[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ56050.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1cerO.bssp"
#ERROR : Can't open dsspfile "3dbvO.bssp"
#ERROR : Can't open dsspfile "3cifA.bssp"
#ERROR : Can't open dsspfile "3docA.bssp"
#ERROR : Can't open dsspfile "1crwG.bssp"
#ERROR : Can't open dsspfile "1a7kA.bssp"
#ERROR : Can't open dsspfile "3e6aA.bssp"
#ERROR : Can't open dsspfile "1dssG.bssp"
#ERROR : Can't open dsspfile "2b4rO.bssp"
#ERROR : Can't open dsspfile "3docD.bssp"
#ERROR : Can't open dsspfile "3e6aO.bssp"
#ERROR : Can't open dsspfile "3e5rO.bssp"
#ERROR : Can't open dsspfile "3dmtC.bssp"
#ERROR : Can't open dsspfile "1dbvO.bssp"
#ERROR : Can't open dsspfile "2d2iA.bssp"
#ERROR : Can't open dsspfile "1dc4A.bssp"
#ERROR : Can't open dsspfile "2b4tO.bssp"
#ERROR : Can't open dsspfile "3cpsB.bssp"
#ERROR : Can't open dsspfile "3cpsA.bssp"
#ERROR : Can't open dsspfile "2duuA.bssp"
#ERROR : Can't open dsspfile "1cf2P.bssp"
#ERROR : Can't open dsspfile "1b7gO.bssp"
#ERROR : Can't open dsspfile "1brmB.bssp"
#ERROR : Can't open dsspfile "3c8mA.bssp"
#ERROR : Can't open dsspfile "1brmC.bssp"
#ERROR : Can't open dsspfile "1e0uA.bssp"
#ERROR : Can't open dsspfile "1brmA.bssp"
#ERROR : Can't open dsspfile "3dblB.bssp"
#ERROR : Can't open dsspfile "3dtyA.bssp"
#ERROR : Can't open dsspfile "2czcA.bssp"
#ERROR : Can't open dsspfile "3dbrE.bssp"
#ERROR : Can't open dsspfile "3e9mD.bssp"
#ERROR : Can't open dsspfile "3dblF.bssp"
#ERROR : Can't open dsspfile "3dbrB.bssp"
#ERROR : Can't open dsspfile "2cvoD.bssp"
#ERROR : Can't open dsspfile "3btvB.bssp"
#ERROR : Can't open dsspfile "3btsA.bssp"
#ERROR : Can't open dsspfile "2cdyC.bssp"
#ERROR : Can't open dsspfile "3cmmA.bssp"
#ERROR : Can't open dsspfile "2aw9B.bssp"
#ERROR : Can't open dsspfile "1ch6A.bssp"
#ERROR : Can't open dsspfile "3dr3A.bssp"
#ERROR : Can't open dsspfile "3do5A.bssp"
#ERROR : Can't open dsspfile "3dbrA.bssp"
#ERROR : Can't open dsspfile "3e1kA.bssp"
#ERROR : Can't open dsspfile "3dblE.bssp"
#ERROR : Can't open dsspfile "3dbrD.bssp"
#ERROR : Can't open dsspfile "3btuE.bssp"
#ERROR : Can't open dsspfile "3e82A.bssp"
#ERROR : Can't open dsspfile "3dbhE.bssp"
#ERROR : Can't open dsspfile "2ejwA.bssp"
#ERROR : Can't open dsspfile "3bioA.bssp"
#ERROR : Can't open dsspfile "3btuA.bssp"
#ERROR : Can't open dsspfile "2cdpD.bssp"
#ERROR : Can't open dsspfile "2czcD.bssp"
#ERROR : Can't open dsspfile "1b3bA.bssp"
#ERROR : Can't open dsspfile "3db2A.bssp"
#ERROR : Can't open dsspfile "3e18B.bssp"
#ERROR : Can't open dsspfile "2cdpB.bssp"
#ERROR : Can't open dsspfile "3dbhA.bssp"
#ERROR : Can't open dsspfile "2axqA.bssp"
#ERROR : Can't open dsspfile "3dbhF.bssp"
#ERROR : Can't open dsspfile "3dbhB.bssp"
#ERROR : Can't open dsspfile "1b6rA.bssp"
#ERROR : Can't open dsspfile "3dbrG.bssp"
#ERROR : Can't open dsspfile "2cvoA.bssp"
#ERROR : Can't open dsspfile "2cdpC.bssp"
#ERROR : Can't open dsspfile "2czcB.bssp"
#ERROR : Can't open dsspfile "3e18A.bssp"
#ERROR : Can't open dsspfile "3dbhG.bssp"
#ERROR : Can't open dsspfile "3btuC.bssp"
#ERROR : Can't open dsspfile "1b26A.bssp"
#ERROR : Can't open dsspfile "3ceaA.bssp"
#ERROR : Can't open dsspfile "3btvA.bssp"
#ERROR : Can't open dsspfile "1e5lA.bssp"
#ERROR : Can't open dsspfile "1arzA.bssp"
#ERROR : Can't open dsspfile "3ceaC.bssp"
#ERROR : Can't open dsspfile "3db2B.bssp"
#ERROR : Can't open dsspfile "3bioB.bssp"
#ERROR : Can't open dsspfile "3btuB.bssp"
#ERROR : Can't open dsspfile "2dldA.bssp"
#ERROR : Can't open dsspfile "3e82D.bssp"
#ERROR : Can't open dsspfile "2a2pA.bssp"
#ERROR : Can't open dsspfile "2dc1A.bssp"
#ERROR : Can't open dsspfile "1arzC.bssp"
#ERROR : Can't open dsspfile "1dihA.bssp"
#ERROR : Can't open dsspfile "3ed8C.bssp"
#ERROR : Can't open dsspfile "2c3gA.bssp"
#ERROR : Can't open dsspfile "1bvuA.bssp"
#ERROR : Can't open dsspfile "3cmmC.bssp"
#ERROR : Can't open dsspfile "2c3hD.bssp"
#ERROR : Can't open dsspfile "3db2C.bssp"
#ERROR : Can't open dsspfile "2c3hA.bssp"
#ERROR : Can't open dsspfile "3e9mB.bssp"
#ERROR : Can't open dsspfile "1b6sA.bssp"
#ERROR : Can't open dsspfile "2c3hB.bssp"
#ERROR : Can't open dsspfile "3dojA.bssp"
#ERROR : Can't open dsspfile "3c1aA.bssp"
#ERROR : Can't open dsspfile "1dapA.bssp"
#ERROR : Can't open dsspfile "2duwA.bssp"
#ERROR : Can't open dsspfile "3btsB.bssp"
#ERROR : Can't open dsspfile "3ec7A.bssp"
#ERROR : Can't open dsspfile "3e1kC.bssp"
#ERROR : Can't open dsspfile "2bh9A.bssp"
#ERROR : Can't open dsspfile "2bhlA.bssp"
#ERROR : Can't open dsspfile "1e7mA.bssp"
#ERROR : Can't open dsspfile "1e77A.bssp"
#ERROR : Can't open dsspfile "3e82E.bssp"
#ERROR : Can't open dsspfile "3dtyB.bssp"
#ERROR : Can't open dsspfile "3d1lB.bssp"
#ERROR : Can't open dsspfile "3dtyD.bssp"
#ERROR : Can't open dsspfile "2d5aA.bssp"
#ERROR : Can't open dsspfile "1dpgA.bssp"
#ERROR : Can't open dsspfile "2e77A.bssp"

## Summary of PDB Search
:335
    6e-97  59%  1cerO  [c.2.1 - d.81.1] HOLO-D-GLYCERALDEHYDE-3-PHOSPHATE
    1e-88  63%  3dbvO  [c.2.1 - d.81.1] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
    7e-88  48%  3cifA  [x.x.x] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
    9e-88  52%  3docA  [x.x.x] GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE
    8e-87  45%  1crwG  [c.2.1 - d.81.1] D-GLYCERALDEHYDE-3-PHOSPHATE-DEHYDROGENASE
    1e-86  47%  1a7kA  [c.2.1 - d.81.1] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
    2e-86  48%  3e6aA  [x.x.x] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE,
    2e-86  45%  1dssG  [c.2.1 - d.81.1] D-GLYCERALDEHYDE-3-PHOSPHATE-DEHYDROGENASE
    1e-85  48%  2b4rO  [x.x.x] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
    3e-85  52%  3docD  [x.x.x] GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE
    6e-85  47%  3e6aO  [x.x.x] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE,
    6e-85  48%  3e5rO  [x.x.x] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE,
    9e-85  46%  3dmtC  [x.x.x] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE,
    2e-84  64%  1dbvO  [c.2.1 - d.81.1] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
    1e-83  55%  2d2iA  [x.x.x] GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE
    2e-80  49%  1dc4A  [c.2.1 - d.81.1] GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE
    3e-80  48%  2b4tO  [x.x.x] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
    4e-80  49%  3cpsB  [x.x.x] GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE
    4e-77  49%  3cpsA  [x.x.x] GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE
    2e-71  53%  2duuA  [x.x.x] GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE
    5e-65  18%  1cf2P  [c.2.1 - d.81.1] PROTEIN (GLYCERALDEHYDE-3-PHOSPHATE
    1e-59  15%  1b7gO  [c.2.1 - d.81.1] PROTEIN (GLYCERALDEHYDE 3-PHOSPHATE
    3e-52  16%  1brmB  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    9e-51  11%  3c8mA  [x.x.x] HOMOSERINE DEHYDROGENASE
    2e-47  15%  1brmC  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    5e-46  15%  1e0uA  [c.1.12 - b.58.1 - c.49.1] PYRUVATE KINASE
    1e-43  16%  1brmA  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    6e-42  10%  3dblB  [x.x.x] NEDD8-ACTIVATING ENZYME E1 CATALYTIC SUBUNIT
    6e-41  10%  3dtyA  [x.x.x] OXIDOREDUCTASE, GFO/IDH/MOCA FAMILY
    8e-41  16%  2czcA  [x.x.x] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
    1e-39   6%  3dbrE  [x.x.x] NEDD8-ACTIVATING ENZYME E1 REGULATORY SUBUNIT
    2e-39  11%  3e9mD  [x.x.x] OXIDOREDUCTASE, GFO/IDH/MOCA FAMILY
    1e-37  11%  3dblF  [x.x.x] NEDD8-ACTIVATING ENZYME E1 CATALYTIC SUBUNIT
    2e-37   8%  3dbrB  [x.x.x] NEDD8-ACTIVATING ENZYME E1 CATALYTIC SUBUNIT
    3e-36  10%  2cvoD  [x.x.x] PUTATIVE SEMIALDEHYDE DEHYDROGENASE
