------------------------GVPVQTNGYPIKTD
3czeA           --------------------------------------------------------------------PP
3bmvA           ----------------------------------------------------------------------
3bh4A           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
3czgA           --------------------------------------------------------------------PP
1c7sA           ----------------------------------------------------------------------
2cpuA           ----------------------------------------------------------------------
1d3cA           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
1ea9C           -------PRKNFSYAYNGTTVHLRIRTKKDDMTAVYALAGDKYMWPMTKLATDELFDYWECEVTPPYRRV
3bakA           ----------------------------------------------------------------------
3cttA           ---------SRQPFSIKVTRRSNNRVLFDSSIGPLLFAQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWP
1a47A           ----------------------------------------------------------------------
1d7fA           ----------------------------------------------------------------------
1cgtA           ----------------------------------------------------------------------
1dhkA           ----------------------------------------------------------------------
3blkA           ----------------------------------------------------------------------
1cgwA           ----------------------------------------------------------------------
1bvnP           ----------------------------------------------------------------------
1cgxA           ----------------------------------------------------------------------
1dtuA           ----------------------------------------------------------------------
2dh2A           ----------------------------------------------------------------------
2choA           ------PPQQLIVQNKTIDPAVYQLNGGEEANPHAVKVLKELLG--MLISIGEKGDKSVRKYSRQ-IPDH
3dhpA           ----------------------------------------------------------------------
3cgtA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1avaA           ----------------------------------------------------------------------
1b0iA           ----------------------------------------------------------------------
3dhuA           ----------------------------------------------------------------------
1cgvA           ----------------------------------------------------------------------
1amg-           ----------------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
3dhuB           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
6cgtA           ----------------------------------------------------------------------
3clwA           ----------------------------------------------------------------------
2d73A           ------------------------------------------GMNGDHIAFWIPGDYDTQEYDYTISRLS
2aaaA           ----------------------------------------------------------------------
1aqmA           ----------------------------------------------------------------------
3blpX           ----------------------------------------------------------------------
3cusR           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
3bsgA           ----------------------------------------------------------------------
3bshA           ----------------------------------------------------------------------
1eceA           ----------------------------------------------------------------------
1cvuA           ----------------------------------------------------------------------
2dh3B           ----------------------------------------------------------------------
3a5vA           ----------------------------------------------------------------------
1cbyA           ----------------------------------------------------------------------
3dc0A           ----------------------------------------------------------------------
3cc1A           ----------------------------------------------------------------------
2choB           ------PPQQLIVQNKTIDPAVYQLNGGEEANPHAVKVLKELLGM-----------LISIGEKGDKSVRK
1b5tB           ----------------------------------------------------------------------
3b40A           ----------------------------------------------------------------------
1bagA           ----------------------------------------------------------------------
3bc9A           ----------------------------SKNLTEIILIFSNDINKVSQLALT---DLITDSDIQGIDYNI
3clwC           ----------------------------------------------------------------------
2dh3A           ----------------------------------------------------------------------
1chkA           ----------------------------------------------------------------------
2agaA           ----------------------------------------------------------------------
3cnyA           ----------------------------------------------------------------------
1bplA           ----------------------------------------------------------------------
2bs9A           ----------------------------------------------------------------------
3civA           ----------------------------------------------------------------------
1bplB           ----------------------------------------------------------------------
1b5tA           ----------------------------------------------------------------------
3cc1B           ----------------------------------------------------------------------
3bobA           ----------------------------------------------------------------------
2bfgA           ----------------------------------------------------------------------
1cz1A           ----------------------------------------------------------------------
2aamC           ----------------------------------------------------------------------
2aamA           ----------------------------------------------------------------------
2c0hA           ----------------------------------------------------------------------
2aamB           ----------------------------------------------------------------------
3coyA           ----------------------------------------------------------------------
1cbgA           ----------------------------------------------------------------------
3cozB           ----------------------------------------------------------------------
1b4dA           ----------------------------------------------------------------------
1b31A           ----------------------------------------------------------------------
1a5sA           ----------------------------------------------------------------------
1bxcA           ----------------------------------------------------------------------
2c7fD           ----------------------------------------------------------------------
2c7fF           ----------------------------------------------------------------------
2cleA           ----------------------------------------------------------------------
2cliA           ----------------------------------------------------------------------
1a5bA           ----------------------------------------------------------------------
2cncA           ----------------------------------------------------------------------
3c0uA           ----------------------------------------------------------------------
2diwA           ----------------------------------------------------------------------
3a21A           ----------------------------------------------------------------------
3a21B           ----------------------------------------------------------------------
3cqhA           ----------------------------------------------------------------------
2c8nD           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
3cepA           ----------------------------------------------------------------------
2clhA           ----------------------------------------------------------------------
3d9iB           ----------------------------------------------------------------------
3cqhB           ----------------------------------------------------------------------
1a5aA           ----------------------------------------------------------------------
1ac0A           ---------------TTPTAVAVTFDLTATTTYGENIYLVGSDGIALSADKYTSSDPLWYVTVTPAGESF
1edgA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RYGYRVHGPYDPERGLRCNPNKLLVDPYAKAIDGQIHWHESLFDYHFADPGRVNNHDSAPYVPTCVVVSP
2e8yA           EYLFCICNN---------SEWMETVDQYAKAVTVNGEKG-------------------------VVLRPD
3ecqB           WQWEKAYKGIVF-------PEYTKELPSAKVVITEDANA-----------------------------DK
1bf2A           YYGYRAWGPNWPYASNRFNPNKLLLDPYAQEVSQDPLNPSNQNGNVFASGASYRTTDSGIYAPKGVVLVP
2bhuA           RYLFVLDGVPTP-------------DPYARFLPDGVHG------------------------EAEVVDFG
1ehaA           RYKYVLDDASE------------IPDPASRYQPEGVHGP-------------------------SQIIQE
2bhyA           RYLFVLDGVPTP-------------DPYARFLPDGVHGE------------------------AEVVDFG
2bhzA           RYLFVLDGVPTP-------------DPYARFLPDGVHG------------------------EAEVVDFG
2d0fA           YYRFQITSTAWYNGNGPSSTEPNADDFYIIPNFKTPDWLKNGVMY------QIFPDRFYNGDSSNDVQTG
3cejA           ----------------------------------------------------------------------
1eh9A           RYKYVLDDASE------------IPDPASRYQPEGVHGPSQIIQESKEFNN-------------------
2dieA           ----------------------------------------------------------------------
3czkA           RAAF--AGPLDPQHAEV---LLSRYDQHASRLLDALHLYGQRADY-ASWLAQWLGEV-----GDIARQRP
3edfA           HKGLQLMVHGRDIGRMEA----ALDYPGVRLVSPTRVPNANYLFVDLEIGPEAQPDIVFKGDGRSERYRL
3czlA           RAAFA--GPLDPQHAEV---LLSRYDQHASRLLDALHALYGQRADYASWLAQWLGEVGDIAR--------
3edeA           HKGLQLMVHGRDIGRMEAA----LDYPGVRLVSPTRVPNANYLFVDLEIGPEAQPDIVFKGDGRSERYRY
3ecqA           WQWEKAYKGIVF-------PEYTKELPSAKVVITEDANA-----------------------------DK
1bliA           ----------------------------------------------------------------------
1bvzA           ELAHALAGKAGSDE--RFDYFEALLECSTKRVKYVFLLTGPQGEAVYFGET-----GFSAERSKAGVFQY
1e3xA           ----------------------------------------------------------------------
3eddA           RLVSTTRVPNANYLFVDLEIGPEAQPGSFDIVFK-GDGRSERYRYRL---------------------LA
4cgtA           ----------------------------------------------------------------------
1c7tA           IQPGKFKGAMAVSGAYELKIGKKEAQVIGFDQAGVFYGLQSILSLVPSDGSGKIATLDASDAPRF----P
3czeA           ALRAAFAGPLAEV-------LLSRYDQHASRLLDALHALYGQRADYASWLAQ------------------
3bmvA           ----------------------------------------------------------------------
3bh4A           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
3czgA           ALRAAFAGPLDPQHAEVL---LSRYDQHASRLLDALALYGQRADYA-------------------SWLAQ
1c7sA           -QPGKFKGAMAVSGAYELKIGKKEAQVIGFDQAGVFYGLQSILSLVPSDG------SGKIATLDASDAPR
2cpuA           ----------------------------------------------------------------------
1d3cA           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
1ea9C           KYGFLLQQGHE----------KRWMTEYDFLTEPPANPDRLFEYPFINPVDVFQPPAWVKD-------AI
3bakA           ----------------------------------------------------------------------
3cttA           IFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGN
1a47A           ----------------------------------------------------------------------
1d7fA           ----------------------------------------------------------------------
1cgtA           ----------------------------------------------------------------------
1dhkA           ----------------------------------------------------------------------
3blkA           ----------------------------------------------------------------------
1cgwA           ----------------------------------------------------------------------
1bvnP           ----------------------------------------------------------------------
1cgxA           ----------------------------------------------------------------------
1dtuA           ----------------------------------------------------------------------
2dh2A           ----------------------------------------------------------------------
2choA           KEGYYLSVNEK------------------------------------------EIVLAGNDERGTYYALQ
3dhpA           ----------------------------------------------------------------------
3cgtA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1avaA           ----------------------------------------------------------------------
1b0iA           ----------------------------------------------------------------------
3dhuA           ----------------------------------------------------------------------
1cgvA           ----------------------------------------------------------------------
1amg-           ----------------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
3dhuB           ----------------------------------------------------------------------
2droA           ---LFGDNPETKIYYEVGDDLGYLLDTGNLDVRTEGMSYGMMMAVQMDRKDIFDRIWNKNMYMTEGVHAG
6cgtA           ----------------------------------------------------------------------
3clwA           ----------------------------------------------------------------VFIIDK
2d73A           EIRGLMKEAITPNSSQTPFSQTGVQTALMMKTDDGLYYSCMHLNLDDKNMVFESWLTPDAKGDKGYMQTP
2aaaA           ----------------------------------------------------------------------
1aqmA           ----------------------------------------------------------------------
3blpX           ----------------------------------------------------------------------
3cusR           -------DPITRIEGLRI---MVEVENDAWSSSQLFRGLEIILDPRDAQHQRACGICTYVH-ALASSRCV
1cdgA           ----------------------------------------------------------------------
3bsgA           ----------------------------------------------------------------------
