[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ56010.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2basA.bssp"
#ERROR : Can't open dsspfile "2basB.bssp"
#ERROR : Can't open dsspfile "1b5tB.bssp"
#ERROR : Can't open dsspfile "1b5tA.bssp"
#ERROR : Can't open dsspfile "2bduA.bssp"
#ERROR : Can't open dsspfile "2ayaA.bssp"

## Summary of PDB Search
:389
    1e-15  14%  2basA  [x.x.x] YKUI PROTEIN
    3e-14  16%  2basB  [x.x.x] YKUI PROTEIN
    1e-09  11%  1b5tB  [c.1.23] PROTEIN (METHYLENETETRAHYDROFOLATE REDUCTASE)
    2e-08  10%  1b5tA  [c.1.23] PROTEIN (METHYLENETETRAHYDROFOLATE REDUCTASE)
    2e-06   6%  2bduA  [x.x.x] CYTOSOLIC 5'-NUCLEOTIDASE III
    4e-05  17%  2ayaA  [x.x.x] DNA POLYMERASE III SUBUNIT TAU
:389

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSVVLRPIIDLDSGAVLAVEAVVPVDRRSGADVAVLTELL
2basA           ------------------------------VLPYYQAIFSAEEQKVVGYEVLGDAGIPEEYKLEVDNRII
2basB           ------------------------------VLPYYQAIFSAEEQKVVGYEVLGDAGIPEEYKLEVDNRII
1b5tB           ------------------------------------HSIIKGIKDRTGLEAAPLRTIARDYWNNGIRHIV
1b5tA           ------------------------------------PHLTCIDATPDELRTIAHIVALRGDLPPGSGKPE
2bduA           ------------------------------VEEIICGLIKGGAAKLQIITDKRCPTCHNIIDNCKLVTDE
2ayaA           --------------------------------------------AKLAAEAI-ERDPWAAQVSQLSLPKL


                         .         .         *         .         .         .         .:140
query           GRVARETAARESFLPLVLPFPARLLTAGQEPLGFLRDTLQRSGRQPRDVTLMVDADLCFLPRDHLVAALA
2basA           RQALDRFLEADSDLLIFNQDANLLL-DHGESFLELLKEYEAKGIELHRFVLEI-TEHNFEGDIEQLYHLA
2basB           RQALDRFLEADSDLLIFNQDANLLL-DHGESFLELLKEYEAKGIELHRFVLEI-TEHNFEGDIEQLYHLA
1b5tB           LRGDLPPGSGKEVADFDISVAAYPEVHPEAKS-AQADLLNLKRKVDAGANRAITQ--FFFDVESYLRFRD
1b5tA           MYASDLVTLLKEVADFDISVAAYPEVHPEAKS-AQADLLNLKRKVDAGANRAITQF--FFDVESYLRFRD
2bduA           CRRKLLQLKEQ--YYAIEVDPVLTVEEKFPYVEWYTKSHGLLIEQGPKAKLKEIVADSDVLKEGYENFFG
2ayaA           VEQVALNAWSDNAVCLHLRSSQRHLNNR-GAQQKLAEALSMLKGSTVELTIVEDDNPAVRTPLEWRQAIY


                         +         .         .         .         .         *         .:210
query           RVREMGFRYAFDTARVSPDLLVETAPFLFRIEGSLTSGLPDQEQCAAIVDGMTRIARGAGTFPLASGVTS
2basA           YYRTYGIKIAVDKESSNLDRIALLSPDLLKIDLQALKSPSYE----HVLYSISLLARKIGAALLYEDIEA
2basB           YYRTYGIKIAVDKESSNLDRIALLSPDLLKIDLQALKSPS----YEHVLYSISLLARKIGAALLYEDIEA
1b5tB           RCVSAGIDVEIILPVSNFKQAKKFADMNVRIPAWMAQMFDGLDDDAETRKLGANIAMDMVKILSREGVKD
1b5tA           RCVSAGIDVEIILPVSNFKQAKKFADMNVRIPAWMAQMFDGLDDDAETRKLGANIAMDMVKILSREGVKD
2bduA           KLQQHGIPVFAGIGDVLEEVIRQAGVYHSNVKVVSNFDFDENGVLKGFKGELIHVFNKHDGALKNTDSQG
2ayaA           EEKLAQARESII----------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IAQLTALRTVGVRMAQGPLFAGDDWAPGDRVTQIPALSLEPLAPDSGAGLRVSEFMVPAVTMTVEATSEE
2basA           NFQLQYAWRNGGRYFQGYYLVSPSETFLEFITHEKKKLETVYEHSEQFYKRVHQAVTSLRKNNLSSDDDF
2basB           NFQLQYAWRNGGRYFQGYYLVSPSETF-------------------------------------------
1b5tB           FHFYTLNRAEMSYAICHTLGV-------------------------------------------------
1b5tA           FHFYTLNRAEMSYAICHTLGV-------------------------------------------------
2bduA           DLRADGVANVEHILKIGYLN--------------------------------------------------
2ayaA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VLEAFSADSALNSVILLDHRERPVAAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2basA           IKKLAEELTDCSFRIYCDEEGDQLTG--------------------------------------------
2basB           ----------------------------------------------------------------------
1b5tB           ----------------------------------------------------------------------
1b5tA           ----------------------------------------------------------------------
2bduA           ----------------------------------------------------------------------
2ayaA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2basA           ---------------------------------------
2basB           ---------------------------------------
1b5tB           ---------------------------------------
1b5tA           ---------------------------------------
2bduA           ---------------------------------------
2ayaA           ---------------------------------------