    4e-34  11%  3btvB  [x.x.x] GALACTOSE/LACTOSE METABOLISM REGULATORY PROTEIN
    4e-34  10%  3btsA  [x.x.x] GALACTOSE/LACTOSE METABOLISM REGULATORY PROTEIN
    3e-33   8%  2cdyC  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    6e-33   8%  3cmmA  [x.x.x] UBIQUITIN-ACTIVATING ENZYME E1 1
    6e-33   7%  2aw9B  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    9e-33  12%  1ch6A  [x.x.x] GLUTAMATE DEHYDROGENASE
    1e-32   9%  3dr3A  [x.x.x] N-ACETYL-GAMMA-GLUTAMYL-PHOSPHATE REDUCTASE
    2e-32  13%  3do5A  [x.x.x] HOMOSERINE DEHYDROGENASE
    3e-32   8%  3dbrA  [x.x.x] NEDD8-ACTIVATING ENZYME E1 REGULATORY SUBUNIT
    7e-32  10%  3e1kA  [x.x.x] GALACTOSE/LACTOSE METABOLISM REGULATORY PROTEIN
    1e-31   7%  3dblE  [x.x.x] NEDD8-ACTIVATING ENZYME E1 REGULATORY SUBUNIT
    5e-31   9%  3dbrD  [x.x.x] NEDD8-ACTIVATING ENZYME E1 CATALYTIC SUBUNIT
    8e-31  13%  3btuE  [x.x.x] GALACTOSE/LACTOSE METABOLISM REGULATORY PROTEIN
    1e-30  12%  3e82A  [x.x.x] PUTATIVE OXIDOREDUCTASE
    4e-30   8%  3dbhE  [x.x.x] NEDD8-ACTIVATING ENZYME E1 REGULATORY SUBUNIT
    7e-30  11%  2ejwA  [x.x.x] HOMOSERINE DEHYDROGENASE
    1e-29  13%  3bioA  [x.x.x] OXIDOREDUCTASE, GFO/IDH/MOCA FAMILY
    5e-28  10%  3btuA  [x.x.x] GALACTOSE/LACTOSE METABOLISM REGULATORY PROTEIN
    6e-28  12%  2cdpD  [x.x.x] BETA-AGARASE 1
    2e-27  16%  2czcD  [x.x.x] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
    3e-27  17%  1b3bA  [c.58.1 - c.2.1] PROTEIN (GLUTAMATE DEHYDROGENASE)
    4e-27  11%  3db2A  [x.x.x] PUTATIVE NADPH-DEPENDENT OXIDOREDUCTASE
    6e-27   8%  3e18B  [x.x.x] OXIDOREDUCTASE
    1e-26  13%  2cdpB  [x.x.x] BETA-AGARASE 1
    2e-26   7%  3dbhA  [x.x.x] NEDD8-ACTIVATING ENZYME E1 REGULATORY SUBUNIT
    2e-26  11%  2axqA  [x.x.x] SACCHAROPINE DEHYDROGENASE
    3e-26  10%  3dbhF  [x.x.x] NEDD8-ACTIVATING ENZYME E1 CATALYTIC SUBUNIT
    8e-26   9%  3dbhB  [x.x.x] NEDD8-ACTIVATING ENZYME E1 CATALYTIC SUBUNIT
    9e-26   9%  1b6rA  [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    1e-25   6%  3dbrG  [x.x.x] NEDD8-ACTIVATING ENZYME E1 REGULATORY SUBUNIT
    7e-25  11%  2cvoA  [x.x.x] PUTATIVE SEMIALDEHYDE DEHYDROGENASE
    2e-24  13%  2cdpC  [x.x.x] BETA-AGARASE 1
    8e-24  16%  2czcB  [x.x.x] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
    2e-23   9%  3e18A  [x.x.x] OXIDOREDUCTASE
    2e-23   8%  3dbhG  [x.x.x] NEDD8-ACTIVATING ENZYME E1 REGULATORY SUBUNIT
    3e-23  14%  3btuC  [x.x.x] GALACTOSE/LACTOSE METABOLISM REGULATORY PROTEIN
    4e-23  16%  1b26A  [c.58.1 - c.2.1] GLUTAMATE DEHYDROGENASE
    5e-23   9%  3ceaA  [x.x.x] MYO-INOSITOL 2-DEHYDROGENASE
    2e-22  11%  3btvA  [x.x.x] GALACTOSE/LACTOSE METABOLISM REGULATORY PROTEIN
    3e-22  10%  1e5lA  [c.2.1 - d.81.1] SACCHAROPINE REDUCTASE
    7e-22  16%  1arzA  [c.2.1 - d.81.1] DIHYDRODIPICOLINATE REDUCTASE
    1e-21  11%  3ceaC  [x.x.x] MYO-INOSITOL 2-DEHYDROGENASE
    2e-21  10%  3db2B  [x.x.x] PUTATIVE NADPH-DEPENDENT OXIDOREDUCTASE
    2e-21  14%  3bioB  [x.x.x] OXIDOREDUCTASE, GFO/IDH/MOCA FAMILY
    3e-21  11%  3btuB  [x.x.x] GALACTOSE/LACTOSE METABOLISM REGULATORY PROTEIN
    6e-21  18%  2dldA  [c.23.12 - c.2.1] D-LACTATE DEHYDROGENASE
    2e-20  12%  3e82D  [x.x.x] PUTATIVE OXIDOREDUCTASE
    3e-20  13%  2a2pA  [x.x.x] SELENOPROTEIN M
    5e-19  16%  2dc1A  [x.x.x] L-ASPARTATE DEHYDROGENASE
    2e-18  16%  1arzC  [c.2.1 - d.81.1] DIHYDRODIPICOLINATE REDUCTASE
    2e-18  15%  1dihA  [x.x.x] DIHYDRODIPICOLINATE REDUCTASE
    9e-17   9%  3ed8C  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    1e-15  12%  2c3gA  [x.x.x] ALPHA-AMYLASE G-6
    1e-14  12%  1bvuA  [c.58.1 - c.2.1] PROTEIN (GLUTAMATE DEHYDROGENASE)
    5e-14  12%  3cmmC  [x.x.x] UBIQUITIN-ACTIVATING ENZYME E1 1
    1e-13  13%  2c3hD  [x.x.x] ALPHA-AMYLASE G-6
    2e-13  11%  3db2C  [x.x.x] PUTATIVE NADPH-DEPENDENT OXIDOREDUCTASE
    2e-13  13%  2c3hA  [x.x.x] ALPHA-AMYLASE G-6
    2e-13  17%  3e9mB  [x.x.x] OXIDOREDUCTASE, GFO/IDH/MOCA FAMILY
    1e-12   8%  1b6sA  [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    2e-12  13%  2c3hB  [x.x.x] ALPHA-AMYLASE G-6
    1e-11   7%  3dojA  [x.x.x] DEHYDROGENASE-LIKE PROTEIN
    2e-11  15%  3c1aA  [x.x.x] PUTATIVE OXIDOREDUCTASE
    1e-10  15%  1dapA  [c.2.1 - d.81.1] DIAMINOPIMELIC ACID DEHYDROGENASE
    5e-10  10%  2duwA  [x.x.x] PUTATIVE COA-BINDING PROTEIN
    1e-09  11%  3btsB  [x.x.x] GALACTOSE/LACTOSE METABOLISM REGULATORY PROTEIN
    7e-08  26%  3ec7A  [x.x.x] PUTATIVE DEHYDROGENASE
    7e-08  15%  3e1kC  [x.x.x] GALACTOSE/LACTOSE METABOLISM REGULATORY PROTEIN
    2e-07  10%  2bh9A  [x.x.x] GLUCOSE-6-PHOSPHATE 1-DEHYDROGENASE
    5e-07   7%  2bhlA  [x.x.x] GLUCOSE-6-PHOSPHATE 1-DEHYDROGENASE
    2e-06  11%  1e7mA  [c.2.1 - d.81.1] GLUCOSE 6-PHOSPHATE 1-DEHYDROGENASE
    9e-06  15%  1e77A  [c.2.1 - d.81.1] GLUCOSE 6-PHOSPHATE 1-DEHYDROGENASE
    3e-05  11%  3e82E  [x.x.x] PUTATIVE OXIDOREDUCTASE
    1e-04  20%  3dtyB  [x.x.x] OXIDOREDUCTASE, GFO/IDH/MOCA FAMILY
    2e-04   7%  3d1lB  [x.x.x] PUTATIVE NADP OXIDOREDUCTASE BF3122
    6e-04  23%  3dtyD  [x.x.x] OXIDOREDUCTASE, GFO/IDH/MOCA FAMILY
    9e-04  15%  2d5aA  [x.x.x] HYPOTHETICAL PROTEIN PH1109
    0.001  13%  1dpgA  [c.2.1 - d.81.1] GLUCOSE 6-PHOSPHATE DEHYDROGENASE
    0.001  18%  2e77A  [x.x.x] LACTATE OXIDASE
:335

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTIRVGVNGFGRIGRNFWRAVQAAGGSDVEIVAVNDLTDKATLAHLLKYDTVLGTLPGEVEVGEDSITVG
1cerO           --MKVGINGFGRIGRQVFRILHS---RGVEVALINDLTDNKTLAHLLKYDSIYHRFPGEVAYDDQYLYVD
3dbvO           --VKVGINGFGRIGRNVFRAALKNP--DIEVVAVNDTGGANTLAHLLKYDSVHGRLDAEVSVNGNNLVVN
3cifA           -TATLGINGFGRIGRLVLRACMERN--DITVVAINDPFDVEYMAYLLKYDSVHGNFNGTVEVSGKDLCIN
3docA           MAVRVAINGFGRIGRNILRAIVESGRTDIQVVAINDLGPVETNAHLLRYDSVHGRFPKEVEVAGDTIDVG
1crwG           ---KIGINGFGRIGRLVLRAALEMG--AQVVAVNDPFIALEYMVYMFKYDSTHGMFKGEVKAEDGALVVD
1a7kA           -PIKVGINGFGRIGRMVFQAICDQGLTEIDVVAVVDMSNAEYFAYQMKHDTVHGRPKYTVEAVKSSPSVE
3e6aA           --IKIGINGFGRIGRLVARVALQSE--DVELVAVNDFITTDYMTYMFKYDTVHGQWKHSDIKIKDSLLLG
1dssG           ---KIGINGFGRIGRLVLRAALEMGAQVV--AVNDPFIALEYMVYMFKYDSTHGMFKGEVKAEDGALVVD
2b4rO           --TKLGINGFGRIGRLVFRAAFGRK--DIEVVAINDFMDLNHLCYLLKYDSVHGQFPCEVTHADGFLLIG
3docD           --VRVAINGFGRIGRNILRAIVESGRTDIQVVAINDLGPVETNAHLLRYDSVHGRFPKEVEVAGDTIDVG
3e6aO           -KIKIGINGFGRIGRLVARVALQSE--DVELVAVNDFITTDYMTYMFKYDTVHGQWKHSDIKIKDTLLLG
3e5rO           --IKIGINGFGRIGRLVARV--ALQSEDVELVAVNDFITTDYMTYMFKYDTVHGQWKHSDIKIKDSLLLG
3dmtC           MPIKVGINGFGRIGRMVFQALCEDGLLEIDVVAVVDMTDAEYFAYQMRYDTVHGKFKYEVTTTKSSPSVA
1dbvO           --VKVGINGFGRIGRNVFRAALKNP--DIEVVAVNGLTDANTLAHLLKYDSVHGRLDAEVSVNGNNLVVN
2d2iA           MTIRVAINGFGRIGRNFLRCWFGRQNTDLEVVAINNTSDARTAAHLLEYDSVLGRFNADISYDENSITVN
1dc4A           -TIKVGINGFGRIGRIVFRAAQKRS--DIEIVAIND--LLDADYAYLKYDSTHGRFDGTVEVKDGHLIVN
2b4tO           ---KLGINGFGRIGRLVFRAAFGR--KDIEVVAINDPMDLNHLCYLLKYDSVHGQFPCEVTHADGFLLIG
3cpsB           ---TLGINGFGRIGRLVLRACMERN--DITVVAINDPMDVEYMAYLLKYDSVHGNFNGTVEV-SKDLCIN
3cpsA           ---TLGINGFGRIGRLVLRACMERN--DITVVAINDPMDVEYMAYLLKYDSVHGNFNGTVEVSGDLC-IN
2duuA           MTIRVAINGFGRIGRNFLRCWFGRQNTDLEVVAINNTSDARTAAHLLEYDSVLGRFNADISYDENSITVN
1cf2P           --KAVAINGYGTVGKRVADAIAQQD--DMKVIGVSKTRDFEARMALKKGYDLYVAIPERVKLFEKAG---
1b7gO           --VNVAVNGYGTIGKRVADAIIKQP--DMKLVGVAKTPNYEAFIAHRRGIRIYVPQQSIKKFEESGI---
1brmB           --KNVGFIGWGMVGSVLMQR----------------------MVEERDFDAIRPVFFSTSQLGQAAPSFG
3c8mA           -TINLSIFGLGNVGLNLLRIIRSFN---------EENRLGLKFNVVFVADSLHSYYNERIDIGKVISYKE
1brmC           --KNVGFIGWGMVGSVLMQR----------------------MVEERDFDAIRPVFFSTSQLGQAAPSFG
1e0uA           FTTDKSVIGNSEMVAVTYEGF--TTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVLNNGDLGEVNLPGV
1brmA           --KNVGFIGWGMVGSVLMQR----------------------MVEERDFDAIRPVFFSTSQLGQAAPSFG
3dblB           DTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVP
3dtyA           -PIRWAVGGGSQSQIGYIHRCAALRDNFVLVAGAFDIDPIRGSAFGEQLGVDSERCYADYLSFEQEARRA
2czcA           MKVKVGVNGYGTIGKRVAYAVTKQD--DMELIGITKTK----------PDFEAYRAKELGIPVYAASEEF
3dbrE           ESAHVCLINATATGTEILKNL-VLPGIGSFTIIDGNQVSGEDAGNNFFLQRSSIGKNRAEAAMEFLQELN
3e9mD           --IRYGI-STAQIVPRFVAGLRESA--QAEVRGIASRRENAQKAKELAIPVAYGSYEELCKDETIDIIYI
3dblF           DTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVP
3dbrB           DTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVP
2cvoD           --VRIAVLGAGYTGAEIVRLLANHPQFRIKVMTADRKAGE----QFGSVFPHLITQDLPNLVAVKDADFS
3btvB           --IRVGFVGLNAAKGWAIKTHYPAISSQFQITALYSPKIETSIATIQTAFPTLESFASSSTIDMIVIAIQ
3btsA           -PIRVGFVGLNAAKGWAIKTHYPAISSQFQITALYSPKIETSIATIQRLKLSNATA--------------
2cdyC           ------------------------------------------------------------AYTLPQLPYA
3cmmA           QTSNVLILGLKGLGVEIAKNVVLAGVKSMTVFDPEPVQLADLSTQFFLTEKDIGQKRGDVTRAKLAELNA
2aw9B           ---------------------------------------------------------------LPQLPYA
1ch6A           ------------------------------------IDPKELEDFKLQHGTILGFPKAKIYEGSILEVDC
3dr3A           --LNTLIVGAGYAGAELVTYVNRHPH-MNITALTVSAQSNDAGKLISDLHPQLKGIVELPLQPMSDISEF
3do5A           --IKIAIVGFGTVGQGVAELLIRKR------------EEIEKAIGEFKVTAVADSKSSISGDFSLVEALR
3dbrA           ESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFFLQRSSIGKNRAEAAMEFLQELNS
3e1kA           -PIRVGFVGLTSGKSWVAKTHFLAISSQFQIVALYNPTL----KSSLQTIEQLQLKHATGFDSLESF---
3dblE           ---HVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFFLQRSSIGKNRAEAAMEFLQELNS
3dbrD           ---KVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVP
3btuE           --IRVGFVGLNAAKGWAIKTHYPAISSQFQITALYSPKIETSIATIQTAFPTLESFASSSTIDMIVIAIQ
3e82A           -TINIALIGYGFVGKTFHAPLIRSVPGLN--LAFVASRDEEKVKRDLPDVTVIASPEAAVQHPDVDLVVI
3dbhE           ESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFFLQRSSIGKNRAEAAMEFLQELVS
2ejwA           --LKIALLGGGTVGSAFYNLVLERAE-ELSAFGVVPRFLGVLVRDPRKPRAIPQELLRAEPFDLLEADLV
3bioA           -KIRAAIVGYGNIGRYALQALREAP--DFEIAGIVRRELQ------------------------------
3btuA           --IRVGFVGLNAAKGWAIKTHYPAILQQFQITALYSPKIETSIATIQRLK--------------------
2cdpD           ----------------------------------------SIAVEAENFNAVGGTFPVSVYTVNGNTAIN
2czcD           --VKVGVNGYGTIGKRVAYAVTKQD--DMELIGITKT-KPDFEAYRAKELGIPVYAASEEFIPRFEKEG-
1b3bA           KKATVAVQGFGNVGQFAALLISQELGSDSRGGIYPEGFDVEELIRYKKEHGTVVTYPKGERITNEELLDV
3db2A           --VGVAAIGLGRWAYVADAYTKS---EKLKLVTCYSRTEDKREKFGKRYNCA----GDATEALLAREDVE
3e18B           --YQLVIVGYGGMGSYHVTLASAAD--NLEVHGVFDILAEKREAAAQKGLKIYESYEAVLADEKVDAVLI
2cdpB           ---------------------------------------------------------ASIAVEAENFNAV
3dbhA           ESAHVCLINATATGTEILKNLVLPGIGSF-TIIDGNQVSGEDAGNNFFLQRSSIGKNRAEAAMEFLQEVS
2axqA           ---NVLLLGSGFVAQPVIDTL-AANDDINVTVACRTLANAQALAKPSGSKAISLDVTDDSALDKVLADND
3dbhF           ---KVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVP
3dbhB           ---KVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVP
1b6rA           ---QVCVLGNGQLGRMLRQAGEPL-GIAVWPVGLDAEPAAVPFQQSVITAEIERWPETALTRQLARHPAF
3dbrG           ESAHVCLINATATGTEILKNLVLPG--IGSFTIIDGNQSGEDAGNNFFLQRSSIGKNRAEAAMEFLQDVS
2cvoA           EEVRIAVLGAGYTGAEIVRLLANHPQFRIKVMTADRKAGEQ---FGSVFPHLITQDLPNLVAVKDADFSN
2cdpC           -----------------------------------------------------------IAVEAENFNAV
2czcB           --VKVGVNGYGTIGKRVAYAVTKQD--DMELIGITKT-KPDFEAYRAKELGI---------PVYAASEEF
3e18A           -KYQLVIVGYGGMGSYHVTLASAAD--NLEVHGVFDILAEKREAAAQKGLKIYESYEAVLADEKVDAVLI
3dbhG           ESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFFLQRSSIGKNRAEAAMEFLQELNS
3btuC           --IRVGFVGLNAAKGWAIKTHYPAILSQFQITALYSPKIETSIATIQRLKLSNATAFPTLES--------
1b26A           KKATVAVQGFGNVGQFAALLISQELGSKVGGIYNPEGFDVEELIRYKKEHGTVVTYPKGERITNEELLDV
3ceaA           -PLRAAIIGLGRLGERHARHLVNKIQ-GVKLVAACALDSNQLEWAKNELGVETTYTNYKDIDTENIDAIF
3btvA           --IRVGFVGLNAAKGWAIKTHYPAISSQFQITALYSPKIETSIATIQRLKL-------------------
1e5lA           --KSVLMLGSGFVTRPTLDVLTDSGI-KVTVACRTLESAKKLSAGVQHSTPISLDVNDDAALDAEVAKDL
1arzA           -NIRVAIAGAGRMGRQLIQAALALE--GVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSSLDAVKDD
3ceaC           --LRAAIIGLGRLGERHARH-LVNKIQGVKLVAACALNQLEWAKNELGVETTYTNYKDIDTENIDAI---
3db2B           --VGVAAIGLGRWAYVADAYTKSEK---LKLVTCYSRTEDKREKFGKRYNCAGDATEALLAREDVEVIIT
3bioB           -KIRAAIVGYGNIGRYALQALREAPDFEIAGIVRRNPAQPFRVVSDIEQLESVDVALVCSPSREVERTAL
3btuB           -PIRVGFVGLNAAKGWAIKTHYPAILQLSSQFQITALYSP-KIETSIATIQRLKLSNATAFPTLESF---
2dldA           ----VGVVGTGHIGQVFMRI---MEGFGAKVIAYDIFKNPELEKKGYYVDSLDDLYKQADVI----SLHV
3e82D           -TINIALIGYGFVGKTFHAPLIRS-VPGLNLAFVAS-RDEEKVKRDLPDVTVIASPEAAVQHPDVDLVVI
2a2pA           -----------NRLRGLARGRGCQLNRLKEVKAFVTED-----IQLYHNLVMKHLPGADPELVLLSRNYQ
2dc1A           --MLVGLIGYGAIGKFLAEWLERNGF--------------EIAAILDVRGEHEKMVRGIDEFLQREMDVA
1arzC           -NIRVAIAGAGRMGRQLIQAALALE--GVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSSLDAVKDD
1dihA           -NIRVAIAGAGRMGRQLIQAALALEGVQL--GAALEREGSSLLGSDAGELAGAGKTGVTVQSSLDAVKDD
3ed8C           ---DFFKSAMPEGYVQERTISFKDDGKYKTRA--VVKFEGDTLVNRIELKGTDFKEDGNILGHKLEYNFN
2c3gA           ----------------------------------------------------------------------
1bvuA           KGKTIAIQGYGNAGYYMAKIMSEEYGMKVVAVSDTKGGIYNPDGLNADEVLAWKKKTGSVKDFPGATNIT
3cmmC           ---NVLILGLKGLGVEIAKNVVLAGVKSMTVFDPEPVQLADLSTQFFLTEKDIGQKRGDVTRAKLAELNA
2c3hD           ----------------------------------------------------------------------
3db2C           --VGVAAIGLGRWAYVADAYTKSEK---LKLVTCYSRTEDKREKFGKRYNCAGDATEALLAREDVEVIIT
2c3hA           ----------------------------------------------------------------------
3e9mB           --IRYGI-STAQIVPRFVAGLRESA--QAEVRGIASRRENAQKAKELAIPVAYGSYEELCKDETIDIIYI
1b6sA           ---QVCVLGNGQLGRMLRQAGEPLGIAVWPVGL-DAEPAAVPFQQSVITAEIERWPETALTRELARHPAF
2c3hB           ----------------------------------------------------------------------
3dojA           ---EVGFLGLGIMGKAMSMNLLKNGF-KVTVWNRTLSKCDELVEHGASVCESPAEVIKKCKYTIAMLSDP
3c1aA           --VRLALIGAGRWGKNYIRTIAGLP--GAALVRLASSNPDNL-ALVPPGCVIESDWRSVVSAPEVEAVII
1dapA           TNIRVAIVGYGNLGRSVEKLIAKQP--DMDLVGIFSRRTLDTKTPVFDVADV-DKHADDVDV----LFLC
2duwA           --RTIALVGASDKPDRPSYRVMKYLDQGYHVIPVSPKVAGKTLLGQQGYATLADVPEKVDMV---DVFRN
3btsB           -PIRVGFVGLNAAKGWAIKTHYPAISSQFQITALYSPKIETSIATIQRL---------------------
3ec7A           -TLKAGIVGIGIGSDHLRRLANTVS--GVEVVAVCDIVAGRAQAALDKYAIEAKDYNDYHDLIND-----
3e1kC           --IRVGFVGLTSGKSWVAKTHFLAISSQFQIVALYNPTLKSSLQTIEQLQL-------------------
2bh9A           LPENTFIVGYARSRLTVADIRKQSEPATPEEKLKLEDFFARNSYVAGQYD----------------DAAS
2bhlA           LPENTFIVGYARSRLTVADIRKQSEPFTPEEKLKLEDFFARNSYVAGQYD----------------DAAS
1e7mA           LQKHFAIVGTARQALNDDEFKQLVRKDFTDDQAQAEAFIEHFSYRAHDV--------TDAASYAVLKEAI
1e77A           LQKHFAIVGTARQALNDDEFKQLVRDSITDDQAQAEAFIEHFSYRAHDVT-----------------DAA
3e82E           -TINIALIGYGFVGKTFHAPLIRS-VPGLNLAFVASRDEEKVKRDLPDVTVIASPEAAVQHPDVDLVVIA
3dtyB           -PIRWAVGGGSQSQIGYIHRCAALRDNFVLVAGAFDIDPIRGSAFGEQLG-----------VDSERCYAD
3d1lB           ---PIVLIGAGNLATNLAKALYRKGFR----IVQVYSRTEESARELAQKVEAEYTTDLAEVNPYAKLYIV
3dtyD           -PIRWAVGGSSQIGYIHRCAALRDNT-FVLVAGAFDIDPIRGSAFGEQLG-----------VDSERCYAD
2d5aA           --KKIALVGASPKPERDANIVMKYLLEHGYDVYPVNPKYEEVLGRKCYPS--VLDIPDKIEV--VDLFVK
1dpgA           LQKHFAIVGTARQALNFKQLVRDCIKDFTDDQAQAEAFIEHFSYRAHDVTDAASY---------------
2e77A           ----------------------------------------------------------------SGIWVS