3bshA           ----------------------------------------------------------------------
1eceA           --------------------------------------------------------------------GG
1cvuA           ----------------------------------------------------------------QNRIAS
2dh3B           ----------------------------------------------------------------------
3a5vA           ----------------------------------------------------------------------
1cbyA           ----------------------------------------------------------------------
3dc0A           ----------------------------------------------------------------------
3cc1A           ----------------------------------------------------------------------
2choB           YSRQIPDHKE----GYYLSVNEKEIVLAGNDERGTYYALQTFAQLLKDGKLP------------------
1b5tB           -------------------PRTSEMEQTLWNSIDRLSSLKPKFVSVTYGANSGERDRTHSIIKDRTGLEA
3b40A           --------------------------------------------MWPHKPTPGFVDEARHQQEIKILTGM
1bagA           ----------------------------------------------------------------------
3bc9A           EGNKVIINNFSLEPTCNYRLSYEVIDIYDNHL---------------------------QGYIEFLVNQS
3clwC           ----------------------------------------------------------------VFIIDK
2dh3A           ----------------------------------------------------------------------
1chkA           ----------------------------------------------------------------------
2agaA           ----------------------------------------------------------------------
3cnyA           ----------------------------------------------------------------------
1bplA           ----------------------------------------------------------------------
2bs9A           ----------------------------------------------------------------------
3civA           ----------------------------------------------------------------------
1bplB           ----------------------------------------------------------------------
1b5tA           -------------------PRTSEMEQTLWNSIDRLSSLKPKFVSVTYGANSGERDRTHSIIIKDRTGLE
3cc1B           ----------------------------------------------------------------------
3bobA           -------------------------------------------------PAQIAEALQGRGWDAEIVT--
2bfgA           ----------------------------------------------------------------------
1cz1A           ---------------------------------------------------------------------M
2aamC           ----------------------------------------------------------------------
2aamA           ----------------------------------------------------------------------
2c0hA           ----------------------------------------------------------------------
2aamB           ----------------------------------------------------------------------
3coyA           ----------------------------------------------------------------------
1cbgA           ---------------------------------------------------------------------Q
3cozB           ----------------------------------------------------------------------
1b4dA           ----------------------------------------------------------------------
1b31A           ----------------------------------------------------------------------
1a5sA           ----------------------------------------------------------------------
1bxcA           ----------------------------------------------------------------------
2c7fD           ----------------------------------------------------------------------
2c7fF           ----------------------------------------------------------------------
2cleA           ----------------------------------------------------------------------
2cliA           ----------------------------------------------------------------------
1a5bA           ----------------------------------------------------------------------
2cncA           ----------------------------------------------------------------------
3c0uA           ----------------------------------------------------------------------
2diwA           ----------------------------------------------------------------------
3a21A           ----------------------------------------------------------------------
3a21B           ----------------------------------------------------------------------
3cqhA           ----------------------------------------------------------------------
2c8nD           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
3cepA           ----------------------------------------------------------------------
2clhA           ----------------------------------------------------------------------
3d9iB           ----------------------------------------------------------------------
3cqhB           ----------------------------------------------------------------------
1a5aA           ----------------------------------------------------------------------
1ac0A           EYKFIRIESDDSVE--------WESDPNREY---------------------------------------
1edgA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           FFDWGAEQHPNIPYHETVIYEAHVRGMTIRHPDVPPPLRGTYAGMAHPAIIEHLLSLGVTAVELMPIHHF
2e8yA           QMKWTAPLKPFSHPVDAVIYETHLRDFSIHENSGMINKGKYLALTETDSGLAYVKELGVTHVELLPVNDF
3ecqB           KVDWQDGAIAYRSINNPQGWKKVKDITAYRIANFGSQAQNPFLTLDGIK-KINLHTDGLGQGVLLKGYGS
1bf2A           STQSTGTKPTRAQKD---DVIYEVHVRGFTEQDTSIPAQYRGTYYGAGLKASYLASLGVTAVEFLPVQET
2bhuA           TFDWTDADWHGIKLADCVFYEVHVGTFTPE---------GTYRAAAE--KLPYLKELGVTAIQVMPLAAF
1ehaA           SKEFNN--ETFLKKEDLIIYEIHVGTFTPE---------GTFEGVIR--KLDYLKDLGITAIEIMPIAQF
2bhyA           TFDWTDADWHGIKLADCVFYEVHVGTFTPEG---------TYRAAAEK--LPYLKELGVTAIQVPLAAFD
2bhzA           TFDWTDADWHGIKLADCVFYEVHVGTFTPEG---------TYRAAAEK--LPYLKELGVTAIQVPLAAFD
2d0fA           SYTYNGTPTEKKAWGSSVYADPGYDNSLVFFG-------GDLAGIDQK-LGYIKKTLGANILYLNPIFKA
3cejA           ------------------------------------------------SFNRHLHTLVKDRNVATTRDYY
1eh9A           --------ETFLKKEDLIIYEIHVGTFTPE---------GTFEGVIR--KLDYLKDLGITAIEIMPIAQF
2dieA           ----------------GTMMQYF--------EWHLPNDGNHWNRLRD--DAANLKSKGITAVWIPPAWKG
3czkA           QALQ----TLDSTRHAGWFGQPHMLGYS----AYADRFAGTLQGVAE--RVPYLQELGVRYLHLLPFLRA
3edfA           LAREQGSAQRQGFGPGDAIYQIMPDRFANGDPSNDNVAGMREQADRRHDHLDYIAGLGFTQLWPTPLVEN
3czlA           -QRPQALQTLDSTRHAGWFGQPHMLGYS----AYADRFAGTLQGVAE--RVPYLQELGVRYLHLLPFLRA
3edeA           RLLAREQGSAQRQGPGDAIYQIMPDRFANGDPSNDNVAGMREQADRRHDHLDYIAGLGFTQLWPTPLVEN
3ecqA           KVDWQDGAIAYRSINNPQGWKKVKDITAYRIANFGSQAQNPFLTLDGIKK-INLHTDGLGQGVLLKGYGS
1bliA           ------------------LNGTLMQYFEWYMPND----GQHWKRLQN--DSAYLAEHGITAVWIPPAYKG
1bvzA           AYIHRSEVFTTEWAKEAVIYQIFPERFANGDPSNDPPGTEQWAKDARPRHLPYLEELGVTALYFTPIFAS
1e3xA           ------------------VNGTLMQYFE----WYTPNDGQHWKRLQN--DAEHLSDIGITAVWIPPAYKG
3eddA           REQGSAQRQG--FGPGDAIYQIMPDRFANGDPSNDNVAGMREQADRRIDHLDYIAGLGFTQLWPTPLVEN
4cgtA           --DPDTAVTNKQSFSTDVIYQVFTDRYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVEN
1c7tA           YRGIFLDVARNFHKKDAVLRLLDQMAAYKLNKFHF----HLSDDEGWRIEIPGLPELTEVGGQRCHDLSE
3czeA           WLGEVGDIARQRPQALQTLDSTRHAGWFGQPHLGADRFAGTLQGVAE--RVPYLQELGVRYLHLLPFLRA
3bmvA           --------SNVVNYSTDVIYQIVTDRFVDGHTSLKKYFGGDWQGIINKINDGYLTGMGVTAIWIPQPVEN
3bh4A           ------------------VNGTLMQYFE----WYTPNDGQHWKRLQN--DAEHLSDIGITAVWIPPAYKG
1cygA           -----AGNLNKVNFTSDVVYQIVVDRFVDGNTSLRKYCGGDWQGIINKINDGYLTDMGVTAIWISQPVEN
3czgA           WLGEVGDIARQRPQALQTLDSTRHAGWFGQPHLGYSAYADRFAGQGVAERVPYLQELGVRYLHLLPFLRA
1c7sA           FPYRGIFLDVARNFHKKDAVLRLLDQMAAYKLNKFHFHLSDDEGW--RIEIPGLPELTEVGGQRCHDLSE
2cpuA           ----------SPNTQQGRTSIVHLFE------------WRWVDIAL--ECERYLAPKGFGGVQVSPPN--
1d3cA           -----TSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTCGGDWQGIINKINDGYLTGMGVTAIWISQPVEN
1cguA           --DPDTAVTNKQSFSTDVIYQVFTDRYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVEN
1ea9C           FYQIFPERFANGDTRNDPEGTLPWG---SADPTPSCFFGGDLQGVIDHLDHLS--KLGVNAVYFTPLFKA
3bakA           ----------SPNTQQGRTSIVHLFE------------WRWVDIAL--ECERYLAPKGFGGVQVSPPN--
3cttA           VVQEYLELIGRPALPSYWALGFHLSRYE----------YGTLDNMRE--VVERNRAAQLPYDVQHADIDY
1a47A           --------SNVVNYSTDVIYQIVTDLYDPTHTSLKKYFGGDWQGIINKINDGYLTGMGVTAIWISQPVEN
1d7fA           -----TSVSNKQNFSTDVIYQIFTDRFSDGNPALRLYCGGDWQGIINKINDGYLTGMGITAIWISQPVEN
1cgtA           -----TAVTNKQSFSTDVIYQVFTDAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVEN
1dhkA           --------APQTQSGRTSIVHLFEWR--------------WVDIALE--CERYLGPKGFGGVQVSPPNEN
3blkA           --------SSNTQQGRTSIVHLFEWR--------------WVDIAL--ECERYLAPKGFGGVQVSPPN--
1cgwA           -------VSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAGDWQGIINKINDGYLTGMGVTAIWISQPVEN
1bvnP           ---------PQTQSGRTDIVHLFEWR--------------WVDIALE--CERYLGPKGFGGVQVSPPN--
1cgxA           -----TSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAGDWQGIINKINDGYLTGMGVTAIWISQPVEN
1dtuA           -----TSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTCGGDWQGIINKINDGYLTGMGVTAIWISQPVEN
2dh2A           ----GSELPAQKWWHTGALYRIGDLQAF------QGHGAGNLAGLKG--RLDYLSSLKVKGLVLGPIHKN
2choA           TFAQLLKDGKLPEVEIKDYPSVRYRGVVEGFYGTP----WSHQARLS--QLKFYGKNKMNTYIYGPKD--
3dhpA           --------SSNTQQGRTSIVHLFEWR--------------WVDIAL--ECERYLAPKGFGGVQVSPPN--
3cgtA           --DPDTAVTNKQSFSTDVIYQVFTDAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVEN
1cxlA           -------VSNKQNFSTDVIYQIFTDRFSDGNPANNPTGGGDWQGIINKINDGYLTGMGVTAIWISQPVEN
1avaA           -----------------VLFQGFNW-------ESWKHNGGWYNFLMG--KVDDIAAAGITHVWLPPASQS
1b0iA           ------------------------------PTTFVHLFEWNWQDVAQE-CEQYLGPKGYAAVQVSPPNEH
3dhuA           -----------TQLRNEMIYSVFVRNYSEA---------GNFAGVTA--DLQRIKDLGTDILWLLPIN--
1cgvA           --------SNKQNFSTDVIYQIFTDRFSDGNPANNPTGGGDWQGIINKINDGYLTGMGVTAIWISQPVEN
1amg-           -AGK-SPNAVRYHGGDEIILQGFHW-------NVVREAPNDWYNILRQ-QAATIAADGFSAIWMPVPWRD
1cgyA           -----TSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAGDWQGIINKINDGYLTGMGVTAIWISQPVEN
3dhuB           -----------TQLRNEMIYSVFVRNYSEA---------GNFAGVTA--DLQRIKDLGTDILWLLPIN--
2droA           YFAWSCQPDGTKNSWEYFALALFFASHRWGDGDEQPF--NYSEQAR--KLLHTCVHNGEGGPGHPMWNRD
6cgtA           -----TAVTNKQSFSTDVIYQVFTDRYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVEN
3clwA           QTVYQEIDNFASDAWRCAFIGKNWPQEKKEKIA-----DLLFKREFDE--KGNPIGMALTNWRVNIGAGS
2d73A           CNTPWRSDDARNILASRITLNLNEPCKIADAASWVKPVKYIGVWWDMIT------GKGSWAYTDELTSV-
2aaaA           -------------WRTQSIYFLLTDRFGRTDNSTTATCNTGNEIYCGGDHLDYIEGMGFTAIWISPITEQ
1aqmA           ------------------------------PTTFVHLFEWNWQDVAQ-ECEQYLGPKGYAAVQVSPPNEH
3blpX           --------SSNTQQGRTSIVHLFEWR--------------WVDIALE--CERYLAPKGFGGVQVSPPN--
3cusR           DDAVKVSIPANARMMRNLVMASHLVHFYHFHADVTAALKADPNKAAKLAASIAPARPGNSAKALKAVQDK
1cdgA           -----TSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGGGDWQGIINKINDGYLTGMGVTAIWISQPVEN
3bsgA           -------------------HQVLFQGF---NWESWKQSGGWYNMMMG--KVDDIAAAGVTHVWLPPPSHS
3bshA           -------------------HQVLFQGF---NWESWKQSGGWYNMMMG--KVDDIAAAGVTHVWLPPPSHS
1eceA           YWHTSGREILDANNVPVRIAGINWFGFETCNYVVH---GLWSRDYR--SMLDQIKSLGYNTIRLPYSDDI
1cvuA           EFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFTRQIAGRVAGGRNVPIAVQAVAK
2dh3B           ----GSELPAQKWWHTGALYRIGDLQAF------QGHGAGNLAGLKG--RLDYLSSLKVKGLVLGPIHKN
3a5vA           --------------------------------------NVDEQLIL--DAAKAIASSGLKDLGYNYVIID
1cbyA           ----------------------------------------------------------------------
3dc0A           -------------IKSGTILHAW---------------NWSFNTLKN--NMKDIHDAGYTAIQTSPINQV
3cc1A           ---------SALTPPGWNSWDCYGASVT----------EEEVLGNA--EYANHLKKYGWEYIVVDIQWYE
2choB           ------------EVEIKDYPSVRYRGVVEGFYGTP----WSHQARLS--QLKFYGKNKMNTYIYGPKDD-
1b5tB           APHLTCIDATPDELRT-IARDYWNNGIRHIVALRGLPPGSGKPEMYASDLVTLLKEVADFDISVAAYPEV
3b40A           VRDFPNQVGIAYSPEDFRRLAMEGKFAIVMSMLNAYPLGDDLS------QLDKWAARGVRMFGFSYVGNN
1bagA           --------------APSIKSGTILHA-----------WNWSFNTLKH--NMKDIHDAGYTAIQTSPINQV
3bc9A           NYPQIPDQEVNHTILQAFYWEMNTGEYATEHPEEA----NLWNLLAERA--PELAEAGFTAVWLPPANKG
3clwC           QTVYQEIDNSASDAWRCAFIGKNWPQEKKEKI-----ADLLFKREFDE--KGNPIGMALTNWRVNIGAGS
2dh3A           ------------WWHTGALYRIGDLQAF------QGHGAGNLAGLKG--RLDYLSSLKVKGLVLGPIHKN
1chkA           -------------PHKKEIAMELVSSAENSSLDWKAQYKGDMLELVQ--HYTDLEPGNILAKYLPALKKV
2agaA           ----------------------------------------------------------------------
3cnyA           --------------EKDIKWGIAPIGWR------NDDIPSIGKDNNLQQLLSDIVVAGFQGTEVGGFFPG
1bplA           ------------------LNGTLMQY----FEWYMPNDGQHWKRLQND--SAYLAEHGITAVWIPPAYKG
2bs9A           ----------NVPSNGREKFKKNWKF----CVGTGRLGLALQKEYLD-HLKLVQEKIGFRYIRGHGLLSD
3civA           ----------ESAFDLGFIRGMTFG-------FVGQHGTWGTDEARA--SMRALAEQPFNWVTLAFAGL-
1bplB           ----------------------------------------------------------------------
1b5tA           AAPHLTCIDATPDELRTIARDYWNNGIRHIVALRGDLPPGSGKPEMYADLVTLLKEVADFDISVAAYPEV
3cc1B           --------------------------------------EEEVLGNA--EYANHLKKYGWEYIVVDIQWYE
3bobA           --DASMAGQLVDVRPEGILKCVDGRGSDNTRMGGPKMPGGIYAIATSIEGLKQITKEVASKGHLPSVHGD
2bfgA           ----------NVPSNGREKFKKNWKFCVGTGRLGLALQKEYLDHL-----KLVQEKIGFRYIRGHGLLSD
1cz1A           TPSLFEPFQNGNDQSGVPVDEYHWTQTL-GKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWA
2aamC           ------------------------------------------------------------LYQLQNADPV