                         .         .         *         .         .         .         .:140
query           GTTMKALAQRDPAQLPWGDLGVDIVVESTGFFTKAEDAKKHLDAGAKKVIISAPAKGEDLTVVMGVNDDK
1cerO           GKAIRATAVKDPKEIPWAEAGVGVVIESTGVFTDADKAKAHLEGGAKKVIITAPAKGEDITIVMGVNHEA
3dbvO           GKEIIVKAERDPENLAWGEIGVDIVVESTGRFTKREDAAKHLEAGAKKVIISAPAKNEDITIVMGVNQDK
3cifA           GKVVKVFQAKDPAEIPWGASGAQIVCESTGVFTTEEKASLHLKGGAKKVIISAPPKDNVPMYVMGVNNTE
3docA           YGPIKVHAVRNPAELPWKEENVDIALECTGIFTSRDKAALHLEAGAKRVIVSAPADGADLTVVYGVNNDK
1crwG           GKKITVFNEMKPENIPWSKAGAEYIVESTGVFTTIEKASAHFKGGAKKVIISAPSA-DAPMFVCGVNLEK
1a7kA           TADVLVKAQRNPADLPWGKLGVDYVIESTGLFTDKLKAEGHIKGGAKKVVISAPASGGAKTIVMGVNQHE
3e6aA           EKPVTVFGIRNPDEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAKKVVISAPSKD-APMFVCGVNEDK
1dssG           GKKITVFNEMKPENIPWSKAGAEYIVESTGVFTTIEKASAHFKGGAKKVIISAPSAD-APMFVCGVNLEK
2b4rO           EKKVSVFAEKDPSQIPWGKCQVDVVCESTGVFLTKELASSHLKGGAKKVIMSAPPKDDTPIYVMGINHHQ
3docD           YGPIKVHAVRNPAELPWKEENVDIALECTGIFTSRDKAALHLEAGAKRVIVSAPADGADLTVVYGVNNDK
3e6aO           EKPVTVFGIRNPDEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAKKVVISAPSKD-APMFVCGVNEDK
3e5rO           EKPVTVFGIRNPDEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAKKVVISAPSK-DAPMFVCGVNEDK
3dmtC           KDILCVKAQRNPADLPWGKLGVEYVIESTGLFTAKAAAEGHLRGGARKVVISAPASGGAKTLVMGVNHHE
1dbvO           GKEIIVKAERDPENLAWGEIGVDIVVESTGRFTKREDAAKHLEAGAKKVIISAPAKNEDITIVMGVNQDK
2d2iA           GKTMKIVCDRNPLNLPWKEWDIDLVIESTGVFVTAEGASKHIQAGAKKVLITAPGKAEVGTYVIGVNDSE
1dc4A           GKKIRVTAERDPANLKWDEVGVDVVAEATGLFLTDETARKHITAGAKKVVTGPSKD--NTPFVKGANFDK
2b4tO           EKKVSVFAEKDPSQIPWGKCQVDVVCESTGVFLTKELASSHLKGGAKKVIMSAPPKDDTPIYVMGINHHQ
3cpsB           GKVVKVFQAKDPAEIPWGASGAQIVCESTGVFTTEEKASLHLKGGAKKVIISAPPKDNVPMYVMGVNNTE
3cpsA           GKVVKVFQAKDPAEIPWGASGAQIVCESTGVFTTEEKASLHLKGGAKKVIISAPPKDNVPMYVMGVNNTE
2duuA           GKTMKIVCDRNPLNLPWKEWDIDLVIESTGVFVTAEGASKHIQAGAKKVLITAPGKAEGGTYVIGVNDSE
1cf2P           --------IEVAGTVDDMLDEADIVIDCTPEGIGAKNLKMYKEKGIKAIFQGGEKHEDIGLSFNSLSNYE
1b7gO           ---------PVAGTVEDLIKTSDIVVDTTPNGVGAQYKPIYLQLQRNAIFQGGEKAEVDISFSALCNYNE
1brmB           GTTGTLQDAFDLEALKA----LDIIVTCQGGDYTNEIYPKLRESGWQGYWIDAASKDDAIIILDPVNQDV
3c8mA           KGSLDSLEYESISASEALARDFDIVVDATPASADGKKELAFYKETFENGKDVVTAN--KSGLANFWPEIE
1brmC           GTTGTLQDAFDLEALKALD----IIVTCQGGDYTNEIYPKLRESGWQGYWIDAASKDDAIIILDPVNQDV
1e0uA           SIALPALAEKDKQDLIFGCEQGVDFVAFIRKRSDVIEIREHLKAHGGENIHIISKIE---NQEGLNNFDE
1brmA           GTTGTLQDAFDLEALKA----LDIIVTCQGGDYTNEIYPKLRESGWQGYWIDAASKDDAIIILDPVNQDV
3dblB           NCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPS-SIVPLIDGGTEGF
3dtyA           DGIQAVSGTHYSITKAALEAGLHVVCEKPLCFTVEQAENLRELSHKHNRIVGVQLIEQAREIAAGELGDV
2czcA           IPRFEKEGFEVAGTLNDLLEKVDIIVDATPGGIGAKNKPLYEKAGVKAIFQGGEKADVAEVSFVAQANYE
3dbrE           SSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPV
3e9mD           PTYNQGHYSAAKLALSQGK---PVLLEKPFTLNAAEAEELFAIAQEQGVFLEAQKSVFL-PITQKVKATI
3dblF           NCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFK
3dbrB           NCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPS-SIVPLIDGGTEGF
2cvoD           NVDAVFCLPHGTTQEIIKGLPQELKIVDLSADFRLRDINEYAEWYGHSHRAPELQQEAVYGL-TEVLRNE
3btvB           VASHYEVVMPLLEFSKNNPNLKYLFVEWALACSLDQAESIYKAAAERGVQTIISLQGRKSPYILRAKELI
3btsA           ---------FPTLESFASSSTIDMIVIAIQVASHYEVVMPLLEFSKNNPNLKYLFVEWALACSLDQAESI
2cdyC           YDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQLDRVPADKKGALRNNAGGHANH
3cmmA           YVPVN--VLDSLDDVTQLSQFQVVVATDTVSLEDKVKINEFCHSSGIRFISSETRGLFGNTFVDLGDEFT
2aw9B           YDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQLDRVPADK-KGALRNNAGGHAN
1ch6A           DILIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPQADKIFLERNIMVIPDLYLNAGGVTVSQILKNLNH
3dr3A           SPGVDVVFLATAHEVSHDLAPQFLEAGCVVFDLSGAFRVNDATFYEKYYGFTHQYPELLEQAGLAEWCGN
3do5A           KRETGLRDDAKAIEVVRSAD-YDVLIEASVTREGVNYIREALKRGKHVVTSNKGPL-----VAEFHGLSL
3dbrA           DSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPV
3e1kA           ----------------AQYKDIDMIVVSVKVPEHYEVVKNILEHSSQNLNLRYLYVEWALAASVQQAEEL
3dblE           DVSGSFVPENLLDNDPSFFCRFTVVVATQLPESTSLRLADVLWNSQIPLLICRTY-GLVGYMRIIIKEHP
3dbrD           NCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFK
3btuE           VASHYEVVMPLLEFSKNNPNLKYLFVEWALACSLDQAESIYKAAAERGVTIISLQGRKSPYILRAKELIS
3e82A           ASPNATHAPLARLALNAGKHVVVDK---PFTLDQEARELIALAEEKQRLLSVFHNRRWD-SDYLGIRQVI
3dbhE           GSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIKEHPVI
2ejwA           VEAMGGVEAPLRLVLPALEAGIPLITANKALLAEAWESLRPFAEEGLIYHEASVMAGTPALSFLETLRGS
3bioA           --------PFRVVSDIEQLESVDVALVCSPSREVERTALEILKKG-ICTADSFDIH----DGILALRRSL
3btuA           ---LSNATAFPTLESFASSSTIDMIVIAIQVASHYEVVMPLLEFSKNNPNLKYLFVEWALACSLDQAESI
2cdpD           Y------------VNQGDYADYTIAVAQAGNYTISYQAGSGVTGGSIEFLVNENGS-WASKTVTAVPNQG
2czcD           --------FEVAGTLNDLLEKVDIIVDATPGGIGAKNKPLYEKAGVKAIFQGGEKADVAEVSFVAQANYE
1b3bA           DILVPAALEGAIHAGNAERIKAKAVVEGANGPTTPEADEILSRRGILVVPDIL-------ANAGGVTVSY
3db2A           VIITVPNDKHAEVIEQCARSGKHIYVEKPISVSLDHAQRIDQVIKETGVKFLCGHSSRRLGALRKKEIDT
3e18B           ATPNDSHKELAISALEAGKHVVCEKPVTMTSEDLLAIMDVAKR---VNKHFMVHQNRRWDEDFLIIKEMF
2cdpB           GGPVSVYTVNGNTAINYDYADYTIAVAQAGNYTISYQAGSGVTGGSIEFLVNENGSW-ASKTVTAVPNQG
3dbhA           GSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRLADVLWNSQIPLLICRT-YGLVGYMRIIIKEHP
2axqA           VVISLIPYTFHPNVVKSAIRTKTDVVTSSYISPALRELEPEIVKAGITVMNEIGLDPGIDHLYAVKTIDE
3dbhF           NCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIV-PLIDGGTEGF
3dbhB           NCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDG--GTEG
1b6rA           VNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDRLGELAIVKRRTGQWRLRANETEQLPA
3dbrG           GSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPV
2cvoA           VDAVFCLPHGTTQEIIKGLPQELKIVDLSADFRLRDINEYAEWYGHSHRAPELQQEAVY--GLTEVLRNE
2cdpC           GGPVSVYTVNGNTAINYVNADYTIAVAQAGNYTISYQAGSGVTGGSIEFLVNENGSW-ASKTVTAVPNQG
2czcB           IPRFEKEGFEVAGTLNDLLEKVDIIVDATPGGIGAKNKPLYEKAGVKAIFQGGEKA-DVAEVSFVAQANY
3e18A           ATPNDSHKELAISALEAGKHVVCEKPVTMTSEDLLAIMDVAKRV---NKHFMVHQNRRWDEDFLIIKEMF
3dbhG           DVSGSFVEESPENLLDNDPSRFTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRII--IKEH
3btuC           ---------------FASSSTIDMIVIAIQVASHYEVVMPLLEFSKNNPNLKYLFVEWALACSLDQAESI
1b26A           DILVPAALEGAIHAGNAERIKAKAVVEGANGPTTPEADEILSRRGILVVPDILANAGGVTVSYF------
3ceaA           IVAP----TPFHPETIYANAGLNVFCEKPLGLDFNEVDEAKVIKSHPNQIFQSGFRRYDDSYRY-AKKIV
3btvA           ----SNATAFPTLESFASSSTIDMIVIAIQVASHYEVVMPLLEFSKNNPNLKYLFVEWALACSLDQAEKA
1e5lA           VISLIPYTFHATVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVMNEIGLDPGIDHAIKTIEEVHA
1arzA           FDVFIDFTRGTLNHLAFCRQHGKGMVIGTTGFDEA----------GKQAIRDAAA---DIAIVFAA----
3ceaC           ---FIVAPTPFHPETIYANAGLNVFCEKPLGLDFNEVDEAKVIKSHPNQIFQSGFRRYD-DSYRYAKKIV
3db2B           VPN----DKHAEVIEQCARSGKHIYVEKPISVSLDHAQRIDQVIKETGVKFLCGHSSRRLALRKKEIDTK
3bioB           SFDIHDGILALRRSLAAGKSGAAAVIAS-GWDPGSDSVVRTLQAIVGITYTNFGPGSGHTVAVKAIDGVK
3btuB           ----------------ASSSTIDMIVIAIQVASHYEVVMPLLEFSKNNPNLKYLFVEWALACSLDQAESI
2dldA           PDVPANVHMINDKSIAEMKDGVVIVNCSRGRLVDTDAVIRGLDSGKIF------------GFVMDTYEDE
3e82D           ASPNATHAPLARLALNA---GKHVVVDKPFTLDQEARELIALAEEKQRLLSVFHNRRWD-SDYLGIRQVI
2a2pA           ELERIPLSQ-------MTRDEINALVQELGFYRKSAPEAQVPPEYLWAP--AKPPEEASEHD--------
2dc1A           VEAASQQAVKDY-AEKILKAGIDLIVLSTGAFADRDFLSRVREVCRKTGR--------------------
1arzC           FDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIDAAA------------DIAIVFAA----
1dihA           FDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIDAAA------------DIAIVFAAN---
3ed8C           SHNVYATRGTKQKNGIKANFTVRHNVEDGSVQLADHYQQNTP-IGDGPVLL-------------------
2c3gA           ----------------------------------------------------------------------
1bvuA           NEELPSAIEEVITKKNADNIKAKIVAELANGPTTPEADEILYEKGILIIPDFLCNAGG--------VTVS
3cmmC           YVPVNVL--DSLDDVTQLSQFQVVVATDTVSLEDKVKINEFCHSSGIRFISSETRGLFGTFVDLGDEFTV
2c3hD           ----------------------------------------------------------------------
3db2C           VPN----DKHAEVIEQCARSGKHIYVEKPISVSLDHAQRIDQIKETGVKFLCGHSSRRLGALRKKEIDTK
2c3hA           ----------------------------------------------------------------------
3e9mB           PTYNQGHYSAAKLALSQ---GKPVLLEKPFTLNAAEAEELFAIAQEQGVFLEAQ----------------
1b6sA           VNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDRLGELAIVKRRTGGGQWRLRANETEQL
2c3hB           ----------------------------------------------------------------------
3dojA           CAALSVVFDKGGVL-EQICEGKGYIDMSTVDAETSLKINEAITGKGGRFVEGPVSGSKKPAEDGQLIILA
3c1aA           ATPPATHAEITLAAIASGKAVLVEKPLTLD------------LAEAEAVAAAAKATGVVWVEHTQLFNPA
1dapA           MGSATDIPEQAPKFAQFAC-----TVDTYDNHRDIPRHRQVMNEAATA----------------------
2duwA           SEA------AWGVAQEAIAIGAKTLWLQLGVINEQAAVL----AREAGLSVVMD----------------
3btsB           --KLSNATAFPTLESFASSSTIDMIVIAIQVASHYEVVMPLLEFSKNNPNLKYLFVEWALACSLDQAESI
3ec7A           ----------------------------------------------------------------------
3e1kC           ---KHATGFDSLESF-AQYKDIDMIVVSVKVPEHYEVVKNILEHSSQNLNLRYLYVEWALAASVQLYSIS
2bh9A           YQRLNSHM----NALHLGSQANRLFYLALPPTVYEAVTKNIHESCMNRIIVEKP----------------
2bhlA           YQRLNSHM----NALHLGSQANRLFYLALPPTVYEAVTKNIHESCWNRIIVEKPF---GRDLQSSDRLSN
1e7mA           EEAADKFD----------IDGNRIFYMSVAPRFFGTIAKYLKSEG-------------------------
1e77A           SYAVLKEAIEEAADK-FDIDGNRIFYMSVAPRFFGTIAKYLKSEGLNRLMIEKP----------------
3e82E           SPN----ATHAPLARLALNAGKHVVVDKPFTLDQEARELIALAEEKQRLLSVFHNRRWD-SDYLGIRQVI
3dtyB           YLSFEQEARRAD--------GIQAVSIATPNGTHYSITKAALEAG-LHVVCEKP----------------
3d1lB           SLKDSAFAELLQGIVEGKREEALVHTAGSIPNVWEGHVPHYGVFYPQTFSKQREVDFKEIPFFIEASSTE
3dtyD           YLSFEQEARRAD--------GIQAVSIATPNGTHYSITKAALEAG-LHVVCEKP----------------
2d5aA           PKLTMEYVEQA------IKKGAKVVWFQYNTYN-REASKKADEAG-------------------------
1dpgA           AVLKEAIEEAADK---FDIDGNRIFYMSVAPRFFGTIAKYLKSEG-------------------------
2e77A           NHGAEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPV---------------


                         +         .         .         .         .         *         .:210
query           YDPANHHILSNASCTTNCVAPMAKTLMENFGIVKGLMTTVHAYTNDQVILDYPHKDLRRARAAAQNIIPT
1cerO           YDPSRHHIISNASCTTNSLAPVMKVLEEAFGVEKALMTTVHSYTNDQRLLDLPHKDLRRARAAAINIIPT
3dbvO           YDPKAHHVISNASCTTNCLAPFAKVLHEQFGIVRGMMTTVHSYTNDQRILDASHKDLRRARAAAESIIPT
3cifA           YDPSKFNVISNASSTTNCLAPLAKIINDKFGIVEGLMTTVHSLTANQLTVDGPGKDWRAGRCAGNNIIPA
3docA           LTK-DHLVISNASCTTNCLAPVAQVLNDTIGIEKGFMTTIHSYTGDQPTLDTMHKDLYRARAAALSMIPT
1crwG           YSK-DMKVVSNASCTTNCLAPVAKVLHENFEIVEGLMTTVHAVTATQKTVDPSAKDWRGGRGAAQNIIPS
1a7kA           YSPASHHVVSNASCTTNCLAPIVHVLTKNFGIETGLMTTIHSYTATQKTVDGVLKDWRGGRAAAVNIIPS
3e6aA           YTS-DIDIVSNASCTTNCLAPLAKVIHDNFGIIEGLMTTVHAITATQKTVDGPSKDWRGGRAASFNIIPS
1dssG           YS--KDMKVVSNASTTNCLAPVAKVLHENFEIVEGLMTTVHAVTATQKTVDGPAKDWRGGRGAAQNIIPS
2b4rO           YDT-KQLIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHASTANQLVVDGPSKGGKDWRCALSNIIPA
3docD           LTK-DHLVISNASCTTNCLAPVAQVLNDTIGIEKGFMTTIHSYTGDQPTLDTMHKDLYRARAAALSMIPT
3e6aO           YTS-DIDIVSNASCTTNCLAPLAKVIHDNFGIIEGLMTTVHAITATQKTVDGPSKDWRGGRAASFNIIPS
3e5rO           YTS-DIDIVSNASCTTNCLAPLAKVIHDNFGIIEGLMTTVHAITATQKTVDGPSKDWRGGRAASFNIIPS
3dmtC           YNP-SEHHVVSNASTTNCLAPIVVLVKEGFGVQTGLMTTIHSYTATQKTVDGVSKDWRGGRAAAVNIIPS
1dbvO           YDPKAHHVISNASCTTNCLAPFAKVLHEQFGIVRGMMTTVHSYTNDQRILDASHKDLRRARAAAESIIPT
2d2iA           YRHEDFAVISNASCTTNCLAPVAKVLHDNFGIIKGTMTTTHSYTLDQRILDASHRDLRRARAAAVNIVPT
1dc4A           YAG--QDIVSNASCTTNCLAPLAKVINDNFGIIEG-LTTVHATTATQTVDGPSHKDWRGGRGASQNIIPS
2b4tO           YDT-KQLIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHASTANQLVVDGPSKGGKDWRCALSNIIPA
3cpsB           YDPSKFNVISNASCTTNCLAPLAKIINDKFGIVEGLMTTVHSLTANQLTVDGPSKDWRAGRCAGNNIIPA
3cpsA           YDPSKFNVISNASCTTNCLAPLAKIINDKFGIVEGLMTTVHSLTANQLTVDGPKGDWRAGRCAGNNIIPA
2duuA           YRHEDFAVISNASCTTNCLAPVAKVLHDNFGIIKGTMTTTHSYARAA----------------AVNIVPT
1cf2P           ESY-GKDYTRVVSCNTTGLCRTLKPLHDSFGIKKVRAVIVRRGADPAQVSKGPINAIIPNPKLPSHHGPD
1b7gO           AL--GKKYIRVVSCNTTALLRTICTVNKVSKVEKVRATIVRRAVPDPATVPSHHAIRNLDIATMAVIAPT
1brmB           ITDNGIRTFVGGNCTVSLMLMSLGGLFANDLVDWVSVATYQAASGGGHLYGHVADELATPSSARSGELPV
3c8mA           YA-RSNNRRIRYEATVAGGVPLFSFIDYSVLPSRIKKFRGIVSLTINYFIRELAREFDDVLSEATKLGIV
1brmC           ITDNGIRTFVGGNCTVSLMLMSLGGLFANDLVDWVSVATYQAASGGGARHMILDIERKVTTLTRSGELPV
1e0uA           ILE-ASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRALKVVITATMMLDSMIKNPRPTRAEAGDVANA
1brmA           ITDNGIRTFVGGNCTVSLMLMSLGGLFANDLVDWVSVATYQAASGGGHLYGHVADELATPSSARSGELPV
3dblB           KGN-ARVILPGMTACIECTLYPPQVNFPMATIASMPRLPEHCIEYVRMLQWPKEPFGEGVPLDGDDPEHI
3dtyA           RVH-QFAHGFHSAGPSYVLGDVGTHPLYLSEVLPDLKIKRLCSRQSFVASRAPLEDTLEYEGGAGVWSSA
2czcA           AAL-GKNYVRVVSCNTTGLVRTLSAIREYADYVYAVMIRRAADPNDT------------KRGPINAIKPT
3dbrE           IESH-PDNALEDLRLDKPFPELRE--HFQSYDLHTPWIVIIAKYLAQWYSETNGRIPKT-----------
3e9mD           QEGG-LGEILWVQSVTAYPNVDHIPWFYSREAGGGALHGSGSYPLQYLQYVLIQEVTGTATYQQGATDSQ
3dblF           G--NARVILPGMTACIECTLYPPQVNFPMATIASMPRLPEHCIEYVRMLQWPKEPFGEGVPLDGDDQKSL
3dbrB           KGN-AQVILPGMTACIECTLELYPPQNFPMATIASMPRLPEHCIEYVRMLQWPKEQPFGEVPLDGDDPEH
2cvoD           IRNARLVANPGCYPTSIQLPLVPLIKAKLIKVSNIIIDAKSGVSGAG----RGAKEANLYTEIAEGIHAY
3btvB           SQGYIGDINSIEIAGNGGWYGYERPVKSPKYIYEIGNGFGHTIDILQYMTSSYFSRI---NAMVFNNIPE
3btsA           YKA--AAERGVQTIISLQGRKSPYILRAKELISQGYIGDINSIEIAGNGGWYGYERPVKSP-------KY
2cdyC           SMFWQIMG-QGQNGANQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVVKDVVSTANQDNPL
3cmmA           VLD-PTGEEPRTGMVSDI--EPDGTVTMLDDNRHGLEDGNFVRFSEVEGLDKLNDGTLFKVEVLKEYGEY
2aw9B           HSM-FWQIMGQGQGANQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVVKDVVSTANQDNPL
1ch6A           VSYGRLTFKYERDSNYHLLMSVQESLERKFGKHGGTIPIVPTAEFQDRISGASEKDIVH-----SGLAYT
3dr3A           K-LKEANLIAVPGCYPTAAQLALKPLIDADLLDLNQWPVINATSGVS---GAGRKAAISNSFCEVSLQPY
3do5A           AE-RNGVRLYEATVGGAPVVKLAKRYLCEIESVKGIFNGTADPSYDVEGIDAALKLVIIANTIGVKASYE
3dbrA           IE--SHPDNALEDLRLDKPFPELREHFQSYDDHSHTPWIVIIAKYLAQWYSETNGRIPKTY---------
3e1kA           YSISRANLQTIICLQGRKSPYIVRAKELISEGCIGDINSIEIGNGGWYGYERPMRSPEYLYDIESGVNLI
3dblE           VIESHPDNALE-DLRLDKPFPELREHFQSYDLDHEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKEK
3dbrD           GNAQVILPGMTACIECTLELYPPQVNFPMATIASMPRLPEHCIEYVRMLQWPKEPFGEGVPLDGDDPEHI
3btuE           QGYIGDINSIEIAGNGGWYGYERPVKSPKYIYEIGNGTTTFGHTIDI-LQYMTSSYFSRINAMVFNNIPE
3e82A           EQGTLGAVKHFESHFDRFRPEVSGLGPHLIDQALQLFGLPQSVQGNIATLRDGAEINDWAHVAHKVILHC
3dbhE           ESHPDNALEDLRLDKPFPELREHFQSYDLDHEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKEKEDF
2ejwA           ELLELHGILNGTTLYILQEMEKGRTYAEALLEAQRLGYAEADPTLDVEGIDAAHPFAEVEAQGIARLTPE
3bioA           GDAAGKS--GAAAVIASGWDPGSDSVVRTLQAIVPKGITYTNFGPGSGHTVAVKAIDGV-KAALSTIPLG
3btuA           YAERGVQTIISLQGRKSPYILRAKELISQGYIGDINSIEIAGNGGWYGYERPVKSPKYIYEIGNGVDLVT
2cdpD           WDNFQP-----LNGGSVYLSAGTHQVRLHGAGSNNWQWNLDKFT--------------------------
2czcD           AA-LGKNYVRVVSCNTTGLVRTLSAIREYADYVYAVMIRRAADPNDTKRGPINA------------IKPT
1b3bA           FEW-VQDLQSFFWDLDQVRNALEKMMKKAFNDVYNVDMRTAAYILAIDRVAYATKK--------------