2aamA           ------------------------------------------------------------LYQLQNADPV
2c0hA           ------------------LSGANQAWVNYARDFGHNQYSKGKSTFES--TLSDMQSHGGNSVRVWLHIEG
2aamB           ------------------------------------------------------------LYQLQNADPV
3coyA           ----------------------------------------------------------------------
1cbgA           YEGAAFEDGKGPSIWDTFTHKYPEKIKDRTNGDVAIDEYHRYKED-----IGIMKDMNLDAYRFSIS---
3cozB           ----------------------------------------------------------------------
1b4dA           ----------------------------------------------------------------------
1b31A           -------------------------------------HGKKYLGTI--GDQYTLTKNTKNPAIIKADF--
1a5sA           ---------------------------------------PGIEQSL--KIIDTLIDAGADALELGVPFSD
1bxcA           ---------PKPEHRFTFGLWTVGNVGR------DPFGDAVRERLDPVYVGHKLAELGVHGVNLHDEDLI
2c7fD           --------IAEIDKRIYGSFVEHLGRAVYDGLYQPGNSKSDEDGFRK-DVIELVKELNVPIIRYPGGNFV
2c7fF           ------------------------RAVYDGLYQPGNSKSDEDGFRKD--VIELVKELNVPIIRYPGGNFV
2cleA           -----------------QLNDRREGAFVPFVTLGDPGIEQS------LKIIDTLIDAGADALELGVPFSD
2cliA           ---------------------------------------PGIEQSL--KIIDTLIDAGADALELGVPFSD
1a5bA           --------------------------------------DPGIEQSL--KIIDTLIDAGADALELGVPFSD
2cncA           ----------------------------------------------------------------------
3c0uA           ----------------------------------------------------------------------
2diwA           ----------------------------------------------------------------------
3a21A           ----------------------------------------------------------------------
3a21B           ----------------------------------------------------------------------
3cqhA           -------------------------------------EKALPAGECWLERLQLAKTLGFDFVESVDETDE
2c8nD           --------------------------------------------------IELVKELNVPIIRYPGGNFV
2a6tA           --------------------------------------------------SQVLDDLSARFILNLPAE--
3cepA           ---------------------------------------PGIEQSL--KIIDTLIDAGADALELGVPFSD
2clhA           ------------------------------------------------KIIDTLIDAGADALELGVP---
3d9iB           ----------------------------------------------------------------------
3cqhB           ----------------------------------------ALPAECWLERLQLAKTLGFDFVESVDETDE
1a5aA           ------------------------------------------------KIIDTLIDAGADALELGVPANG
1ac0A           ----------------------------------------------------------------------
1edgA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LPEHALVARGLTNYWGYNTLAFFAPHSGYAATGTRGHQVQEFKTMVKALHQAGIEVILDVVYNHTAEGDH
2e8yA           -AGVDEEKPLDAYNWGYNPLHFFAPEGSYASNPHPQTRKTELKQMINTLHQHGLRVILDVVFNHVYKREN
3ecqB           ------------EGHDSGHLNYADIGKRI---GGVED----FKTLIEKAKKYGAHLGIHVNASETYPESK
1bf2A           QNDANDNSDANQNYWGYMTENYFSPDRRYAYNKAAGGPTAEFQAMVQAFHNAGIKVYMDVVYNHTAEGGT
2bhuA           DGQR---------GWGYDGAAFYAPYAPYG-------RPEDLMALVDAAHRLGLGVFLDVVYNHFGPSGN
1ehaA           PGK---------RDWGYDGVYLYAVQNSY-------GGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGN
2bhyA           GQRG----------WGYDGAAFYAPYAPYGRP--------EDLALVDAAHRLGLGVFLDVVYNHFGPSGN
2bhzA           GQRG----------WGYDGAAFYAPYAPYGRP--------EDLALVDAAHRLGLGVFLDVVYNHFGPSGN
2d0fA           -----------PTNHKYDTQDYMAVDPAFG-------DNSTLQTLINDIHSTANGPKGYLILDGTGDSHP
3cejA           FALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSL-----EFYMGRTLQNTMINLGLQNACDEAIYQLEE
1eh9A           PGKR---------DWGYDGVYLYAVQNSY---GG----PEGFRKLVDEAHKKGLGVILDVVYNHVGPEGN
2dieA           TSQNDV---GYGAYDLYDLGEFNQKGTVRTKYGT----RSQLQGAVTSLKNNGIQVYGDVVMNHKGGADG
3czkA           --------RAGDNDGGFAVSDYGQVEPSL---GS----NDDLVALTSRLREAGISLCADFVLNHTADRYE
3edfA           DA-------AAYSYHGYAATDHYRIDPRYG-------SNEDFVRLSTEARKRGMGLIQDVVLSHIGKHGK
3czlA           --------RAGDNDGGFAVSDYGQVEPSLG-------SNDDLVALTSRLREAGISLCADFVLNHTADRTV
3edeA           DAAA-------YSYHGYAATDHYRIDPRYG-------SNEDFVRLSTEARKRGMGLIQDVVLSHIGKHHW
3ecqA           ------------EGHDSGHLNYADIGKRI---GGV----EDFKTLIEKAKKYGAHLGIHVNASETYPESK
1bliA           TSQADVGYGAYDLYDLGEFHQKGTVRTKYGT-------KGELQSAIKSLHSRDINVYGDVVINHKGGADA
1bvzA           -----------PSHHKYDTADYLAIDPQF---GDL----PTFRRLVDEAHRRGIKIILDAVFNHAGDQFF
1e3xA           LSQSDN---GYGPYDLYDLGEFQQKGTVRTKYGT----KSELQDAIGSLHSRNVQVYGDVVLNHKAGADA
3eddA           DAAA-------YSYHGYAATDHYRIDPRYG-------SNEDFVRLSTEARKRGMGLIQDVVLSHIGYGGK
4cgtA           IFTINYSGVTNTAYHGYWARDFKKTNPYFG-------TMADFQNLITTAHAKGIKIVIDFAPNHTSPADA
1c7tA           -----------TTCLLPQYGQGPDVYGGFF-------SRQDYIDIIKYAQARQIEVIPEIDMPAHARAAV
3czeA           --------RAGDNDGGFAVSDYGQVEPSLGS-------NDDLVALTSRLREAGISLCADFVLNHTADRTV
3bmvA           IYLPDSTFGGSTSYHGYWARDFKRTNPYFG-------SFTDFQNLINTAHAHNIKVIIDFAPNHTSPASE
3bh4A           LSQSDNGYGPYDLYDLGEFQQKGTVRTKYGTK-------SELQDAIGSLHSRNVQVYGDVVLNHKAGADA
1cygA           VFSVMNDASGSASYHGYWARDFKKPNPFF---GT----LSDFQRLVDAAHAKGIKVIIDFAPNHTSPASE
3czgA           --------RAGDNDGGFAVSDYGQVEPSLG-------SNDDLVALTSRLREAGISLCADFVLNHTADRTV
1c7sA           -----------TTCLLPQYGQGPDVYGGFFSR-------QDYIDIIKYAQARQIEVIPEIDMPAHARAAV
2cpuA           --ENVAIYNPFRPWWERYQPVSYKLCT-------RSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAV
1d3cA           IYIINYSGVNNTAYHGYWARDFKKTNPAY---GT----IADFQNLIAAAHAKNIKVIIDFAPNHTSPASS
1cguA           IFATIYSGVTNTAYHGYWARDFKKTNPYFGT-------MADFQNLITTAHAKGIKIVIDFAPNHTSPAME
1ea9C           -----------TTNHKYDTEDYFQIDP-------QFGDKDTLKKLVDLCHERGIRVLLDAVFNHSGRTFP
3bakA           --ENVAIYNPFRPWWERYQPVSYKLCTRSGNE-------DEFRNMVTRCNNVGVRIYVDAVINHMCGNAV
3cttA           MDER--------RDFTYDSVDFK-----------------GFPEFVNELHNNGQKLVIIVDPAISNNSSS
1a47A           IYAVLSTFGGSTSYHGYWARDFKRTNPYF---GSF----TDFQNLINTAHAHNIKVIIDFAPNHTSPASE
1d7fA           IYVINYSGVNNTAYHGYWARDFKKTNPAY---GT----MQDFKNLIDTAHAHNIKVIIDFAPNHTSPASS
1cgtA           FATINYSGVTNTAYHGYWARDFKKTNPYF---GT----MADFQNLITTAHAKGIKIVIDFAPNHTSPAME
1dhkA           VVVT----NPSRPWWERYQPVSYKLCTRSGN-------ENEFRDMVTRCNNVGVRIYVDAVINHMNPGSR
3blkA           --ENVAIHNPFRPWWERYQPVSYKLCTRSGN-------EDEFRNMVTRCNNVGVRIYVDAVINHMCGNAV
1cgwA           IYIINYSGVNNTAYHGYWARDFKKTNPAYG-------TIADFQNLIAAAHAKNIKVIIDFAPNHTSPASS
1bvnP           --ENVVVTNPSRPWWERYQPVSYKLCTRSGNE-------NEFRDMVTRCNNVGVRIYVDAVINHMNPGSR
1cgxA           IYIINYSGVNNTAYHGYWARDFKKTNPAYG-------TIADFQNLIAAAHAKNIKVIIDFAPNHTSPASS
1dtuA           IYIINDSGVNNTAYHGYWARDFKKTNPAY---GTI----ADFQNLIAAAHAKNIKVIIDFAPNHTSPASP
2dh2A           ------------QKDDVAQTDLLQIDPNFG-------SKEDFDSLLQSAKKKSIRVILDLTPNYRGENSW
2choA           --------------DPYHSAPNWRLPYPDK-------EAAQLQELVAVANENEVDFVWAIHPGQDIKWNK
3dhpA           --ENVAIHNPFRPWWERYQPVSYKLCTRSGN-------EDEFRNMVTRCNNVGVRIYVDAVINHMCGNAV
3cgtA           IFATIYSGVTNTAYHGYWARDFKKTNPYF---GTM----ADFQNLITTAHAKGIKIVIDFAPNHTSPAME
1cxlA           IYIINYSGVNNTAYHGYWARDFKKTNPAYGT-------IADFQNLIAAAHAKNIKVIIDFAPNHTSPASS
1avaA           -----------VAEQGYMPGRLYDLDASKYGN------KAQLKSLIGALHGKGVKAIADIVINHRTAEHK
1b0iA           ITGSQ--------WWTRYQPVSYELQ-------SRGGNRAQFIDMVNRCSAAGVDIYVDTLINHMAAGSG
3dhuA           --PIGEVNRKGTLGSPYAIKDYRGINPEY-------GTLADFKALTDRAHELGMKVMLDIVYNHTSPDSV
1cgvA           IYIINYSGVNNTAYHGYWARDFKKTNPAYG-------TIADFQNLIAAAHAKNIKVIIDFAPNHTSPASS
1amg-           FSSWSDGSKGGEGYFWHD----FNKNGRYG-------SDAQLRQAASALGGAGVKVLYDVVPNHMNRGYP
1cgyA           IYIINYSGVNNTAYHGYWARDFKKTNPAYG-------TIADFQNLIAAAHAKNIKVIIDFAPNHTSPASS
3dhuB           --PIGEVNRKGTLGSPYAIKDYRGINPEYG-------TLADFKALTDRAHELGMKVMLDIVYNHTSPDSV
2droA           ------------NKLIKFIPEVEFSDPSYHL-------PHFYELFSLWANEEDRVFWKEAAEASREYLKI
6cgtA           IFTINYSGVTNTAYHGYWARDFKKTNPYFGT-------MADFQNLITTAHAKGIKIVIDFAPNHTSPAME
3clwA           YENR--------EAKEVDNSWNRTECFLSPDGKYDFTKQAGQQWFMKAARERGMNNFLFFTNSAPYFMTR
2d73A           -------------KLGETDYSKTKPNGKHSANT------ANVKRYIDFAAAHGFDAVLVEGWNEGWE-DW
2aaaA           LPQDT---ADGEAYHGYWQQKIYDVNSNFG-------TADNLKSLSDALHARGMYLMVDVVPDHMGYAGN
1aqmA           ITGSQ--------WWTRYQPVSYELQSRGG-------NRAQFIDMVNRCSAAGVDIYVDTLINHMAAGSG
3blpX           --ENVAIHNPFRPWWERYQPVSYKLCT-------RSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAV
3cusR           LKAFVESGQLGIFTNAYFLGGHKAYYLPPEVDLIATAHYLEALHMQVKAAS--AMAILGCSNYQGLTKDP
1cdgA           IYIINYSGVNNTAYHGYWARDFKKTNPAYGT-------IADFQNLIAAAHAKNIKVIIDFAPNHTSPASS
3bsgA           -----------VSNEGYMPGRLYDIDASKYGN------AAELKSLIGALHGKGVQAIADIVINHRCAKDS
3bshA           -----------VSNEGYMPGRLYDIDASKYGN------AAELKSLIGALHGKGVQAIADIVINHRCADDS
1eceA           LKPG-------TMPNSINFYQMNQDLQ-------GLTSLQVMDKIVAYAGQIGLRIILDRHRPDCSGQLW
1cvuA           ASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKALYS--DIDVMELYPALLVEKPRPDAI
2dh3B           ------------QKDDVAQTDLLQIDPNFGS-------KEDFDSLLQSAKKKSIRVILDLTPNYRGENSW
3a5vA           ---------DCWQKNERESSKTLLA--------DPTKFPRGIKPLVDDIHNLGLKAGIYSSAGTLTCGGH
1cbyA           ----------------------------------------------------------------------
3dc0A           KEGNKGDKSMGNWYWLYQPTSYQIGNRYL-------GSEEEFKEMCAAAEEYGVKVIVDAVINHTTSDYA
3cc1A           PTANSSA--YNPFAPLCDEYGRLLPATNRF---PSAKNGAGFKPLSDAIHDLGLKFGIHIRGIPRQAVYE
2choB           ------------PYHSAPNWRLPYPDKEAA----------QLQELVAVANENEVDFVWAIHPGQDIKWNK
1b5tB           HPEAKSAQADLLNLKRKVDAGANRAITQFF------FDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQ
3b40A           D----------WADSSRPLPFFNDSPDALG----------GLSPLGKQAVERLNDLGVIIDVSQMSTKAP
1bagA           KEGNQGDKSMSNWYWLYQPTSYQIGNRYLG-------TEQEFKEMCAAAEEYGIKVIVDAVINHTTFDYA
3bc9A           MAG--IHDVGYGTYDLWDLGEFDQKGTVRTKYGTK----GELENAIDALHNNDIKVYFDAVLNHRMGADY
3clwC           YENRE---AKEVDNSWNRTECFLSPDGKYDFTK-----QAGQQWFMKAARERGMNNFLFFTNSAPYFMTR
2dh3A           ------------QKDDVAQTDLLQIDPNFGS-------KEDFDSLLQSAKKKSIRVILDLTPNYRGENSW
1chkA           NGSASH---SGLGTPFTKDWATAAKDTVFQQAQNDERDRVYFDPAVSQAKADGLRALGQFAYYDAIVMHG
2agaA           ------------IFHEKQEGSLCAQHCLNNLLQGEYFSPSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQ
3cnyA           PEKLNELKLRNLEIAGQWFSSYIIRDGIEKA-------SEAFEKHCQYLKAINAPVAVVSEQTYTIQRSD
1bplA           TSQA---DVGYGAYDLYDLGEFHQKGTVRTKYGT----KGELQSAIKSLHSRDINVYGDVVINHKG-GAD
2bs9A           D------------VGIYREVEIDGEMKPF-------YNFTYIDRIVDSYLALNIRPFIEFGFMPKALASG
3civA           ------------MEHPGDPAIAYGPPVTVS--------DDEIASMAELAHALGLKVCLKPTVNCRDGTWR
1bplB           ----------------------------------------------------------------------
1b5tA           HPEAKSAQADLLNLKRKV------DAGANRAITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQ
3cc1B           PTAN-----NPFAPLCDEYGRLLPATNRFPSAKNG----AGFKPLSDAIHDLGLKFGIHIRGIPRQAVYE
3bobA           ---------HSSDMLGCGFFKLWVTGRFD---DMG----YPRPQFDADQGANAVKDAGGIIEMHHGSHTE
2bfgA           D------------VGIYREVEIDGEMKPFYN-------FTYIDRIVDSYLALNIRPFIEFGFMPKALASG
1cz1A           F-----------QLLDNDPYVQGQVQ--------------YLEKALGWARKNNIRVWIDLHGAPGSQNGF
2aamC           EI----------SSSGFEIAVIDYSKDGSE--------SGEYSPEEIKIVDAGVVPVAYVNIGQAEDYRF
2aamA           EI----------SSSGFEIAVIDYSKDGSES--------GEYSPEEIKIVDAGVVPVAYVNIGQAEDYRF
2c0hA           ---------ESTPEFDNNGYVTGIDNTLIS----------DMRAYLHAAQRHNILIFFTLWNGAVKQSTH
2aamB           EIS----------SSGFEIAVIDYSKDGSE--------SGEYSPEEIKIVDAGVVPVAYVNIGQAEDYRF
3coyA           ---------------------HPGELNVY-------SAPGDVADVSRALRLTGRRVMLVPTMGALHEGHL
1cbgA           -------------WPRVLPKGKLSGGVNR-------EGINYYNNLINEVLANGMQPYVTLFHWDVPQALE
3cozB           -----------------------AIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHL
1b4dA           ----------------------------------------------------------------------
1b31A           ---------GQLTPENSMKWDATEPNRGQF-------TFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGW
1a5sA           PLAD----------GPTIQNANLRAFAAGVT-------PAQCFEMLALIREKHPTIPIGLLMYANLVFNN
1bxcA           PRGTPP------QERDQIVRRFKRALDET-------GLKVPMVTGNLFSDPGFKDGGFTSRDPWVRAYAF
2c7fD           SNYF---------WEDGVGPVEDRPRRLDLAWKSIEPNQVGINEFAKWCKKVNAEIMMAVNLGTRGISDA
2c7fF           SNYF----WEDGVGPVEDRPRRLDLAWKSIEPN-----QVGINEFAKWCKKVNAEIMMAVNLGTRGISDA
2cleA           PLAD----------GPTIQNANLRAFAAG-------VTPAQCFEMLALIREKHPTIPIGLLMYANLVFNN
2cliA           PLA----------DGPTIQNANLRAFAAGVTP-------AQCFEMLALIREKHPTIPIGLLMYANLVFNN
1a5bA           PLAN----------GPTIQNANLRAFAAGVTP-------AQCFEMLALIREKHPTIPIGLLMYAN-LVFN
2cncA           ----------IAKEFNSITPENCMKWGVLRDAQGQW-NWKDADAFVAFGTKHNLHMVGHTLVWHSQIHDE
3c0uA           --------------------------------------ARHPSETQERLRLLAWLKYADERLQFTDEPEA
2diwA           --------------------------NMEAVKTFNS-ELYSLNDYKPPISKAKMTQITKAAIKAIKFYKH
3a21A           ----TRQITVPSAPMGWASWNSFAAKIDYS----------VIKKQVDAFVAAGLPAAGYTYINIDEGWWQ
3a21B           ---------VPSAPMGWASWNSFAAKIDYS----------VIKKQVDAFVAAGLPAAGYTYINIDEGWWQ
3cqhA           RREQRLALVNAIVETGVRVPSCLSAHRRFSEDDAVRAQGLEIRKAIQFAQDVGIRVIQLAGYDVYYQENN
2c8nD           SNYF----------WEDGVGPVEDRPRRLDLAWKSIENQVGINEFAKWCKKVNAEIMMAVNLGTRGISDA
2a6tA           -------------EQSSVERLCFQIEQAH------WFYEDFIRAQNDQLPSLGLRVFSAKLFAHCPLLWK
3cepA           PLA----------DGPTIQNANLRAFAAGVT-------PAQCFEMLAIIREKHPTIPIGLLMYANLVFNN
2clhA           -------FSDPLADGPTIQNANLRAFAAGVTP-------AQCFEMLALIREKHPTIPIGLLMYANLVFNN
3d9iB           ---------------------------------------YSLMDMKPPISKAKMTQITKAAIKA-IKFYK
3cqhB           SREQRLALVNAIVETGVRVPSCLSAHRRFPLDDAVRAQGLEIRKAIQFAQDVGIRVIQLAGYDVYYQEAN
1a5aA           PTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADV
1ac0A           ----------------------------------------------------------------------
1edgA           ------------------------------------VWMNRVQEVVNYCIDNKMYVILNTHHDVDKVKGY


                         .         *         .         .         .         .         +:350
query           MGPALSLRGIDNLAYYRVREDNPRYYLDYTGCGNSLNVRHPHSLQLIMDSLRYWVLDMHVDGFRFDLAAA
2e8yA           SPFEKTVPGYFF------RHDECGKPSNGTGVGNDIASERRMARKFIADCVVYWLEEYNVDGFRFDLLGI
3ecqB           YFNEKILRKNPDGSYS-------YGWNWLDQGINIDAAYDLAHGRLARWEDLKKKLGDGLDFIYVDVWGN
1bf2A           WATIYSWRGLDNATYYE-LTSGNQYFYDNTGIGANFNTYNTVAQNLIVDSLAYWANTMGVDGFRFDLASV
2bhuA           Y--------------LSSYAPSYFTDRFSSAWGMGLDYAEPHMRRYVTGNARMWLRDYHFDGLRLDATPY
1ehaA           YM------------VKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHA
2bhyA           Y----------------LSSYAPSYF-TDRFSSAWGGLDYAEPHRRYVTGNARWLRDYHFDGLRLD--AT
2bhzA           Y----------------LSSYAPSYFT-DRFSSAWGGLDYAEPHRRYVTGNARWLRDYHFDGLRLDATPY
2d0fA           WFDKYNNFSSQGAYESQSSPWYNYYTFYTWPDNSGSAVRGVIYNNSNSVAKTYLNPPYSVDGWRLNAAQY
3cejA           LEEIEEDAGLGNGGLGRLAACDSMATLGLAAYGYGIRYEYGIFNQKIRDG---WQVEEADDWLRYGNPWE
1eh9A           YMV-------KLGPYFS-----QKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHA
2dieA           TEMVNAVEVNRSNRNQEISGEYTIEAWTKFDFPGRGNTHSNFKWRWYHFDGTDWDQSRQLQNKIYKFRGT
3czkA           ATLGQVFPHTAPGNFTWVDDTAQWMWTTFYPYQWDLNWSNPAVFGDMALAMLRL-ANLGVEAFRLDSTAY
3edfA           FVPTQHHRVAVQDPYAAQADSENFTKGWFVEGMPDLNQTNPLVANYLIQNNIWWIEYAGLSGLRIDTYGY
3czlA           PDRYEATLGQVPGNFTWVDDTAQWMWTTFYPYQWDLNWSNPAVFGDMALAMLRL-ANLGVEAFRLDSTAY
3edeA           WMKDLPTPDWINYGGKFVPTQHHFTKGWFVEGMPDLNQTNPLVANYLIQNNIWWIEYAGLSGLRIDTYGY
3ecqA           YFNEKILRKNPDGSYSY-------GWNWLDQGINIDAAYDLAHGRLARWEDLKKKLGDGLDFIYVDVWGN
1bliA           TEDVTAVEVDPADRNRVISEHLIKAWTHFHFPGRGSTYSDFKWHWYHFDGTDWDESRKLNRIYKFQGKAW
1bvzA           AFRDVLQKGEQSRYKDWTSRTNYETFAVQVPAMPKLRTENPEVKEYLFDVARFW-MEQGIDGWRLDVA--
1e3xA           TEDVTAVEVNPANRNQETSEEYQIKAWTDFRFPGRGNTYSDHFDGADWDESRKISRIFKFRGEGKAWDWE
3eddA           FVPTQHHRVAVQDPYAAQADSENFTKGWFVEGMPDLNQTNPLVANYLIQNNIWWIEYAGLSGLRIDTYGY
4cgtA           ENGRLYDNGTLVGGYTNDTSSLENGIYKNLYDLADFNHNNATIDKYFKDAIKLWL-DMGVDGIRVD----
1c7tA           VSMEARYKKLHAAGKEQEADTSNTTSVQFFNRQSYLNPCLDSSQRFVDKVIGEIAQMHKEAGQPIKTWHF
3czeA           PDRYEATLGQVG--NFTWVDDTAQWWTTFYPYQWDLNWSNPAVFG---DALALRLANLGVEAFRLDSTAY
3bmvA           TDPTYAENGRLYDNGTLLGGYTNDGIYRNLFDLADLNQQNSTIDSYLKSAIKVWL-DMGIDGIRLDAVKH
3bh4A           TEDVTAVEVNPANRNQETSEEYQIKAWTDFRFPGRGNWHWYHFDGADWDESRKISRIFKFRGEGKAWDWE
1cygA           TNPSYMENGRLYDNGTLLGGYTNDGIYRNLFDLADLNHQNPVIDRYLKDAVKMW-IDMGIDGIRMDAVKH
3czgA           PDRYEATLGQVGNFTW--VDDTAQWWTTFYPYQWDLNWSNPAVFG---DALALRLANLGVEAFRLDSTAY
1c7sA           VSLHAAGKEQEANEFRLVDQTDTSTSVQFFNRQSYLNPCLDSSQRFVDKVIGEIAQMHKEAGQPIKTWHF
2cpuA           SAGTSSTCGSYFNPGSRDFPAVPQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLI-DIGVAGFRLDASKH
1d3cA           DQPSFAENGRLYDNGTLLGGYTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMW-LDLGIDGIRMNAVKH
1cguA           TDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSFNHNNATIDKYFKDAIKLW-LDMGVDGIRVAAVKH
1ea9C           PFVDVLKNGEKSKYKDWFHIRPTYDTFAFEPLMPKLNTEHPDVKEYLLKAAEYWIRETGIDGWRLDVA--
3bakA           SAGTSSTCGSYFNPGSRDFPAVPQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLI-DIGVAGFRLDASKH
3cttA           SKPYGPYDRGSDMKIWVNSSDGVTPLIVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEV
1a47A           TDPTYAENGRLYDNGTLLGGYTNDTNGYFHHYGGTLNQQNSTIDSYLKSAIKVW-LDMGIDGIRLDAVKH
1d7fA           DDPSFAENGRLYDNGNLLGGYTNNGIYKNLYDLADLNHNNSSVDVYLKDAIKMW-LDLGVDGIRVDAVKN
1cgtA           TDTSFAENGRLYDNGTLVGGYTNNGIYKNLYDLADFNHNNATIDKYFKDAIKLWL-DMGVDGIRVDAVKH
1dhkA           EFPAVPYSAWDFNDGKCKYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLI-DIGVAGFRIDASKH
3blkA           SAGTSSTCGSYFNPGSRDFPAVPQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLI-DIGVAGFRIDASKH
1cgwA           DQPSFAENGRLYDNGTLLGGYTNNGIYKNLGDLADLNHNNSTVDVYLKDAIKMW-LDLGIDGIRMDAVKH
1bvnP           EFPAVPYSAWDFNDGKCKTYNDPYQVRDCLVGLLDLALEKDYVRSMIADYLNKLI-DIGVAGFRLDASKH
1cgxA           DQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGDLNHNNSTVDVYLKDAIKMWL-DLGIDGIRMDAVKH
1dtuA           DQPSFAENGRLYDNGTLLGGYTNNGIYKNLYDLADLNHNNSTVDVYLKDAIKMW-LDLGIDGIRMDAVKH
2dh2A           -----------------------------------FSTQVDTVATKVKDALEFWL-QAGVDGFQVRDIEN
2choA           EDRDLLLAKFEKMYQL----GVRSFAVFFDDISGEGTNPQKQAELLNYIDEKFAQVKPDINQLVMCPTEY
3dhpA           SAGTSSTCGSYFNPGSRDFPAVPYSGADRLSGLLDLALGKDYVRSKIAEYMNHL-IDIGVAGFRIDASKH
3cgtA           TDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSFNHNNATIDKYFKDAIKLW-LDMGVDGIRVDAVKH
1cxlA           DQPSFAENGRLYDNGTLLGSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMW-LDLGIDGIRMDAVKH
1avaA           DGRGIYCIFEGGTPDARLDWGPHMDTGADFGAAPDIDHLNLRVQKELVEWLNWLKADIGFDGWRFDFAKG
1b0iA           TGTAGNSFGNKSFPIYSPGNDRYRVQNCELVGLADLDTASNYVQNTIAAYINDL-QAIGVKGFRFDASKH
3dhuA           LAT------EHPEWFYHDADGQLTNKVGDWSDVKDLDYGHHELWQYQIDTLLYW--SQFVDGYRCDVAPL
1cgvA           DQPSFAENGRLYDNGTLLGGYTNNGIYKNLFDLADLNHNNSTVDVYLKDAIKMWL-DLGIDGIRMDAVKH
1amg-           DKEINLPAGQNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFD----
1cgyA           DQPSFAENGRLYDNGTLLGGYTNDTQNKNLWDLADLNHNNSTVDVYLKDAIKMW-LDLGIDGIRMDAVKH
3dhuB           LATE----------HPEWFYHDLTNKVGDWSDVKDLDYGHHELWQYQIDTLLYWS--QFVDGYRCDVAPL
2droA           AGLAPEYAYYDGTPNDEKGYGHFFSCVAANIGLDAEWFGGSEWSAEEINKIQAFFADKEPEDYRRYKIDG
6cgtA           TDTSFAENGRLYDNGTLVGGYTNNGIYKNTYDLADFNHNNATIDKYFKDAIKLW-LDMGVDGIRVD----
3clwA           SASTVSTDQDCINLQNDKFDD-------------------------FARFLVKSAQHFREQGFHVN-YIS
2d73A           FGNSKDYVFDFVTPYPDFDVKEIHRYAARKGIKMMMHHASVRNYERHMDKAYQFMADNGYNSVKSGYVGN
2aaaA           GNDVDYSVFDPFDSSSYFHPYCLCWEGDTIVSLPDLDTTETAVRTIWYDWVADLVSNYSVDGLRIDSVLE
1aqmA           TGTAGNSFGNKSFPIYSPGNDRYRVQNCELVGLADLDTASNYVQNTIAAYINDLQ-AIGVKGFRFDASKH
3blpX           SAGTSSTCGSYFNPGSRDFPAVPQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLI-DIGVAGFRIDASKH
3cusR           LNYLALSKEVCNECYIPDLLAVAGFYKDWGGIGGTSNYLAFGEFATDDSSPEKHLATSQFPSGVI-----
1cdgA           DQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTLNHNNSTVDVYLKDAIKMW-LDLGIDGIRMDAVKH
3bsgA           RGIYCIFEGGTSDGRLDWGPTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARG
3bshA           RGIACIFEGGTSDGRLDWGPHMICDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARG
1eceA           YTSSVSEATWISDLQALAQRYKGNPTVVGFDLHNEPHDPACWGCGDPSIDWRLAAERAGNAVLSVNPNLL
1cvuA           FGETMVELGAPF--SLKGLMGNPICSPQYWKPSTFGGEVGFKIINTASSLICNNVKGCPFTSFNV-----
2dh3B           F-----------------------------------STQVDTVATKVKDALEFW-LQAGVDGFQVRDIEN
3a5vA           IASLGYEDIDAKTWAKWGIDYLKYDNCYNQGQSGTPKLSYDNALNKTGRPMLYSLCNWGEDGPWNFASTI
1cbyA           ----------------------------------------------------------------------
3dc0A           AISN-EIKSISNWTHGNTWSDRWDVTQNSLLGLYDWNTQNTQVQSYLKRFLERAL-NDGADGFRYDAAKH
3cc1A           NSPVLGSTKTAR-------EIAHTNSICPWNTDYGVDPTKEGAQSYYNSLFELY-AQWGVDFVKVDDIAA
2choB           EDRDLLLAKFEKMYQLGVRSFAV----FFDDISGEGTNPQKQAELLNYIDEKFAQVKPDINQLVMCPTEY
1b5tB           AKKFADMTNVRIPAWMA-----QMFDGLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSY
3b40A           RALVDIKRNLSDHEMQLIKDSGGVGFPAYLRPLSKPTLDKLDALRARFDLPPLEGLDYALMPGDPIITIW
1bagA           AISNEVKSIPNWTHGNTQWSDRWDVTQNSLLGLYDWNTQNTQVQSYLKRFLERA-LNDGADGFRFDAAKH
3bc9A           AETVLLDENFDGTDWDDYSKESGKYLFDEKSWGADVDYENEAVQNDVIDWGQWIINNIDFDGFRLDAVKH
3clwC           SASTVSTDQDCINLQNDKFDDFARFLVKSAQHFREQGFHV------------NYISPNNEPNGQWHANSF
2dh3A           -----------------------------------FSTQVDTVATKVKDALEFWL-QAGVDGFQVRDIEN
1chkA           PGNDPTSAMKKARTPAQGGDETTYLNGFLDARKAAMLTEAAHDDTSRVDTEQRVFLKAGNLDLNPPLKWK
2agaA           PSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSL
3cnyA           TANIFKDKPYFTDKEWDEVCKGLNHYGEIAAKYGLKVAYHHHGTGIQTKEETDRLANTDPKLVGLLYDTG
1bplA           ATEDVTAVEVDPADRN-------RVISGEHLIKAWTHFHFPGRGSTYSDFKWHWY---HFDGTDWDESR-
2bs9A           DQTVFYWKGNDYNKWRDLIVAVVSHFIERYGIEEVRTWLFEVWNEPNLVNFWKDANKQEYFKLYEVTARA
3civA           GEIRFEKEHGPDLESWEAWFGSYSDMMAHYAH----VAKRTGCEMFCVGCEMTTAEPHEAMWRETIARVR
1bplB           -----------------------------YLMYADIDYDHPDVAAEIKRWGTWYANELQLDGFRLDAV--
1b5tA           AK---KFADMTNVRIPA--WMAQMFDGLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSY
3cc1B           N-------SPVLGSTKTAREIAHTNSICPWNTDYGVDPTKEGAQSYYNSLFELY-AQWGVDFVKVDDIAA
3bobA           KVVYINLLANKTLEPNEN--DQRFIVDGWAADKFGFLIAAAATVEMLGGPKNAKI---------------
2bfgA           DQTVFYWKGNKWRDLIVAVVSHFIERYGIEEVRTWLFEVWNAPNLVNFWKDANKQEYFKLYEVTARAVKS
1cz1A           DNSGLRDSYNFQLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFGYNSLRQTGSVTPVI
2aamC           Y---------WKESWYTNTPEWLGEEDPAWPGNYFVKYWYNEWKEIVFSYLDRV-IDQGFKGIYLDRIDS
2aamA           YWKE---------SWYTNTPEWLGEEDPAWPGNYFVKYWYNEWKEIVFSYLDRV-IDQGFKGIYLDRIDS
2c0hA           YRLNGLM--VDTRKLQSYIDHALKPMANALKNEKALGGWDIMNEPEGEIKPGESSSEPCFDTRHLSGSGA
2aamB           YWKESWYTN---------TPEWLGEEDPAWPGNYFVKYWYNEWKEIVFSYLDRVI-DQGFKGIYLDRIDS
3coyA           ALVRAAKRVPGSVVVIFVNPMQFGAYPRTPDDDLAQL-RAEGVEIAFTPTTAAMYPDGLRTTVQPG---P
1cbgA           DEYRGFLGRNIVDDFRDYAELCFKEFGDRVKHWITRCSDWLKLNCTGGDSGREPYLAAHYQLLAHAAAAR
3cozB           ALVRAAKRVPGSVVV--VSIFVNPMQYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPG---P
1b4dA           --------------------------LGLAAYGYGIRYEFGIFNQKICGG---WQMEEADDWLRYGNPWE
1b31A           VSSITDKNTLISVLKNHITTVMTRYKGKIYAW-------------DVLNEIFNEDGSLRNSVFYNV----
1a5sA           GIDAFYARCEQVGVDSVLRQAALRHNIAPIFICPNADDDLLRQVASYGRGYTYLL-SRSGVTGAENLIEK
1bxcA           RKSL-----ETMDLGAELGAEIYVVWPGREGAEVEATGKARKVWDWVREPLNFMAAYAEDQGYGRFALEP
2c7fD           CNLLEYCNHPGGSKYSDMRIKHGVKEPHNIKVWCLGNAMDGPW--------QVGHKTMDEYGRIAEETAR
2c7fF           CNLLEYCNHPGGSKYSDMRIKHGVKEPH--------NIKVWCLGNAMDGPWQVGHKTMDEYGRIAEETAR
2cleA           GIDAFYARCEQVGVDSVLVADVPVEE-SAPFRQAALRHNIAPIFICPPNADDDLVASYGRGYTYLLSHHL
2cliA           GIDAFYARCEQVGVDSPFRQAALRHNIAPICPPNADDDLLRQVASYGRGYTYLL-SRSGVTGHLIE----
1a5bA           NGIDAFYARCEQVGVDSVADVPVEESAPFRQAALRHNIAPDDLLRQVASYGRGYTYLLI-EKLKEYHAAP
2cncA           VFKNADGSYISKAAQKKMEEHITTLAGRYKGKLAAWDVVNEAVGDDLKMRDSHWYKIMGDDFIYN--AFT
3c0uA           WLRNDHLGIDLWIELGLPDERRIKKACTQAAEVALFTYNSRAAQIWWQQNQSKCVQFANLSVWYLDDEQL
2diwA           VVQSVEKFIQKCKPEYKKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLW---QKNNVFKSEIIQP
3a21A           GTSAITAYIHSKGLKAGIYTDAGKDGCGYYYPTGRPAAPGSGSEGHYDQDMLQF-STWGFDFVKVDWCGG
3a21B           GTSAITAYIHSKGLKAGIYTDAGKDGCGYYYPTGRPAAPGSGSEGHYDQDMLQF-STWGFDFVKVDWCGG
3cqhA           ETRRRFRDGLKESVEASRAQVTLAEILNNPWFQLYPDIGNLSAWVQELQAGIGHIVAVHVKDTKPGVFKN
2c8nD           CNLLEYCNHPGGSKYSDMRIKHGVKEPHNIKVWCLGN--AMDGPWQVGHKTMDEYGRIAEETARAMKMID
2a6tA           WHEEAFDDFLRYKTRIPVRGAIMLDMSMQQCV--------------------------------------
3cepA           GIDAFYARCEQVVDSVLVADVPVEESAPFRQAALRHNIAPIFIASYGRGYTYLLS-RSGVTGAENRGLHH
2clhA           GYARCEQVGVDSVLVADVPVEESAPFRQAICPPNADDDLLRQVASYGRGYTYLLSRS-GVTGHHL---IE
3d9iB           HVVQSVEKFIQKCKPEYKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLW-QKNNV--FKSEIIQP
3cqhB           NETR--RRFRDGLKESVEASRAQVTLAEILNFQLYPDIGNLSAVQ-ELQAGIGHIVAVHVKDTKPGVFKN
1a5aA           PVEESAPLRHNIAPIFICPPNADDDLLRQVASYGRGYTYLALPLHHLIEKLKEYHAAPALQGFGISSPE-
1ac0A           ----------------------------------------------------------------------
1edgA           FPSSQYMASSKKYITSVWAQIAARFPELTNSDVVDSINCINQLNQDFVNTVRAT-GGKNASRYLMCPGYV


                         .         .         .         .         *         .         .:420
query           LAREFHDVDRLSTFFDIVQQDPVISQVKLIAEPWDVGPGGYQVGNFPPLWTEWNGKYRDTVRDFWRGYPV
2e8yA           LDIDTVLYMKEKATKAKPGILLFGEGWDLATPLPHEQKAALANAPRMPGIGFFNDMFRDAVKGNTFHL--
3ecqB           G----QSGDNGAWATHVLAKEINKQGWRFAIEWGHGGEYDSTFHHWAAYGGYTNKGINSAITRFIRNHQ-
1bf2A           LGNSCLNGAYTASAPNCPRPAAGGSGLDLFAEPWAIGGNSYQLGGFPQGWSEWNGLFRDSLRQAQNELGY
2bhuA           MTDDSETHILTELAQEI---HELGGTHLLLAEDHRNLPDLVTVNHL---DGIWTDDFHHETRVTLTGEQE
1ehaA           IIDTSPKHILEEIADVVHKYNRIVIAESDLNDPRVVNPKEKVGYNI---DAQWVDDFHHSIHAYLTGEQG
2bhyA           PYTDDSETHILTELAQEI--HELGGTHLLLAEDHRNLPDLVTVNHL---DGIWTDDFHHETRVTLTGEQE
2bhzA           TDDSETHILT--ELAQEI--HELGGTHLLLAEDHRNLPDLVTVNHL---DGIWTDDFHHETRVTLTGEQE
2d0fA           VDANGNNGSD---------VTNHQIWSEFRNAVKGVNSNAAIIGEYWGNANPWTAQGNQWDAATNFDG--
3cejA           KSR--PEFMLPVHFYGKVEHTNTGTKWVVLALPYDTPVPGYMNNTVNTMWSARAPDYIQAVLDRNLAE--
1eh9A           IIDTSPKHILEEIADVVHKYNRIVIAESDLNDPRVVNPKEKCGYNI---DAQWVDDFHHSIHAYLTGRQG
2dieA           GKAWDWEVDIENGNYDYLMYPEVINELRNWGVWYTLNLDGFRIDAVKHIKYSYTRDWLTHVRNTTGKMFA
3czkA           LWKRIGTDCMNQSEAHTLLVDIVAPAVVMKAQAIVPMTQLPPFGSGVDEGHECHLAYHSTLMAAGWSAQR
3edfA           SDGAFL-------TEYTRRLMAEYPRLNMVGQEWSTRVPVVARWQRGKANFDGYTSHLPSLMDFPLVDAM
3czlA           LWKRIGTDCMNQSEAHTLLVDIVAPAVVMKAQAIVPMTQYFGSGVDEGHECHLAYHSTLMAAGWSALALQ
3edeA           SDGAFL-------TEYTRRLMAEYPRLNMVGEEWSTRVPVVARWQRGKANFDGYTSHLPSLMDFPLVDAM
3ecqA           GQSGDNGAW----ATHVLAKEINKQGWRFAIEWGHGGEYDSTFHHWAADLTYTNKGINSAITRFIRNHQK
1bliA           DWEVSNEFDYLMYADIDYDHPDVAAEIKRWGTWYELQLDGFRLDAVKHIKFSFLRDWVNHVREKTGKEFT
1bvzA           -----NEVDHAFWREFRRLVKSLNPDALIVGEIWHDASGWLMGDQF---DSVMNYLFRESVIRFFATGEI
1e3xA           VSSENGNYDYLMYADVDYDHPDVVAETKKWGIWYELSLDGFRIDAAKHIKFSFLRDWVQAVRQATKEMFT
3eddA           SDGAFL-------TEYTRRLMAEYPRLNMVGQEWSTRVPVVARWQRGKANFDGYTSHLPSLMDFPLVDAM
4cgtA           -AVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTS
1c7tA           GGDDAKNIRLGAGYTDKAKPGKGIIDQSNEDKPWAKSQVCQTMIKEGKLPSYFGQEVSKLVKAHGIDRMQ
3czeA           LWKRIGTDCNQSEAHTLLVALRIVAPAVVKAEAIVPTQLPPYFGSGVDEGHECHLAYHSTLAAGWSALLQ
3bmvA           MPFGWQ-----KNFMDSILSYRPVFTFGEWFLGTNEIDVNNTYFANESGMSLLDFRFSQKVRQVFRDNTD
3bh4A           VSSENGNYDYLMYADVDYDHPDVVAETKKWGIWYANELSGFRIDAAKHIKFSFLRDWVQAVRQATGKMFT
1cygA           MPFGWQKSLM----DEIDNYRPVFTFGEWFLSENEVDANNHYFAN-ESGMSLLDFRFGQKLRQVLRNNSD
3czgA           LWKRIGTDCNQSEAHTLLVALDIVAPAVVKAEAIVPTQLPPYFGSGVDEGHECHLAYHSTLAAGWSALLQ
1c7sA           GGAEAIRLGAGYTDKAKPEPGKGIIDQSNEDKPWAKSQVCQTMIKEGKLPSYFGQEVSKLVKAHGIDRMA
2cpuA           MWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNG
1d3cA           MPFGWQKSF----MAAVNNYKPVFTFGQWFLGVNEVSP-ENHKFANESGMSLLDFRFAQKVRQVFRDNTN
1cguA           MPLGW-----QKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTS
1ea9C           -----NEVSHQFWREFRRVVKQANPDAYILGEVWHESSIWLEGDQF---DAVMNYPFTNAVLDFFIHQID
3bakA           MWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNG
3cttA           SNFVDGSVSGCSTPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNL--YGYSMAVATAEAAKTVFPNKRS
1a47A           MPFGW-----QKNFMDSILSYRPVFTFGEWFLGTNEIDVNNTYFANESGMSLLDFRFSQKVRQVFRDNTD
1d7fA           MPFGWQKSF----MATINNYKPVFTFGEWFLGVNEISP-EYHQFANESGMSLLDFRFAQKARQVFRDN--
1cgtA           MPLGWQKS-----WMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTN
1dhkA           MWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIQSSEYFGNGRVTEFKYGAKLGTVVRKWSG
3blkA           MWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNG
1cgwA           MPFGWQKSFMAAVN----NYKPVFTFGEWFLGVNEVSP-ENHKFANESGMSLLDFRFAQKVRQVFRDNTD
1bvnP           MWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAISSSEYFGNGRVTEFKYGAKLGTVVRKWSG
1cgxA           MPFGWQKSFM----AAVNNYKPVFTFGEWFLGVNEVSPE-NHKFANESGMSLLDFRFAQKVRQVFRDNTD
1dtuA           MPFGWQKSF----MAAVNNYKPVFTFGEWFLGVNEVSP-ENHKFANESGMSLLDFRFAQKVRQVFRDNTN
2dh2A           LKDASSFLAEWQNITKGFSED-----RLLIAGTNSSDLQQIDSGSTGEHTKSLVTQYLNATGNRWCSWSL
2choA           NKSWSNPNGNYLTTLGDKLNPSIQIMWTGDRVRDGISWINERIKRPAYIWWNFPVSDYVRDHLLLGPVYG
3dhpA           MAPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLYFGNGRVTEFKTVIRKWNGEKMSALKNWGEGAGM
3cgtA           MPLGWQKSWMSSIYA---HKPVFTFGAWFLGSAASD--ADNTDFANKSGMSLLDFRFNSAVRNVFRDNTS
1cxlA           MPFGWQKSF----MAAVNNYKPVFTFGQWFLGVNEVSP-ENHKFANESGMSLLDFRFAQKVRQVFRDNTN
1avaA           YSADVAKIYI-----------DRSEPSFAVAEIWTSLAYGGDGKPN---LNQDQHRQELVNWVDKVGGKG
1b0iA           VAASDIQSLM----------AKVNGSPVVFQEVIDQGGEAVGASEYLSTGLVTEFKYSTELGNTFRNG--
3dhuA           VPLDFWLEAR-KQVNAKYPETLWLAESAGSGFIEELRSQGYTGLSDSELYQAFDMTYDYDVFGDFKD---
1cgvA           MPFGWQKSF----MAAVNNYKPVFTFGEWFLGVNEVSPE-NHKFANESGMSLLDFRFAQKVRQVFRDNTD
1amg-           -FVRGYAPERVNSWMTDSADNSFCVGELWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFAKERMQ
1cgyA           MPFGWQKSF----MAAVNNYKPVFTFGEWFLGVNEVSP-ENHKFANESGMSLLDFRFAQKVRQVFRDNTN
3dhuB           VPLDFWLEAR-KQVNAKYPETLWLAESAGSGFIEELRSQGYTGLSDSELYQAFDMTYDYDVFGDFKDYWQ
2droA           EPFEE-----------------------------------------------------------------
6cgtA           -AVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTS
3clwA           PNNEPNGQWHANSFQEGSFATKADLYRMVEELDKAISEAQIDTKILIPEVGDMKYLFEIDSIAKTPDDII
2d73A           IIPRGEHHYGQWMNNHYLYAVKKAADYKIMVNAHEATRPTGICRTYPNLIGNESARGTEYESFGG-NKVY
2aaaA           VQPDFF------------PGYNKASGVYCVGEIDN-GNPASDCPYQKVLDGVLNYPIYWQLLYAFESSSG
1aqmA           VAASDIQSLM----------AKVNGSPVVFQEVIDQGGEAVGASEYLSTGLVTEFKYSTELGNTFRNGS-
3blpX           MWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNG
3cusR           --TGRDLGKVDNVDLGAIYEDVKYSWYAPGGDGKHPYDGVTDPKYT---KLDDKDHYSWMKAPRYKGKAM
1cdgA           MPFGWQKSF----MAAVNNYKPVFTFGEWFLGVNEVSP-ENHKFANESGMSLLDFRFAQKVRQVFRDNTN
3bsgA           YSPEMAKV-----YIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAVFDFTTKAAV
3bshA           YSPEMAKV-----YIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAVFDFTTKAAV
1eceA           IFVENGDSYWWGGNLQGAGQYPVVLNVPLVYSAHDYATSVYPQTWFSPTFPNNMPGIWNKNWGYLFNQNI
1cvuA           ----------------------------------------------------------------------
2dh3B           LKDASSFLAEWQNITKGFSE-----DRLLIAGTNSSDLQQILESNKDLLLTSSYLSDSGSTGEHTKS--L
3a5vA           SNSWRISGDVYDNFNRPDPACPCTTYDCVLAGFRCSVMNIINKAVAVSQKARSGGWNDLDM--LEVGNGG
1cbyA           ----------------------------------------------------------------------
3dc0A           IELPDDGNYGSQFWPNITNTSAEFQY------GEILQDSASRDAAYANYMNVTASNYGHSIRSALKNR--
3cc1A           SRLYHLEEIKIQRAIQACGRPVLSLSPGPAPIKYAHHFKTNANWRITDFWDDWSLLYQFERCEVWEKHIG
2choB           NKSWSNPNGNYLTTLGDKLNP------SIQIMWTGDRVISDITRDGISWINERIKRPAYIWWNFPVSDYR
1b5tB           AICHTL----------------------------------------------------------------
3b40A           PEQRFGEYASALYGILEEEPKAGLKELVDAIDYTVKKVGIDHVGISSDFNDGGGVDGWKDVSEIRNV---
1bagA           IELPDDGSYGSQFWPNITNTSAEF----QYGQILQDSA--SRDAAYANYMDVTASNYGHSIRSALKNRN-
3bc9A           IDYRFID-----KWMSAVQNS-SNRDVFFVGEAWVEDVKGFLDTVGNPDLRVFDFPLRSFFVDMLNGA-Y
3clwC           QEGSFATKADLYRMVEELDKAISEAQIDTKILIPEVGDMKYLFEIDSIAKTPDDIIHSMFYKDGQYSVL-
2dh3A           LKDASSFLAEWQNITKGFSED-----RLLIAGTNSSDLQQILSSNKDLLLTSSYLSDSGSTGEHTKSL--
1chkA           TYGDPYVIN-------------------------------------------------------------
2agaA           LTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLL----------------------------
3cnyA           HIAVSDGLNAHIDRVVHVHFKDVRRSKEEECRAKGLTFQGSFLNGVPGDGDLDFKPVYDKLIANNYKGWI
1bplA           ----------------------------------------------------------------------
2bs9A           VKSVDPHLQVGGPAICG-GSDEWITDFLHFCAERRVPVDFVSRHAYTSKAPHKKTFEYYYQELEPPEDME
3civA           T-------EYDGLVTYNCNHGREEHVRFWDAVDLISSSAYYPIDRWRDRVPVLREVAEAHEKPLFFMEVG
1bplB           ---KHIKFSFLRDWVNHV-REKTGKEMFTVAEYWQNDLGALENYLNKTNFNHSVFDVPLHYQFHAASTQG
1b5tA           AICHTL----------------------------------------------------------------
3cc1B           SRLYDTHLEEIKIQRAIQACGRPVLSLSPGPAPIKWRITDDFWDDWSLLYFERCEVWEKHIGTGHWPDCG
3bobA           ----------------------------------------------------------------------
2bfgA           VDPHLQVGGPAICGGSDEWITDFLHFCAERRVPVDFVSRHAYTSKAPHKKTFEYYYQELEPPEDMLEFKT
1cz1A           IHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAG---
2aamC           FEYWAQEGV----ISRRSAARKINFVLEIAEYVRERKPDLIIPQNGENILDFDDGQLASTVSGWAVENLF
2aamA           FEYWAQEGV----ISRRSAARKINFVLEIAEYVRERKPDLIIPQNGENILDFDDGQLASTVSGWAVENLF
2c0hA           GWAGHLYSAQEIGRFNWQAAAIKEVDPGAMVTVGSWNMKADTDAMGFHNLYSDHCLVKAGGKQSGTLYDW
2aamB           FEYWAQEGVISRRSAARKINFVLEIAEYVRERKPDLIIPQNGENILDFDDGQLASTVSGWAVENLFYLK-
3coyA           LAAELEGGPRPTHFAGV---LTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVA----------------
1cbgA           LYKTKYQASQNGIIGITLVSHWFEPASKEKADVDAAK-RGLDFMLGWFMHPLTKGRYPESMRYLVRKRLP
3cozB           LAAELEGGPR---PTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVQLVADFNLDVAPTVRE-------
1b4dA           KAR--PEFTLPVHFYGRVEHTKWVDTQVVLAMPYDTPVPGYRVNTMRLWSAKAPNGYIQAVLDRNL----
1b31A           IGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWL----AAGIPIDGIG--------
1a5sA           LKEYH-----------------------------------------------------------------
1bxcA           KPNEPRGDIYFATVGSMLALIHTLERPERFGLNPEFAHETMAGLNFVHAVAQALDAGKLLHIDLNGQRM-
2c7fD           AMKMIDPSIELVACGSSSKDMPTFPQWEATVLDYAYDYVDYISLHQYYGNKENDTADFLAKSDDLDDFI-
2c7fF           AMKMIDPSIELVACGSSSKDMPTFPQWEATVLDYAYDYVDYISLHQYYGN--KENDTADFLAKSDDLDDF
2cleA           IEKEYHAAPA------------------------------------------------------------
2cliA           ----------------------------------------------------------------------
1a5bA           ALQGF-----------------------------------------------------------------
2cncA           LANEVDPKAHLMYNDYNIERTGKREATVEMIERL------------------------------------
3c0uA           ----------------------------------------------------------------------
2diwA           LLDMAAGSGP------------------------------------------------------------
3a21A           DAEGLDAATTYKSISDAVGRRPLTLSICNWGYQNPWNGQAPLWRTSTDIIYYGNQPSMTSLLSNFDQTLH
3a21B           DAEGLDAATTYKSISDAVGRAAATTGRPLTLSICNWGYQNPWNWAAGQAPLWRTSTDIIYYGNQP-----
3cqhA           VPFGEGVVD----FERCF---------ETLKQSGYCGPYLIEWSETAEDPAAEVAKARDWVKARAK----
2c8nD           PSIELVACGSSSKDMPTFPQWEAT--VLDYAYDYVDYISLHQYYGNKENDTADFLAKSDDLDDFIRS---
2a6tA           ----------------------------------------------------------------------
3cepA           LIEKLKEYHAA-----------------------------------------------------------
2clhA           KLKEYHAAP-------------------------------------------------------------
3d9iB           L---------------------------------------------------------------------
3cqhB           VPFGEGVVDFERCF-------------ETLKQSGYCGPYLIEWSETAEDPAAEVAKARDWVKARAK----
1a5aA           ----------------------------------------------------------------------
1ac0A           ----------------------------------------------------------------------
1edgA           ASPDGATNDYFRMPNDISGNNNKIIVSVHAYCPWNFAGLAMADGGTNAWNINDSKDQSEVTWFMDNIY--


                         .         .         +         .         .         .         .:490
query           LPELASRISGSSDLYQADGRRPVASINFVTCHDGFTLADLVSYDRKHNEANGEDNRDGTDDNRSWNHGTE
2e8yA           -KATGFALGNGESAQAVMHGIAGSSGWKALAPIVPEPSQSINYVESHDNHTFWDKMSFALPQENDS----
3ecqB           ----KDAWVGDYRSYGGAANYPLLGGYSKDFEGWQGRSDYNGYVTNLFAHDVTKYFQHFTVSKWENGTPV
1bf2A           VTQDANDFSGSSNLFQSSGRSPWNSINFIDVHDGMTLKDVYSCNGANNSQAWPYGPSDGGTS-TNYSWDQ
2bhuA           GYYAGYRGGAEALAYTIRRGWRYEGQFWAVKGEEHERGHPSDALEAPNFVYCIQNHDQ-----IGNRPLG
1ehaA           YYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKL---
2bhyA           GYYAGYRGGAEALAYTI-------RRGWRYEGQFWAVKGEEHERGHPSDALEAPNFVYCIQNH-DQIGNR
2bhzA           GYYAGYRGGAEALAYTI-------RRGWRYEGQFWAVKGEEHERGHPSDALEAPNFVYCIQNH-DQIGNR
2d0fA           --------------FTQPVSEWITGKDYQNNSASISTTQFDSWLRGTRANYPTNV----QQSMMNFLSNH
3cejA           --NISRVLYPNDNFFEGKELRLKQEYFVVAA----TLQDIIRRFKASKFVFDAFPDQVAIQLNDTHPIPE
1eh9A           YYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKL---
2dieA           VAEFWKNDLAAIENYLNKTSWNHSVFDVPLHYNLYNASNSGGYFDMRNILNGSVVQKHPIHAVTFVDNHD
3czkA           GDILHNVIAHS-----PPLPRHCAWLSYVRCHDDIGWNVLQ-HEACGNAAQPPFSLRDVARFYANAVPGS
3edfA           RNA---------------LSKTGEENGLNEVYETLSLDY--LYPEPQNLVLFGGNHDMARMFSAAGE---
3czlA           GDILHNVIAHSPPLP-----RHCAWLSYVRCHDDIGWNVLQ-HEACGNAAQPPFSLRDV--ARFYANAVP
3edeA           RNA---------------LSKTGEENGLNEVYETLSLDY--LYPEPQNLVLFGGNHDMARMFSAAGE---
3ecqA           -----DAWVGDYRSYGGAANYPLLGGYSKDFEGWQGRSDYNGYVTNLFAHDVTKYFQHFTVSKWENGTPV
1bliA           VAEYWSYDLGALENYLNKTNFNHSVFDVPLHYFHAASTQGGGYDMRKLLNGTVVSKHPLKSVTFVDNHDT
1bvzA           AERFDAELTRARMLYP--EQAAQGLWNLLDSHDTERFLTSCGGNEAK-----------------------
1e3xA           VAEYWQNNAGKLENYLNKTSFNQSVFDVPLHFNLQASSQGGGYDMRKLLNGTVVSKHPLKSVTFVDNHDT
3eddA           RNA---------------LSKTGEENGLNEVYETLSLDY--LYPEPQNLVLFGGNHDMARMFSAAGE---
4cgtA           MYALDSMINSTATDYNQVND----QVTFIDNHDMDRFKTSAVNNRRLEQALGVPAIYYGTEQYLTGNGDP
1c7tA           AQDGLKDAESSKAFATSRVGVNFWDTLYWGGFDGYEVVVSNPDYVYMDFPYEVNPDERGYYWGTRFSDER
3czeA           RGDILHNVIAHSP----PLPRHCAWLSYVRCHDDIGWNVLQHEA-CGNAAQPPFSLRSYARGESFVHGTN
3bmvA           TMYGLDSMI---QSTASDYNFINDMVTFIDNHDMDRFYNGGSTRPVEQALAFTLTSRGVPAIYYGTEQYM
3bh4A           VAEYWQNNAGKLENYLNKTSFNQSVFDV---PLHFNLQAASSQGGGYDMRRLLDGTVVSRHPEKAVTFVE
1cygA           NWGFNQMIQDTASAY----DEVLDQVTFIDNHDMDRFMIDGGDPRKVDMALAVLLTSRGVPNIYYGTEQY
3czgA           RGDILHNVIAHSP----PLPRHCAWLSYVRCHDDIGWNVL-QHEACGNAAQPPFSLR-------------
1c7sA           WQDGLKDAESSKAFATSRVGVNFWDTLYWGGFDSVNDWEVVVSNPDYVYMDFPYEVNPDERGYYWGTRFS
2cpuA           EKMSYLKNGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGINPD
1d3cA           MYGLKAMLEGSAADYAQVDD----QVTFIDNHDMERFHASNANRRKL-----------------------
1cguA           MYALDSMINSTATDY----NQVNDQVTFIDNHDMDRFKTSAV----------------------------
1ea9C           AEKFSFMLGKQLAGYP--RQASEVMFNLLDSHDTARLLTQADGDKRK-----------------------
3bakA           EKQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIPD
3cttA           FILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLENLFGIPMVGPDICGFALDTPEELCRRW-----
1a47A           TMYLDSMIQSTASDY----NFINDMVTFIDNHDMDRFYNGGSTRPVEQALAFTLTSRGVPAIYYGTEQDP
1d7fA           -TDNMYGLKAMLEGSEVDYAQVNDQVTFIDNHDMERFHTSNGDRRKLEQALAFTLTSRGVPAIYYGSEQY
1cgtA           MYALDSMINSTATDY----NQVNDQVTFIDNHDMDRFKTSAVNN--------------------------
1dhkA           EKQRGHGAGGASILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPIKEVTINAD
3blkA           EKMSYLKNGGASILTFADARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGINPD
1cgwA           MYGLKAMLEGSAADYAQVDD----QVTFIDNHDMERFHASNANRRKL-----------------------
1bvnP           EKMSYLKNWGSSILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPKEVTINAD
1cgxA           MYGLKAMLEG----------------------------SAADYAQVDDQVTFIDNHDMERFHASNA----
1dtuA           MYGLKAMLEGSAADY----AQVDDQVTFIDNHDMERFHASNA----------------------------
2dh2A           QARLLTSFLPAQLLRLYQLLFTLPGTPVFSYGDEIGLDAAALPGQPEAPVLWESSFPDIPGAVSANTVKG
2choA           NDTTIAK-EMSGFVTNPMEHAESSKIAIYSVASYAW--NPAKYDTWQTWKDAIRTILPSAAEELECFAMH
3dhpA           PSDRALVFVDNHDLTFADARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWNGVTKEVTINPD
3cgtA           MYALDSMINSTATDYNQVND----QVTFIDNHDMDRFKTSAVNNRR------------------------
1cxlA           MYGLKAMLEGSAADYAQVDD----QVTFIDNHDMERFHASNANRRKL-----------------------