3db2A           KEI-GEVSSIEAVFSNERGLELKKGNWRGEPATAPGGPLTQLGVHQIDNLQFLLGPVARVFNFGKPYTEV
3e18B           EQK-TIGEMFHLESRVHGANGIPGDWRHLKAHGGGMVLDWGVHLLLFLVDSNVKSVSANLSFALGDEVDD
2cdpB           WD--NFQPLNGGSVYLSAGTHQVRLHNWQWNLDKFTLS--------------------------------
3dbhA           VIE-SHPDNALEDLRLDKPFPELREHFQSYDLDHMKDHSHTPWIVIIAKYLAQWSETNGRIPKTYKEKED
2axqA           VHRAGGKLKSFLSYCGGLPAPEDSDNPLGYKFSWSSRGVLLALRNSA----KYWKDGKIETVSSEDLMAT
3dbhF           KGN-AAVILPGMTACIECTLELYPPQFPMATIASMPRLPEHCIEYVRMLQWPKEQPFGEGVIQWIFQKSL
3dbhB           FKGNAAVILPGMTACIECTLELYQVNFPMATIASMPRLPEHCIEYVRMLQWPKEQFGEGVPLDGDDPE--
1b6rA           ECYGECIV--EQGINFSGEVSLVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQARAEEMLSA
3dbrG           IESHPDNA-LEDLRLDKPFPELREHFQSYTPWIVIIAKYLAQWYSETNGRIPKT----------------
2cvoA           IRN--ARLVANPGCYPTSIQLPLVPLIKAKLIKVSNIIIDAKSGVSGAG--RGAKEANLYTEIAEGIHAY
2cdpC           WD--NFQPLNGGSVYLSAGTHQVRLHGAGWNLDKFTLS--------------------------------
2czcB           EAALGKNYVRVVSCNTTGLVRTLSAIREYADYVYAVMIRRAADPNDTKRGPINA------------IKPT
3e18A           EQK-TIGEMFHLESRVHGANGIPGDWRHLKAHGGGMVLDWGVHLLDQLVDSNVKSVSANLSFALGDEVDD
3dbhG           PVIESHPDNALEDLRLDKPFPELREHFQSYDLDHDHSHTPWIVIIAKYLAQWYSRIPKTYKEKEDFRDLI
3btuC           YKAAGVQTIISLQGRKSPYILRAKELISQGYIGDINSIEIAGNGGWYGYERPVKSPKYIYEIGNGVDLVT
1b26A           --EWVQDLQSFFWDLDQVRNALEKMMKGAFNDVYNVDMRTAAYILAIDRVA----YATKKR---------
3ceaA           DNGDIGKIIYRGYGIDPISGESFTKFATEADSGGIFVDNIHDIDLIRWFTGQDPVQAYGLTSNIAAPQLA
3btvA           AAERGVQTIISLQGRKSPYILRAKELISQGYIGDINSIEIAGNGGWYGYERPVKSPKYIYEIGNGVDLVT
1e5lA           AGGKIKTFLSYCGGLPAPESSDNPLGYKFSWSSRGVLLALRNAASFYKDGKVTNVAGPELMATAKPYFIY
1arzA           ------NFSVGVNVMLKLLEKAAKVMGDYT------DIEIIEAHHRHKVDAPSGTALAMGEAIAHALDKD
3ceaC           DNGDIGKIIYRGYGIDPISGESFTKFATEADSGGIFVDNIHDIDLIRWFTGQDPVQAYGLTSNIAAPQLA
3db2B           EIGEVSSIEAVFSNERGLELKKGNWRGEPATAPGGPLTQLQFLLGPVARVFNFGPYTEVENITVNQTLLE
3bioB           AAL-STIPLGTGVHRRVYVELLPGHNLEEVSADETHVIQVDEVDALIDGHKGVSGSTQNQRSFDEINNPA
3btuB           YKAAGVQTIISLQGRKSPYILRAKELISQGYIGDINSIEIAGNGGWYGYERPVKSPKYIYEINGVDLVTT
2dldA           VGV-FNKDWEGKEFPDKRLADLID--------RPNVLVTPHTAFYTT------HAVRNMVVKAFNNNLKL
3e82D           EQG-TLGAVKHFESHFDRFRPEVRVRWREGSGL-WFDLGPHLIDQALQLFGLPQSVQGNIATLRDGAEIN
2a2pA           ----------------------------------------------------------------------
2dc1A           ----RVYIASGAIGGLDAIFSASELIEEIVLTTRKNWRQFGRKGV---IFEGSASEAAQKFPKNLNVAAT
1arzC           ------NFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDA------PSGTALAMGEAIAHALDKD
1dihA           -------FSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPS------GTALAMGEAIAHALDKD
3ed8C           ----------------------------------------------------------------------
2c3gA           ----------------------------------------------------------------------
1bvuA           YFEWVQNITGDYWTVEETRAKLDKKMTKAFWDVYNINMRDAAYVVAVSVYQAMKDWIKK-----------
3cmmC           LDPTGEEPRT--GMVSDI--EPDGTVTMLDDNRHGLEDGNFVRFSEVEGLDKLNDGTLF-----------
2c3hD           ----------------------------------------------------------------------
3db2C           EIGEVSSIEAVFSNERGLELKKGNWRGEPATAPGGPLTQLGVHQIDNL----------------------
2c3hA           ----------------------------------------------------------------------
3e9mB           ----------------------------------------------------------------------
1b6sA           PAECYGECI-------------------------------------------------------------
2c3hB           ----------------------------------------------------------------------
3dojA           AGDKALFE-ESIPAFDVLGKRSFYLGQVGNGAKMKLIVNMIMGSMMNAF---------------------
3c1aA           WEALKADLVRSEAGNHGPYRPGGVPLWDWG----------------------------------------
1dapA           ----------------------------------------------------------------------
2duwA           ----------------------------------------------------------------------
3btsB           YKAAAERGVQTIISLQGRKSPYILRAKEYIGDINSIEIAGNGGWYGYE--RPVKSPKYIYEIGNGVDLVT
3ec7A           ----------------------------------------------------------------------
3e1kC           QQRANLQTIICLQGRKSPYIVRAKELISEGCIGDINSIEISGNGGWYGYERPMRSPEYLYDIE-------
2bh9A           ----------------------------------------------------------------------
2bhlA           HISSLFREDQIYRIDHYLGKMVQNLMVLRFAN--RIFGPIWNRDNIACVILTFKEPFG------------
1e7mA           ----------------------------------------------------------------------
1e77A           ----------------------------------------------------------------------
3e82E           EQGT-LGAVKHFESHFDRFRPESGLWFDLIDQALQLFGLPQSVQ--------------------------
3dtyB           ----------------------------------------------------------------------
3d1lB           DAAFLKAIASTLSNRVYDADSEQRKSLHLAAVFTC-----------------------------------
3dtyD           ----------------------------------------------------------------------
2d5aA           ----------------------------------------------------------------------
1dpgA           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TTGAAKATALVLPELKGKLDGLAMRVPVPDGSVTDLVVTLEREVTXXXXXXXXXXXXXXXXXDILVYTED
1cerO           TTGAAKATALVLPSLKGRFDGMALRVPTATGSISDITALLKREVTAEEVNAALKAAAEGPLKGILAYTED
3dbvO           TTGAAKAVALVLPELKGKLNGMAMRVPTPNVSVVDLVAELEKEVTVEEVNAALKAAAEGELKGILAYSEE
3cifA           STGAAKAVGKVIPALNGKLTGMAIRVPTPDVSVVDLTCKLAKPASIEEIYQAVKEASNGPMKGIMGYTSD
3docA           STGAAKAVGLVLPELKGKLDGVAIRVPTPNVSVVDLTFIAKRETTVEEVNNAIREAANGRLKGILGYTDE
1crwG           STGAAKAVGKVIPELDGKLTGMAFRVPTPNVSVVDLTVRLGKECSYDDIKAAMKAASEGPLQGVLGYTED
1a7kA           TTGAAKAVGMVIPSTKGKLTGMSFRVPTPDVSVVDLTFRATRDTSIQEIDKAIKKAAQTYMKGILGFTDE
3e6aA           STGAAKAVGKVLPDLNGKLTGMSFRVPTVDVSVVDLTVRIEKAASYDAIKSAIKSASEGKLKGIIGYVEE
1dssG           STGAAKAVGKVIPELDGKLTGMAFRVPTPNVSVVDLTVRLGKECSYDDIKAAMKAASEGPLQGVLGYTED
2b4rO           STGAAKAVGKVLPELNGKLTGVAFRVPIGTVSVVDLVCRLQKPAKYEEVALEIKKAAEGPLKGILGYTED
3docD           STGAAKAVGLVLPELKGKLDGVAIRVPTPNVSVVDLTFIAKRETTVEEVNNAIREAANGRLKGILGYTDE
3e6aO           STGAAKAVGKVLPDLNGKLTGMSFRVPTVDVSVVDLTVRIEKAASYDAIKSAIKSASEGKLKGIIGYVEE
3e5rO           STGAAKAVGKVLPDLNGKLTGMSFRVPTVDVSVVDLTVRIEKAASYDAIKSAIKSASEGKLKGIIGYVEE
3dmtC           TTGAAKAVGMVIPSTQGKLTGMSFRVPTPDVSVVDLTFTAARDTSIQEIDAALKRASKTYMKGILGYTDE
1dbvO           TTGAAKAVALVLPELKGKLNGMAMRVPTPNVSVVDLVAELEKEVTVEEVNAALKAAAEGELKGILAYSEE
2d2iA           TTGAAKAVALVIPELKGKLNGIALRVPTPNVSVVDLVVQVEKPTITEQVNEVLQKASQTTMKGIIKYSDL
1dc4A           STGAAKAVGKVLPELNGKLTG-AFRVPTPNVSVVDLTVRLEKAATYEQIKAAVKAAAEGEKGVLG-YTED
2b4tO           STGAAKAVGKVLPELNGKLTGVAFRVPIGTVSVVDLVCRLQKPAKYEEVALEIKKAAEGPLKGILGYTED
3cpsB           STGAAKAVGKVIPALNGKLTGMAIRVPTPDVSVVDLTCKLAKPASIEEIYQAVKEASNGPMKGIMGYTSD
3cpsA           STGAAKAVGKVIPALNGKLTGMAIRVPTPDVSVVDLTCKLAKPASIEEIYQAVKEASNGPMKGIMGYTSD
2duuA           TTGAAKAVALVIPELKGKLNGIALRVPTPNVSVVDLVVQVEKPTITEQVNEVLQKASQTTMKGIIKYSDL
1cf2P           ----------VKTVLDINIDTMAVIVPTTLMHQHNVMVEVEETPT----VDDIIDVFEDTPRVILISAED
1b7gO           TLMHMHFINITLKDKVEKKDILSVLENTPRIVLISSKYDAEATAE-LVEVARDLKRDRNDIPEVMIFSDS
1brmB           DNFGVPLNKILNTSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHNPWAKVVPNDREIT
3c8mA           EKNYKDDLTGLDA--ARKSVILCNHLYGSSYRLSDVFYEGILQDRFGKNERLVTETGIVNGKPSAESRIK
1brmC           DNFGVPLAGSLIPWIDKPVDGLCVRVGALRCHSQAFTIKLKKDVSPTVEELLAAHNPWAKVVPNDREITM
1e0uA           ILDGTDAVMLSGESAKGKYPLEAVSIMATICERTDRVMNSRLEITEAVCRGAVETAEKLDAPLIVVATQG
1brmA           DNFGVPLAGSLIPWIDWKGDGLCVRVGALRCHSQAFTIKLKKDVSPTVEELLAAHNPWAKVVPNDREITM
3dblB           QWIFQKSLQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATE----VFKIATSAYIPLNNYLVFNDV
3dtyA           VNAGSHGQKIRVIGSRASLEWWDERPNQLSFEVQGQPAQILERGG---------YLHPNALIDDRIGGGH
2czcA           VEVPSHHGPDVQTVIPINIETMAFVVPTTLMHVHSVMVELKKPLTKDDVIDIFENTTRVLLFEKEKGFDS