1avaA           P-------ATTFDFTTKGILNVAVEGELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDTGSTQHMWPF---
1b0iA           -----SLAWLSNFGEGWGFMPSSSAVVFVDNHDNQRGGGAGNVITFED----------------------
3dhuA           --------------YWQGRSTVERYVDLLQRQDAT-------FPGNYVKMRFLENHDNARMMSLMHS---
1cgvA           MYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNAN-------------------------------
1amg-           NGSIADWKHGLNGNPDP--RWREVAVTFVDNHD--------------------------------TGYSP
1cgyA           MYGLKAMLEGSAADYAQVDD----QVTFIDNHDMERFHASNANRRKL-----------------------
3dhuB           GRSTVERYVDLLQRQDATFPGNYVKMRFLENHDNARM------------------------MSLMHSKA-
2droA           ----------------------------------------------------------------------
6cgtA           MYALDSMINSTATDY----NQVNDQVTFIDNHDMDRFKTSAVNN--------------------------
3clwA           HMFYKDGQYSVLKFKNLFNCVAAHDYWSAYPATLLVDIRNRIHKELSANGHNTKFWASEYCILEKNEEIT
2d73A           HTTILPFTRLVGGPMDYTPGIFETHCNKMNPANNSQVRSTIARQLALYVTMYSPLQMAADIPENYERFMD
2aaaA           ISNLYNMIKSVASDCSDPTLL----GNFIENHDNPRFAKYTS----------------------------
1aqmA           LAWLSNFGEGWGFMP------SSSAVVFVDNHDNQRGHGGAGNVITFEDGR-------------------
3blpX           EKMSYLKNWGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTPD
3cusR           EVGPLARTFIAYAKGQPDFKKVVDMVLGKLSVPATALHSTLGRTAAR-----------------------
1cdgA           MYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNAN-------------------------------
3bsgA           EGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSD------------------------
3bshA           EGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSD------------------------
1eceA           APVWLGEF-GTTLQSTTDQTWLKTLVQYLRPTAQYGADSFQWTFWSWNPDSGDTGGILKDDWQTVDTVKD
1cvuA           ----------------------------------------------------------------------
2dh3B           VTQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAALPGQPMEAPV
3a5vA           MNQEEYRVHYTIWAALKSPLILGNDVTNITNTTKEIIMNKEVIAVNQDSSFSPANRIWVKGDQQLFSGNL
1cbyA           --------------------------------------KHIVLTVPSSDLDNFNTVFYVQPQYINQA--L
3dc0A           ------NLSVSNISHYASDVSADKLVTWVESHDTYANDDEESTWMSD-----------------------
3cc1A           TGWPDCGLPLGHIGIRSVDGPG---GDRWTRFTKDEQLTNLWAICHSPL-FGGELRDNDEWTLSLLT---
2choB           DHLLLGPVYGNDTTIAKEMSGFVTNPMEHAESSKIAIYSVASYAWNPAKYDTWQTWKDAIRTILPSAAEE
1b5tB           ----------------------------------------------------------------------
3b40A           TAELITRGYSDADI--------------------------------------------------------
1bagA           -------LGVSNISHYASDVSADKLVTWVESHDTYANDDEESTWMSD-----------------------
3bc9A           MADLRNAGLVNSPGY------ENRAVTFVDNHDTDRDEGSYTVS--------------------------
3clwC           ------KFKNLFNCVAAHDYWSAYPATLLVDIRNRIHKELSANGHNTKFWASEYCILEKNEEITMPASPE
2dh3A           VTQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAALPGQPMEAPV
1chkA           ----------------------------------------------------------------------
2agaA           ----------------------------------------------------------------------
3cnyA           VVEAEQDPSKANPLEAQIAHRYIKQH--------------------------------------------
1bplA           ----------------------------------------------------------------------
2bs9A           QFKTVRALIRQSPFPHLPLHITEYNTSYSPINPVHDTALNAAYIARILSEGGDYVDSFSYWTFSDVFEEM
3civA           PSRSGSGACPWDYRHPGAVCLDEQARFYEAMFAAMPDEPWFKGYMLWEWPWKLYPREAASEDGSY-----
1bplB           GGYDMRKLLNST----VVSKHPLKAVTFVDNHDTQPGQSLESTVQTW-----------------------
1b5tA           ----------------------------------------------------------------------
3cc1B           LP----------LGHIGIRSVDGPGGDRWTRFTKDEQLTNLWAICHSPLFGGELRDNDEWTLSLL-----
3bobA           ----------------------------------------------------------------------
2bfgA           VRALIRQSPFPHLPLHITEYNTSYSPINPVHDTALNAAYIARILSEGGDYVDSFSYWTFSDVFEEMDVPK
1cz1A           --EWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGG
2aamC           YLKTIPLEENETKSRLEYLIRLNRKGKFILSVDYVD-------------DGSDSFENISRILDYYEK---
2aamA           YLKTIPLEENETKSRLEYLIRLNRKGKFILSVDY------------------------------VDDGSD
2c0hA           QNHFGNESPFKHSFSNFRLKKPMVIGEFQEHGAGMSSESMFEWAYTKGYSGAWTWSTDVSWNNQLRGMQH
2aamB           ------------------------TIPLEENETKSRLEYLIRLNRKGKFILSVDY---------VDDGSD
3coyA           ----------------------------------------------------------------------
1cbgA           KFS--------------TEESKELTGSFDFLGLNYYSSYYAAKAPRIPNARPAIQTDSLINATFEHNGKL
3cozB           ----------------------------------------------------------------------
1b4dA           -AENISRVLYPNDFFEGKELRLKQEYFVVAA----TLQDIIRRFKSSK----------------------
1b31A           ----------------------------------------------------------------------
1a5sA           ----------------------------------------------------------------------
1bxcA           ----------------------------------------------------------------------
2c7fD           -RSVIATCDYIKAKKRSKKDIY----LSFDEWNVWYHSNNEDANIMQNEPWRIAPPLLEDIYTFEDALLV
2c7fF           IRSVIATCDYIKAKKRSKKDIYLMQNEPWRIAPPLLEDIYTFEDALLVGLMLITLMKHADRIKIACLAQL
2cleA           ----------------------------------------------------------------------
2cliA           ----------------------------------------------------------------------
1a5bA           ----------------------------------------------------------------------
2cncA           ----------------------------------------------------------------------
3c0uA           ----------------------------------------------------------------------
2diwA           ----------------------------------------------------------------------
3a21A           PTQHTGYYNDPDMLMVGMDGFTAAQNRTHMNLWAISGAPLLAGNDLTTMTSETAGILKNPEVIAVDQDSR
3a21B           ----------------------------------------------------------------------
3cqhA           ----------------------------------------------------------------------
2c8nD           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
3cepA           ----------------------------------------------------------------------
2clhA           ----------------------------------------------------------------------
3d9iB           ----------------------------------------------------------------------
3cqhB           ----------------------------------------------------------------------
1a5aA           ----------------------------------------------------------------------
1ac0A           ----------------------------------------------------------------------
1edgA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           GPTTDSAIATLRRRQMRNMLTTLMLSQGVPMLSHGDEIGRTQHGNNNAYCQDNPISWVDWELARRNADLL
2e8yA           ----------RKRSRQRLAVAIILLAQGVPFIHSGQEFFRTKQGVENSYQSSDSINQLDWDRRETFKEDV
3ecqB           TKWTPERVELVDADNNKVVVTRKSNDVNSPQYRERTVTLNGRVIQDGSAYLTPWNWDANGKKLSTDKEKY
1bf2A           GMSAGTGAAVDQRRAARTGMAFEMLSAGTPLMQGGDEYLRTLQCNNNAYNLDSSANWLTYSWTTDQSNFY
2bhuA           ERLHQSDG--VTLHEYRGAAALLLTLPMTPLLFQGQEWAASTPFQFFSDHAGELGQAVSEGVPDPQAEQT
1ehaA           ----------VDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQD
2bhyA           PLGERLHQSDGVTLHEYRGAAALLLTLPTPLLFQGQEWAASTPFQFFSDHAGELGQAVSEGVPDPQAEQT
2bhzA           PLGERLHQSDGVTLHEYRGAAALLLTLPTPLLFQGQEWAASTPFQFFSDHAGELGQAVSQAEQTFLNSKL
2d0fA           DITRFATRSGGDLWKTYLALIFQMTYVGTPTIYYGDEYGMQGGADPDNRRSF------DWSQATPSNSAV
3cejA           LMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQ----------
1eh9A           ----------VDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDS-----------------
2dieA           SQPGEALESFVQWFKPLAYALILTREQGYPSVFYGDYYGIPTHGVPSMKSKIDPLLQARQTYAGTQHDYF
3czkA           YARGESFQGVHGTNGMAAALAIALAMPGVPLIYMGDELA---MVNDPGYRDDPHRQHEGRWLHR------
3edfA           -----------DFDRWRMNLVFLMTMPRIPQFYSGDEILMTSTVKGRDDASYRRDFPGGWAGDKANAFSG
3czlA           GSYARGESFQVHGTNGMALYAIALAMPGVPLIYMGDELA---MVNDPGYRDDPHRQHEGRWLHRP-----
3edeA           -----------DFDRWRMNLVFLMTMPRIPQFYSGDEILMTSTVKGRDDASYRRDFPGGWAGDKANAFSG
3ecqA           TTDNGSTYKWTPERVELVDADNNKVVVTRKSNDVNSPQYRERTVTLNGRVIQDGSAYLTP----------
1bliA           QPGQSLESTVQTWFKPLAYAFILTRESGYPQVFYGDMYGTKGDSQREIPALKHKIEPILKARKQYA----
1bvzA           ---------------FRLAVLFQMTYLGTPLIYYGDEIGMAGATD------PDCRRPMIWEEKEQNRGLF
1e3xA           QPGQSLESTVQTWFKPLAYAFILTRESGYPQVFYGDMYGTKGDSQREIPALKHKIEPILKARKQYAY---
3eddA           -----------DFDRWRMNLVFLMTMPRIPQFYSGDEILMTSTVKGRDDASYRRDFPGGWAGDKANAFSG
4cgtA           DNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLST--
1c7tA           PQNAETSVDRDGNHFNAKSDKPWPGAYGLSAQLWSETQRTDPQMEYMIFPRALSVAERSWHRAGWEQDYR
3czeA           GAAALAGIQAAQEADRLVLLYAIALAPGVPLI-YGDELAV----NDPGYRDDPHRQHERWLHRPADWQLA
3bmvA           TGNGDPYNRAMMTSFNTSTTAYNVIKKLAPLRKSNPAIAYGTTQQRWINNDVYIYERKFG----------
3bh4A           QPGQSLESTVQTWFKPLAYAFILTRESGYPQVFYGDMYGTKGTSPKEIPSLKDNIEPILKARKEYAY---
1cygA           MTGNGDPNNRKMMSSFNKNTRAYQVIQKLSSLRRNNPALAYGDTEQRWINGDVYVYERQF----------
3czgA           -----------DVARFYANAVPGSYARGESFGVHGTN---------------------------------
1c7sA           DERKNAETSVDRDGNHFNAKSDKPWAYGLSAQLWSETQRTDPQMEYMIFPRALSVAERSWHRAGWE-QDY
2cpuA           TTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNNGSNQVAFGRGNRGFIVFNNDDWSFSLTL--------
1d3cA           ----------------EQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSF-STSTTAYQVIQKLA
1cguA           -----------NNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTT----------
1ea9C           ---------------MKLAVLFQFTYFGTPCIYYGDEVGLDGGHDPGCRK------CMEWDETKHDKDLF
3bakA           TTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPA--
3cttA           ----------------------------------------------------------------------
1a47A           YNRAMMTSFNTSTTAYNVIKKLAPLRKSNPAIAYGTTQQRWINNDVYIYERKFGNNVALV----------
1d7fA           MSGGNDPDNRARLPSFSTTTTAYQVIQKLAPLRKSNPAIAYGSTHERWINNDVIIYERKF----------
1cgtA           -------------RRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTT----------
1dhkA           TTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANNGSNQVAFGRGNRGFIVFNNDDWQLSSTL--------
3blkA           TTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPA--
1cgwA           ----------------EQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTT----------
1bvnP           TTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNQVAFGRGNRGFIVFNNDDWQLSSTL--------
1cgxA           -----------NRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTT----------
1dtuA           -----------NRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFST-STTAYQVIQKLA
2dh2A           QSEDPGSLLSLFRRLSDQRSKERSLLHGDFHAFSAGPYIRHWDQNERFLVVLN-----------------
2choA           NS---------DLGPNGHGYRREESMDIQPAAERFLKAFKEGKNYDKADFETLQYTFERMKESADILLMN
3dhpA           TTCGNDWVCEHRARQIRNMVNFRNVVDGQPFYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPA--
3cgtA           ---------------LEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSK-------------
1cxlA           ----------------EQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRA-RIPSFSTSTTAYQVIQKLA
1avaA           -----------PSDRVMQGYAYILTHPGTPCIFYDHFFDWGLKEEIDRLVSVR---TRHGIHNESKLQII
1b0iA           -----------GRLYDLANVFMLAYPYGYPKVMSSYDFHGDTDAGGPNVPVHNNGNLECFA---SNWKCE
3dhuA           ------------KAEAVNNLTWIFMQRGIPLIYNGQEFLAE--HQPSLFDRDTMVADRHGDVTPLIQKLV
1cgvA           ------------RRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFST-STTAYQVIQKLA
1amg-           GQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQL------IQVRRAAGVRADSAI
1cgyA           ----------------------------------------------------------------------
3dhuB           --------------EAVNNLTWIFMQRGIPLIYNGQEFLAE--HQPSLFDRDTMVADRHGDVTPLIQKLV
2droA           ----------------------------------------------------------------------
6cgtA           -------------RRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTT----------
3clwA           MPASPERSINLGLYVARIIHNDLTLANASAWQWWTAVSLGEDVPIQLLPLEGSNGLSLQYDGEISTTKML
2d73A           AFQFI-----KDVALDWDETNYLEAEPGEYITIARKAKDTDDWYVGCTAGENGHTSKLVF----------
2aaaA           -----------DYSQAKNVLSYIFLSDGIPIVYAGEEQHYA--GGKVPYNRE----ATWLSGYDTSAELY
1aqmA           -------------LYDLANVFMLAYPYGYPKVMSSYDFHGDTDAGGPNVPVHNNGNLECFASNWKCEHRW
3blpX           TTCGNDWVCEHRARQIRNMVNFRNVVDGQPFTNNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPA--
3cusR           ----------------------------------------------------------------------
1cdgA           ------------RRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTT----------
3bsgA           --------------KVMQGYAYILTHPGIPCIFYDHFFN-------------------------------
3bshA           --------------KVMQGYAYILTHPGIPCIFYDHFFNWG-----------------------------
1eceA           GYLAP-----------------------------------------------------------------
1cvuA           ----------------------------------------------------------------------
2dh3B           MLWD--------------------------------------ESSFPDIPGAVSANMTVKGQSEDPGSLL
3a5vA           A------------NNTQVVILLNAGDSAAKMTATWDDIWVYNLPNVDSSRSIEVRDLWKQK---------
1cbyA           HLANAFQGAIDPLNLNFNFEKALQIANGIPNSAIVKTL------NQSVIQQTVEISVMVEQLKKIIQEVL
3dc0A           -------------DDIRLGWAVIASRSGSTPLFFSRPDGGGNGVRFPGKTQIGDRGSALFEDQAIVA---
3cc1A           ----------------------------------------------------------------------
2choB           LECFAMHNSDLGPNGHGYRRESMDIQPAAERFLKAFKEGKNYDKADFETLQYTFERMKESADILLMN---
1b5tB           ----------------------------------------------------------------------
3b40A           ----------------------------------------------------------------------