3dbrE           ----------------------------------------------------------------------
3e9mD           CNLALKFAEGTLGNIFINVGLKIPSETICKGQIVIPNFWKTDCAYYTDAQGNTVKWSEQFTSEFTYEINH
3dblF           ERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKI--------ATSAYIPLNNYLVFNDV
3dbrB           IQWIFQKSLESQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAA-VCATEVFKIATSAYIPLNNYLVFNDV
2cvoD           GIKGHRHVPEIEQGLSEAISFTPNLICMKRGMQSTMFVEMAPGVTANDLYQHLKSTYEGEEFVKLLNGSS
3btvB           QELIDERGNRLGQRVPKTVPDHLFQGTLLNGNVPVSCSFKGGKKF-----TKNLVIDIHGTKRDLKLEGD
3btsA           IYEIGNGVDLVTTTFGHTIDILQYMTSSYFSRINAMVFNNIPEQE--LIDERGNRLGQRVPKTVPDHLLF
2cdyC           MGEAIAGVSGTPILGVYYLNYQNRRPDYLAANVVNWDEVSKR----------------------------
3cmmA           KKGGIFTEVKVPRKISFKSLKQQLSNPEFVFSDFAKFDRAAQLHLGFQALHQFAVRHNGELPRTMNDEDA
2aw9B           MGEAIAGVSGTPILGVDVWEH-AYYLNYQNRRP-DYLAAFWNVVN-------------------------
1ch6A           MERSARQIMRTAMKYNLG---LDLRTAAYVNAIEKVFRVYNEAGV-------------------------
3dr3A           GVFTHRHQPEIATHLGADVIFTPHLGNFPRGILETITCRLKSGVTQAQVAQALQQAYAHKPL-VRLYDKG
3do5A           DVEVTGITQITPEAFQGYTIRLIAEVSREKLKVSPRLVPFHHPLTNAAFKTDTAGSIFVAGRGAGKEETA
3dbrA           ----------------------------------------------------------------------
3e1kA           SNSFGHTIDVLQYITGSYFQKINAMISNNIPTQFLLDENGKRTKETISKTCPDHLLFQGILENKVPVSCS
3dblE           ED--------------------------------------------------------------------
3dbrD           QWIFQKS---------------------------------------------------------------
3btuE           QELIDERGNRLGQRVPKTVDHLLFQGTLLNGNVPVSCS--------------------------------
3e82A           SLVAGGSSRFTVHGDKGSVIKARADQQESQLLAGVVPGSADWGQD-------------------------
3dbhE           RDLIRQGILKPEDEENFEEAIKNVNTALNT----------------------------------------
2ejwA           VLQKAEARGERVR-----LVASLFGEGGRWRAAVAPRRLPQDHPL-------------------------
3bioA           TGVHRRVYVELLPGHNLEEVS--AAIKADEYFVHDETHVIQVDEVDALIDGHGVRVRKG----VSGSTQN
3btuA           TTFGHTIDILMTSSYFSRINAMVFNNIPEQELIDERGNR-------------------------------
2cdpD           ----------------------------------------------------------------------
2czcD           VEVPSHHGPDVQTVIPINIETMAFVVPTTLMHVHSVMVELKKPLTKDDVIDIFENTTRVLLFEKEKGFDS
1b3bA           ----------------------------------------------------------------------
3db2A           ENITVNQTLLEFENVYGTKANLFYQLDFSWWSNSDVTDEHSTLIK-------------------------
3e18B           GFVTNGITAQIEVGTTNFIKLPRWYVKGTEGTGIIHDWDLSGEIVPPSEEATNTLSLPAPAKLAPSFYNN
2cdpB           ----------------------------------------------------------------------
3dbhA           FRD-------------------------------------------------------------------
2axqA           AKPYFIYPGYAFV-CYPNRDSTLFKDLYHIPEAETVIRGTLRY-QGFPEFVKALVDMGMLKDDANEIFSK
3dbhF           ERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVF---------------------------
3dbhB           ----------------------------------------------------------------------
1b6rA           IMQELGYVGVMAMEC--FVTPQGLLINELAPRVHNSGHWTQN--------GASISQFELHLRAITDLPLP
3dbrG           ----------------------------------------------------------------------
2cvoA           GIKGHRHVPEIEQGLSEAAESKPNLICMKRGMQSTMFVEMAPGVTANDLYQHLKSTYEGEEFVKLLNGSS
2cdpC           ----------------------------------------------------------------------
2czcB           VEVPSHHGPDVQTVIPINIETMAFVVPTTLMHVHSVMVELKKPLTKDDVIDIFENTTRVLLFEKEKGFDS
3e18A           GFVT------------------------------------------------------------------
3dbhG           RQGILK----------------------------------------------------------------
3btuC           TTFGHTIDIL------------------------------------------------------------
1b26A           ----------------------------------------------------------------------
3ceaA           DIGEFETGVAQLKS--------------------------------------------------------
3btvA           TTFGH-TIDILQYMTSSYFSRINAMVFNNIPEQELIDERGNRLG--------------------------
1e5lA           PGFA------------------------------------------------------------------
1arzA           LKDCAVYSREGHERVPGTIGFATVRAGDIVGEHTAMFADIGERLE-----------ITHKASSRMTFANG
3ceaC           DIGEFETGVAQL----------------------------------------------------------
3db2B           FEDGKQAYLGTNWACPGVFS--------------------------------------------------
3bioB           LTGQVLCAARAARQQPGAYT--LQEIPVIDLLPGDREQWIGK----------------------------
3btuB           TFGHTIDILQYMSRINAMVFNNIPEQELIDERGNRLGQRVPKTV--------------------------
2dldA           ING--EKPDSPVALNKNK----------------------------------------------------
3e82D           DWAHV-----------------------------------------------------------------
2a2pA           ----------------------------------------------------------------------
2dc1A           LSIAGKDVKVRLVADEVEENIHEILVRGEFGEMENRPMRENPKT--------------------------
1arzC           LKDCAVYSREGGERVPGTIGFATVRAGDIVGEHTAMFADIGERLE-----------ITHKASSRMTFANG
1dihA           LKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGER---------LEITHKASSRMTFANG
3ed8C           ----------------------------------------------------------------------
2c3gA           -------------------------------MASGLTIYFKKPDSWGTPHLYYYDTNPKVDEPEMEHYEG
1bvuA           ----------------------------------------------------------------------
3cmmC           ----------------------------------------------------------------------
2c3hD           -----------------------------------LTIYFKKPDSWGTPHLYYYDTNPKVDEPEMEHYEG
3db2C           ----------------------------------------------------------------------
2c3hA           ---------------------------------SGLTIYFKKPDSWGTPHLYYYDTNPKVDEPEMEHYEG
3e9mB           ----------------------------------------------------------------------
1b6sA           ----------------------------------------------------------------------
2c3hB           ---------------------------------SGLTIYFKKPDSWGTPHLYYYDTNPKVDEPEMEHYEG
3dojA           ----------------------------------------------------------------------
3c1aA           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
2duwA           ----------------------------------------------------------------------
3btsB           TTFGHTI-DILQYMTSSYFSRINAMVFN------------------------------------------
3ec7A           ----------------------------------------------------------------------
3e1kC           ----------------------------------------------------------------------
2bh9A           ----------------------------------------------------------------------
2bhlA           ----------------------------------------------------------------------
1e7mA           ----------------------------------------------------------------------
1e77A           ----------------------------------------------------------------------
3e82E           ----------------------------------------------------------------------
3dtyB           ----------------------------------------------------------------------
3d1lB           ----------------------------------------------------------------------
3dtyD           ----------------------------------------------------------------------
2d5aA           ----------------------------------------------------------------------
1dpgA           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           PIVSSDIVGTPASCTFDASLTMAFGTQVKVVGWYDNEWGYSNRLVDLVKLVGSNL
1cerO           EIVLQDIVMDPHSSIVDAKLTKALGNMVKVFAWYDNEWGYANRVADLVELVLR--
3dbvO           PLVSRDYNGSTVSSTIDALSTMVDGKMVKVVSWYDNETGYSHRVVDLAAYIAS--
3cifA           DVVSTDFIGCKYSSILDKNACIANDSFVKLISWYDNESGYSNRLVDLAVYVAS--
3docA           KLVSHDFNHDSHSSVFHTDQTKVDGTMVRILSWYDNEWGFSSRMSDTAVALGKLI
1crwG           DVVSCDFTGDNRSSIFDAKAGIQLKTFVKVVSWYDNEFGYSQRVIDLIKHMQK--
1a7kA           ELVSADFINDNRSSVYDSKATLQNKRFFKVVSWYDNEWAYSHRVVDLVRYMAA--
3e6aA           DLVSTDFVGDSRSSIFDAKAGIANDNFVKLVAWYDNEWGYSNRVIDLIRHMA---
1dssG           DVVSCDFTGDNRSSIFDAKAGIQSKTFVKVVSWYDNEFGYSQRVIDLIKHMQK--
2b4rO           EVVSQDFVHDNRSSIFDMKAGLANDNFFKLVSWYDNEWGYSNRVLDLAVHITT--
3docD           KLVSHDFNHDSHSSVFHTDQTKVMGTMVRILSWYDNEWGFSSRMSDTAVALGKLI
3e6aO           DLVSTDFVGDSRSSIFDAKAGIANDNFVKLVAWYDNEWGYSNRVIDLIRHMA---
3e5rO           DLVSTDFVGDSRSSIFDAKAGIALNDNVKLVAWYDNEWGYSNRVIDLIRHMAK--
3dmtC           ELVSADFINDNRSSIYDSKATLQERRFFKIVSWYDNEWGYSHRVVDLVRHMAS--
1dbvO           PLVSRDYNGSTVSSTIDALSTMVDGKMVKVVSWYDNETGYSHRVVDLAAYIAS--
2d2iA           PLVSSDFRGTDESSIVDSSLTLVMGDLVKVIAWYDNEWGYSQRVVDLAELAAR--
1dc4A           DVVSTDFNGEVCTSVFDAKAGIANDNFVKLVSWYDNETGYSNKVLDLI-------
2b4tO           EVVSQDFVHDNRSSIFDMKAGLANDNFFKLVSWYDNEWGYSNRVLDLAVHITT--
3cpsB           DVVSTDFIGCKYSSIFDKNACIALNDSVKLISWYDNESGYSNRLVDLAVYVAS--
3cpsA           DVVSTDFIGCKYSSIFDKNACIALNDSVKLISWYDNESGYSNRLVDLAVYVAS--
2duuA           PLVSSDFRGTDESSIVDSSLTLVMGDLVKVIAWYDNEWGYSQRVVDLAELAAR--
1cf2P           GLTSTAEIMEYAKELGRSRNDLFEIPVRESITVVDNEIYYMQAVHQESDIVPEN-
1b7gO           IYVKDDEVMLMYAVHQESIVVPENIAIRASMKLMSAEDSMTNESLGIL-------
1brmB           MRELTPAVTGTLTTPVGRLRKLNGPEFLSAFTVGDQLWGAAEPLRRMLRQL----
3c8mA           SLDSND----YLLTLGKGSLGYQLTDTNGTLNVSDLYDGTAGAVNDLVIL-----
1brmC           RELTPAAVTGTLTTPVGRLRKLNGPEFLSAFTVGDQLWGAAEPLRRMLRQL----
1e0uA           GKSARAVRKYFPDATILALTTNEKGVVPQLVKEITSTDDFYRLGKELAL------
1brmA           RELTPAAVTGTLTTPVGRLRKLNGPEFLSAFTVGDQLWGAAEPLRRMLRQL----
3dblB           DGLYTYTFEAERKENCPACSQLPQIQFSPSAKLQEVLDYLTNSASLQMKSPA---
3dtyA           PEGLFEAWANLYYRFALADATRSDTQALSAVRYPGIDAGVEGRWVERCV------
2czcA           TAQIIEFARDLHREWNNLESINIKGNRLFYIQAVHQESDVIPENIDA--------
3dbrE           -------------------------------------------------------
3e9mD           VNQCLQDKKLTSPVTKELTIATVKIVESFYQEWFDN-------------------
3dblF           DGLYTYTFEAERKCPACSQLPQNI---QFSPSAKLQELDYLTNSASL--------
3dbrB           DGLYTYTFEAERK--ENCPACSQLPQNIQFSPSAKLQEVLDYLTNSAS-------
2cvoD           VPHTRHVVGSNYCFMNVFEDRI--PGRAIIISVIDNVKGASGQAVQNLNL-----
3btvB           EISNLVLYYSGYDAGKEIMEVYHLRNYNAIVGNIHRLYQS---------------
3btsA           QGTLLNGNVPVSCSFKGGKKNLVIIHGTKRDLKLEGDAEISNLVLY---------
2cdyC           -------------------------------------------------------
3cmmA           NELIKLVTDLSVQQPEVLGEGVDVEDLIKELSYQARGDIPGVV------------
2aw9B           -------------------------------------------------------
1ch6A           -------------------------------------------------------
3dr3A           VPALKNVVGLPFCDIGF----AVQGEHLIIVATEDNLKGAAAQAVQCANIRFG--
3do5A           SAILSDLYEIY--------------------------------------------
3dbrA           -------------------------------------------------------
3e1kA           FKGGTPVKKLTKNLVIDIHGTKIEGDAGFVEISNLVLYFYGIKNGEEQTM-----
3dblE           -------------------------------------------------------
3dbrD           -------------------------------------------------------
3btuE           -------------------------------------------------------
3e82A           -------------------------------------------------------
3dbhE           -------------------------------------------------------
2ejwA           -------------------------------------------------------
3bioA           QRSFDEINNPALTGQVLVCAARAARQQPGAYTLQEIPVIDL--------------
3btuA           -------------------------------------------------------
2cdpD           -------------------------------------------------------
2czcD           TAQIIEFARDLHREWNNLYEIAVKGNRLFYIQAVHQESDVI--------------
1b3bA           -------------------------------------------------------
3db2A           -------------------------------------------------------
3e18B           FVDVLNNTSEPIVQNEEVYQVLKLIEAI-FEAAETNRT-----------------
2cdpB           -------------------------------------------------------
3dbhA           -------------------------------------------------------
2axqA           PIAWNEALKQYLGAKSTSKEDLSIDSKATWKDDEDRERILSGFAWL---------
3dbhF           -------------------------------------------------------
3dbhB           -------------------------------------------------------
1b6rA           QPVVNNPSVM--INLIGSDVNYDWKLPLVHLHWYDKEVRPGRKVGHLN-------
3dbrG           -------------------------------------------------------
2cvoA           VPHTRHVVGSNYCFMNVF--EDRIPGRAIIISVIDNVKGASGQAVQNLNLMMG--
2cdpC           -------------------------------------------------------
2czcB           TAQIIEFARDLHREWNNLYEIAVKGNRLFYIQAVHQESDVIPENIDA--------
3e18A           -------------------------------------------------------
3dbhG           -------------------------------------------------------
3btuC           -------------------------------------------------------
1b26A           -------------------------------------------------------
3ceaA           -------------------------------------------------------
3btvA           -------------------------------------------------------
1e5lA           -------------------------------------------------------
1arzA           AVRSALWLSGKESGLFDM-------------------------------------
3ceaC           -------------------------------------------------------
3db2B           -------------------------------------------------------
3bioB           -------------------------------------------------------
3btuB           -------------------------------------------------------
2dldA           -------------------------------------------------------
3e82D           -------------------------------------------------------
2a2pA           -------------------------------------------------------
2dc1A           -------------------------------------------------------
1arzC           AVRSALWLSGKESGLFDM-------------------------------------
1dihA           AVRSALWLSGKESGLFDM-------------------------------------
3ed8C           -------------------------------------------------------
2c3gA           DWYTHTIEGVESVRLLFKDRGTNPGFFRDQDGWFDGEWHVDRP------------
1bvuA           -------------------------------------------------------
3cmmC           -------------------------------------------------------
2c3hD           DWYTHTIEGVESVRLLFKDRGTNQGFFRDQDGWFDGEWHVDR-------------
3db2C           -------------------------------------------------------
2c3hA           DWYTHTIEGVESVRLLFKPGPGEPGFFRDQDGWFDGEWHVDR-------------
3e9mB           -------------------------------------------------------
1b6sA           -------------------------------------------------------
2c3hB           DWYTHTIEGVESVRLLFKDRGTNPGFFRDQDGWFDGEWHVDR-------------
3dojA           -------------------------------------------------------
3c1aA           -------------------------------------------------------
1dapA           -------------------------------------------------------
2duwA           -------------------------------------------------------
3btsB           -------------------------------------------------------
3ec7A           -------------------------------------------------------
3e1kC           -------------------------------------------------------
2bh9A           -------------------------------------------------------
2bhlA           -------------------------------------------------------
1e7mA           -------------------------------------------------------
1e77A           -------------------------------------------------------
3e82E           -------------------------------------------------------
3dtyB           -------------------------------------------------------
3d1lB           -------------------------------------------------------
3dtyD           -------------------------------------------------------
2d5aA           -------------------------------------------------------
1dpgA           -------------------------------------------------------
2e77A           -------------------------------------------------------