1bagA           -------------DDIRLGWAVIASRSGSTPLFFSRPEGGGNGVRFPGKSQIGDRGSALFEDQAITA---
3bc9A           ----------IYSRKYQAYAYILTRAEGVPTVYWKDYYIWEMKERYYAYGP-------GYEVDNNDADIY
3clwC           RSINLGL---YVARIIHNDLTLANASAWQWWTAVSLGEDVPIQLLPLEGSNGLSLQYDGEISTTKMLWTT
2dh3A           ML--------------------------------------WDESSFPDIPGAVSANMTVKGQSEDPGSLL
1chkA           ----------------------------------------------------------------------
2agaA           ----------------------------------------------------------------------
3cnyA           ----------------------------------------------------------------------
1bplA           ----------------------------------------------------------------------
2bs9A           DVPKALFHGGHSIPKPTFHAFTFFNALGDELLYRDGEMIVTRRKDGSIAAVLWNLVMEKG----------
3civA           ----------------------------------------------------------------------
1bplB           -------------FKPLAYAFILTRESGYPQVFYGDMYGTKGDSQREIPALKHKIEPILKARKQYAY---
1b5tA           ----------------------------------------------------------------------
3cc1B           -------------TNEGILSINQKSVLNRFVYREEDKVAWAANGRNGEA------YVALFNLHDQQKTLQ
3bobA           ----------------------------------------------------------------------
2bfgA           ALFHGGFGLVALHSIPKPTFHAFTFFNALGDELLYRDGEMIVTRRKDGSIAAVLWNL-------------
1cz1A           WVFWSW----------------------------------------------------------------
2aamC           -----------AKRNGCIPYAARSDLELDENVIEGIQPP-------------------------------
2aamA           SFENISRILDYYEKAKRNGCIPYAARSDLELDENVIEGIQPP----------------------------
2c0hA           LKSRT-----------------------------------------------------------------
2aamB           SFENISRILDYYEKAKRNGCIPYAARSDLELDENVIEGIQPP----------------------------
3coyA           ----------------------------------------------------------------------
1cbgA           GPMAASSWLCIYPQGIRKLLLYVKNHYNNPVIYITNEFNDPTLSLQESLLDTPRIDYYYRHLYYVLTAIG
3cozB           ----------------------------------------------------------------------
1b4dA           ----------------------------------------------------------------------
1b31A           ----------------------------------------------------------------------
1a5sA           ----------------------------------------------------------------------
1bxcA           ----------------------------------------------------------------------
2c7fD           GLMLITLMKHADRIKIACLAQLINVIAPIVTERNGGAAWRQTIFYPFMHASKYGRGIVLQ----------
2c7fF           INVIAPIVTERNGGAAWRQTIFYPFMHASKYGRGIVLQPVINSPLHDTSKHEDVTDIESV--AIYNEEKE
2cleA           ----------------------------------------------------------------------
2cliA           ----------------------------------------------------------------------
1a5bA           ----------------------------------------------------------------------
2cncA           ----------------------------------------------------------------------
3c0uA           ----------------------------------------------------------------------
2diwA           ----------------------------------------------------------------------
3a21A           GLQGVKVAEDTTGLQAYGKVLSGTGNRAVVLLNRTSAAHDITVRWSDLGLTNASATVRDL----------
3a21B           ----------------------------------------------------------------------
3cqhA           ----------------------------------------------------------------------
2c8nD           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
3cepA           ----------------------------------------------------------------------
2clhA           ----------------------------------------------------------------------
3d9iB           ----------------------------------------------------------------------
3cqhB           ----------------------------------------------------------------------
1a5aA           ----------------------------------------------------------------------
1ac0A           ----------------------------------------------------------------------
1edgA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           DFVRTLSXXXXXXXXXXXXXXXQGALPGRGKQRDIAWLRPDGTLMEDADWGRGWRALGVFLNGDAITEPD
2e8yA           HYIRRLISLR--------------------KAHPAFRLRSAADIQRHLECLTLKEHLIAYRLYD------
3ecqB           YFNTQAG---------------------------------------------------------------
1bf2A           TFAQRLIAFRKAHPALRPSSWYSG--------SQLTWYQPSGAVADSNYWNNTSNYAIAYAINGPSLG--
2bhuA           FLNSKLNWAEREGGEHARTLRLYRDLL-RLRREDPVLHNRQRENLTTGHDGDVL----------------
1ehaA           TD---------------------PQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNG
2bhyA           FLNSKLNWAEREGGEHARTLRLYRDLL-RLRREDPVLHNRQRENLTTGHDGD----------------VL
2bhzA           NWAEREGGEHARTLRLYRDLLR--------LRREDPVLHNRQRENLTTGHDGDVLW--------------
2d0fA           ALTQKL-----------ITIRNQYPALRTGSFMTLITDDTNKIYS-------------------------
3cejA           ----------------------------------------------------------------------
1eh9A           ----------------------------------------------------------------------
2dieA           DHHDIIGWTREGDSSHPNSGLATIMSDGPGGNKWMYVGKHKAGQVWRDITGNRSGTVTINADGWGNFTVN
3czkA           -PAMDWQLAAQRHDAKSLSGTVYRRLRGLIRQRALGALAADQALASIALNDPRVFAL-------------
3edfA           AGLTSQQRAAQDLVRKLANWRKNQPVIHNGRLM---HFGPEENTWVYFRYNKDKRIMVAMNNDKPMTLPT
3czlA           AMDWQLAAQRHDA----------KSLSGTVYRRLRGLIRQRAAL--------GALAADQALASIALNDPR
3edeA           AGLTSQQRAAQDLVRKLANWRKNQPVIHNGRLM---HFGPEENTWVYFRYNKDKRIMVAMNNDKPMTLPT
3ecqA           ----------------------------------------------------------------------
1bliA           ----------------------------------------------------------------------
1bvzA           EFYKELI---------------------RLRHRLASLTRGNVRSWHADKQANLY----------------
1e3xA           ----------------------------------------------------------------------
3eddA           AGLTSQQRAAQDLVRKLANWRKNQPVIHNG---RLMHFGPEENTWVYFRYNKDKRIMVAMNNDKPMTLPT
4cgtA           ----------------------------------------------------------------------
1c7tA           AGREYKGGETHFVDTQALEKDWLRFANILGQRELAKLDKGGVAYRLPVPGA------RVAGGKLEANIAL
3czeA           AQRHDA----------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
3bh4A           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
3czgA           ----------------------------------------------------------------------
1c7sA           RAGREYKGGETHFVDTQALEKDWLRFANILGQRELAKLDKGGVAYRLPVP--------GARVAGGKLE-A
2cpuA           ----------------------------------------------------------------------
1d3cA           PL--------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
1ea9C           AFYQTV----------------------------------------------------------------
3bakA           ----------------------------------------------------------------------
3cttA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
1d7fA           ----------------------------------------------------------------------
1cgtA           ----------------------------------------------------------------------
1dhkA           ----------------------------------------------------------------------
3blkA           ----------------------------------------------------------------------
1cgwA           ----------------------------------------------------------------------
1bvnP           ----------------------------------------------------------------------
1cgxA           ----------------------------------------------------------------------
1dtuA           PL--------------------------------------------------------------------
2dh2A           ----------------------------------------------------------------------
2choA           TENKPL----------------------------------------------------------------
3dhpA           ----------------------------------------------------------------------
3cgtA           ----------------------------------------------------------------------
1cxlA           PL--------------------------------------------------------------------
1avaA           EADADL----------------------------------------------------------------
1b0iA           HRWSYIAGGVDFRNNTADNWAVTNWWDNTNNQ--ISFGRGSSGHMAINKEDSTLTTVQTDMASGQYCNVL
3dhuA           TI--------------------------------------------------------------------
1cgvA           PLRK------------------------------------------------------------------
1amg-           SFHSGYS---------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
3dhuB           TI--------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
6cgtA           ----------------------------------------------------------------------
3clwA           WTTANYSFFVRPGMKRIAIKPTYKISDLEAATSLMISSYTDGKEVVTVAINYSKENQVISL---NCDHAQ
2d73A           ----------------------------------------------------------------------
2aaaA           TWIATTNAIRKLAIAADSAYITYANDAFYTDSNTIAMAKGTS----------------------------
1aqmA           SYIAGG----------------------------------------------------------------
3blpX           ----------------------------------------------------------------------
3cusR           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
3bsgA           ----------------------------------------------------------------------
3bshA           ----------------------------------------------------------------------
1eceA           ----------------------------------------------------------------------
1cvuA           ----------------------------------------------------------------------
2dh3B           SLFRRL----------------------------------------------------------------
3a5vA           ----------------------------------------------------------------------
1cbyA           GLVINS-----TSFWNSVEATIKGTFTNLDTQIDEAWIFWHSLSAHNTSYYYN----ILF----------
3dc0A           ----------------------------------------------------------------------
3cc1A           ----------------------------------------------------------------------
2choB           ----------------------------------------------------------------------
1b5tB           ----------------------------------------------------------------------
3b40A           ----------------------------------------------------------------------
1bagA           ----------------------------------------------------------------------
3bc9A           SYVRS-----------------------------------------------------------------
3clwC           ANYS------------------------------------------------------------------
2dh3A           SLFRRL----------------------------------------------------------------
1chkA           ----------------------------------------------------------------------
2agaA           ----------------------------------------------------------------------
3cnyA           ----------------------------------------------------------------------
1bplA           ----------------------------------------------------------------------
2bs9A           ----------------------------------------------------------------------
3civA           ----------------------------------------------------------------------
1bplB           ----------------------------------------------------------------------
1b5tA           ----------------------------------------------------------------------
3cc1B           FRLD------------------------------------------------------------------
3bobA           ----------------------------------------------------------------------
2bfgA           ----------------------------------------------------------------------
1cz1A           ----------------------------------------------------------------------
2aamC           ----------------------------------------------------------------------
2aamA           ----------------------------------------------------------------------
2c0hA           ----------------------------------------------------------------------
2aamB           ----------------------------------------------------------------------
3coyA           ----------------------------------------------------------------------
1cbgA           DGVN------------------------------------------------------------------
3cozB           ----------------------------------------------------------------------
1b4dA           ----------------------------------------------------------------------
1b31A           ----------------------------------------------------------------------
1a5sA           ----------------------------------------------------------------------
1bxcA           ----------------------------------------------------------------------
2c7fD           ----------------------------------------------------------------------
2c7fF           EVTI------------------------------------------------------------------
2cleA           ----------------------------------------------------------------------
2cliA           ----------------------------------------------------------------------
1a5bA           ----------------------------------------------------------------------
2cncA           ----------------------------------------------------------------------
3c0uA           ----------------------------------------------------------------------
2diwA           ----------------------------------------------------------------------
3a21A           ----------------------------------------------------------------------
3a21B           ----------------------------------------------------------------------
3cqhA           ----------------------------------------------------------------------
2c8nD           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
3cepA           ----------------------------------------------------------------------
2clhA           ----------------------------------------------------------------------
3d9iB           ----------------------------------------------------------------------
3cqhB           ----------------------------------------------------------------------
1a5aA           ----------------------------------------------------------------------
1ac0A           ----------------------------------------------------------------------
1edgA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           RMGRRIRDDSFLLLLNAGINDVQFTLPGPSYSAAWETVVDTADPEVAGRPYLPAGSDVTVIDRSFLVLKx
2e8yA           -LDEVDEWKDIIVIHHASPDSVEWRLPNDIP---YRLLCDPSGFQEDPT---EIKKTVAVNGIGTVILY-
3ecqB           ----------------------------------------------------------------------
1bf2A           ------DSNSIYVAYNGWSSSVTFTLPAPPSGTQWYRVTDTCDWNDGASTFVAPGSETLIGGAGTTY---
2bhuA           WVRTVTGAGERVLLWNLGQDTRAVAEVKLPFTVPRRLLLHTEGREDLTGAG-------------------
1ehaA           ENWLIIKGREYFSLYVFSKSSIEVKYSG------------------------------------------
2bhyA           WVRTVTGAGERVLLWNLGQDTRAVAEVKLPFTVPRRLLLHTEGREDLT---LGAGEAVLV----------
2bhzA           -VRTVTGAGERVLLWNLGQDTRAVAEVKLPFTVPRRLLLHTEGREDLTGAG-------------------
2d0fA           -YGRFDNVNRIAVVLNNDSVSHTVNVPVWQLGSTVTDKITGHSYTVQN-----GMVTVAVDGHYGAVL--
3cejA           ----------------------------------------------------------------------
1eh9A           ----------------------------------------------------------------------
2dieA           GGAVSV----------------------------------------------------------------
3czkA           -----TRGDSFIALHNFSDQLLDVELAAIGV--DGWTLLRG-DGSIVLPPY-------------------
3edfA           ARFQEMGAPSGVDFLSGKTVGLGRELRLAPKSVVV-----------------------------------
3czlA           VFALT-RGDSFIALHNFSDQLLDVELAAIGVD--GWTLLAIRGDSIVLPPY-------------------
3edeA           ARFQEMGAPSGVDFLSGKTVGLGRELRLAPKSVVV-----------------------------------
3ecqA           ----------------------------------------------------------------------
1bliA           ----------------------------------------------------------------------
1bvzA           AFVRTVQDQHVGVVLNNRGEKQTVLLQVPESGGKWLDCLTGEEVHGKQ-----GQLKLTLRPYQGMILW-
1e3xA           ----------------------------------------------------------------------
3eddA           ARFQEMGAPSGVDFLSGKTVGLGRELRLAPKSVVV-----------------------------------
4cgtA           ----------------------------------------------------------------------
1c7tA           PGLGIEYSTDGGKQWQRYDAKAKPAVSGEVQ---VRSVSPDGKRYSRAEK--------------------
3czeA           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
3bh4A           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
3czgA           ----------------------------------------------------------------------
1c7sA           NIALPGLGIEYSTDGGKQWQRYDAKAKPAVSGEVQVRSVSPDGKRY------------------------
2cpuA           ----------------------------------------------------------------------
1d3cA           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
1ea9C           ----------------------------------------------------------------------
3bakA           ----------------------------------------------------------------------
3cttA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
1d7fA           ----------------------------------------------------------------------
1cgtA           ----------------------------------------------------------------------
1dhkA           ----------------------------------------------------------------------
3blkA           ----------------------------------------------------------------------
1cgwA           ----------------------------------------------------------------------
1bvnP           ----------------------------------------------------------------------
1cgxA           ----------------------------------------------------------------------
1dtuA           ----------------------------------------------------------------------
2dh2A           ----------------------------------------------------------------------
2choA           ----------------------------------------------------------------------
3dhpA           ----------------------------------------------------------------------
3cgtA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1avaA           ----------------------------------------------------------------------
1b0iA           ELSADAKSCSGEVITVNSDGTINLNIGA------------------------------------------
3dhuA           ----------------------------------------------------------------------
1cgvA           ----------------------------------------------------------------------
1amg-           ----------------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
3dhuB           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
6cgtA           ----------------------------------------------------------------------
3clwA           KGKVYLTTIDKNLRYMGEQPLKKLQLPARS----------------------------------------
2d73A           ----------------------------------------------------------------------
2aaaA           ----------------------------------------------------------------------
1aqmA           ----------------------------------------------------------------------
3blpX           ----------------------------------------------------------------------
3cusR           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
3bsgA           ----------------------------------------------------------------------
3bshA           ----------------------------------------------------------------------
1eceA           ----------------------------------------------------------------------
1cvuA           ----------------------------------------------------------------------
2dh3B           ----------------------------------------------------------------------
3a5vA           ----------------------------------------------------------------------
1cbyA           SIQNEDTGAVMAVLPLAFEVSVDVEKQK----VLFFTIKDSARYEVKMKAVQALHSSNAPIVDIFNV---
3dc0A           ----------------------------------------------------------------------
3cc1A           ----------------------------------------------------------------------
2choB           ----------------------------------------------------------------------
1b5tB           ----------------------------------------------------------------------
3b40A           ----------------------------------------------------------------------
1bagA           ----------------------------------------------------------------------
3bc9A           ----------------------------------------------------------------------
3clwC           ----------------------------------------------------------------------
2dh3A           ----------------------------------------------------------------------
1chkA           ----------------------------------------------------------------------
2agaA           ----------------------------------------------------------------------
3cnyA           ----------------------------------------------------------------------
1bplA           ----------------------------------------------------------------------
2bs9A           ----------------------------------------------------------------------
3civA           ----------------------------------------------------------------------
1bplB           ----------------------------------------------------------------------
1b5tA           ----------------------------------------------------------------------
3cc1B           ----------------------------------------------------------------------
3bobA           ----------------------------------------------------------------------
2bfgA           ----------------------------------------------------------------------
1cz1A           ----------------------------------------------------------------------
2aamC           ----------------------------------------------------------------------
2aamA           ----------------------------------------------------------------------
2c0hA           ----------------------------------------------------------------------
2aamB           ----------------------------------------------------------------------
3coyA           ----------------------------------------------------------------------
1cbgA           ----------------------------------------------------------------------
3cozB           ----------------------------------------------------------------------
1b4dA           ----------------------------------------------------------------------
1b31A           ----------------------------------------------------------------------
1a5sA           ----------------------------------------------------------------------
1bxcA           ----------------------------------------------------------------------
2c7fD           ----------------------------------------------------------------------
2c7fF           ----------------------------------------------------------------------
2cleA           ----------------------------------------------------------------------
2cliA           ----------------------------------------------------------------------
1a5bA           ----------------------------------------------------------------------
2cncA           ----------------------------------------------------------------------
3c0uA           ----------------------------------------------------------------------
2diwA           ----------------------------------------------------------------------
3a21A           ----------------------------------------------------------------------
3a21B           ----------------------------------------------------------------------
3cqhA           ----------------------------------------------------------------------
2c8nD           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
3cepA           ----------------------------------------------------------------------
2clhA           ----------------------------------------------------------------------
3d9iB           ----------------------------------------------------------------------
3cqhB           ----------------------------------------------------------------------
1a5aA           ----------------------------------------------------------------------
1ac0A           ----------------------------------------------------------------------
1edgA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxx
2e8yA           -------
3ecqB           -------
1bf2A           -------
2bhuA           -------
1ehaA           -------
2bhyA           -------
2bhzA           -------
2d0fA           -------
3cejA           -------
1eh9A           -------
2dieA           -------
3czkA           -------
3edfA           -------
3czlA           -------
3edeA           -------
3ecqA           -------
1bliA           -------
1bvzA           -------
1e3xA           -------
3eddA           -------
4cgtA           -------
1c7tA           -------
3czeA           -------
3bmvA           -------
3bh4A           -------
1cygA           -------
3czgA           -------
1c7sA           -------
2cpuA           -------
1d3cA           -------
1cguA           -------
1ea9C           -------
3bakA           -------
3cttA           -------
1a47A           -------
1d7fA           -------
1cgtA           -------
1dhkA           -------
3blkA           -------
1cgwA           -------
1bvnP           -------
1cgxA           -------
1dtuA           -------
2dh2A           -------
2choA           -------
3dhpA           -------
3cgtA           -------
1cxlA           -------
1avaA           -------
1b0iA           -------
3dhuA           -------
1cgvA           -------
1amg-           -------
1cgyA           -------
3dhuB           -------
2droA           -------
6cgtA           -------
3clwA           -------
2d73A           -------
2aaaA           -------
1aqmA           -------
3blpX           -------
3cusR           -------
1cdgA           -------
3bsgA           -------
3bshA           -------
1eceA           -------
1cvuA           -------
2dh3B           -------
3a5vA           -------
1cbyA           -------
3dc0A           -------
3cc1A           -------
2choB           -------
1b5tB           -------
3b40A           -------
1bagA           -------
3bc9A           -------
3clwC           -------
2dh3A           -------
1chkA           -------
2agaA           -------
3cnyA           -------
1bplA           -------
2bs9A           -------
3civA           -------
1bplB           -------
1b5tA           -------
3cc1B           -------
3bobA           -------
2bfgA           -------
1cz1A           -------
2aamC           -------
2aamA           -------
2c0hA           -------
2aamB           -------
3coyA           -------
1cbgA           -------
3cozB           -------
1b4dA           -------
1b31A           -------
1a5sA           -------
1bxcA           -------
2c7fD           -------
2c7fF           -------
2cleA           -------
2cliA           -------
1a5bA           -------
2cncA           -------
3c0uA           -------
2diwA           -------
3a21A           -------
3a21B           -------
3cqhA           -------
2c8nD           -------
2a6tA           -------
3cepA           -------
2clhA           -------
3d9iB           -------
3cqhB           -------
1a5aA           -------
1ac0A           -------
1edgA           -------